Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0H029007.128ON1881889941e-139
YIL009C-A (EST3)7.128ON1811884013e-49
NDAI0E036907.128ON1961933902e-47
Sklu_YGOB_EST37.128ON1961893782e-45
Skud_9.1637.128ON1801873651e-43
NCAS0E021507.128ON1851873651e-43
Suva_9.1957.128ON1891963554e-42
Smik_9.1857.128ON1821893545e-42
Zrou_YGOB_EST37.128ON1681833501e-41
KNAG0L009607.128ON1851873362e-39
KAFR0L004807.128ON1801913075e-35
Kwal_YGOB_EST37.128ON1921922963e-33
CAGL0C03828g7.128ON1801862912e-32
TPHA0C043107.128ON2012042765e-30
ADL016C7.128ON2021882748e-30
Kpol_1062.557.128ON1821912599e-28
TBLA0A009607.128ON2151232341e-23
Kthe_YGOB_EST37.128ON1931922321e-23
KLLA0D14289g7.128ON1841992266e-23
Sklu_YGOB_Anc_7.128singletonOFF98971711e-15
ZYRO0C05258gsingletonOFF87941613e-14
Kwal_55.20848singletonOFF96981388e-11
KLTH0F12606gsingletonOFF96981212e-08
ZYRO0A08228g2.382ON540113730.51
Skud_2.2433.369ON139290691.7
SAKL0H00902g5.2ON580175682.4
CAGL0B03641g6.16ON98877672.8
NDAI0E010908.690ON46154655.3
KLLA0D16302g3.494ON22653646.0
Kpol_1051.255.267ON196889639.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0H02900
         (188 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0H02900 Chr8 complement(482608..482892,482894..483175) [567 ...   387   e-139
YIL009C-A Chr9 complement(335666..335935,335937..336212) [546 bp...   159   3e-49
NDAI0E03690 Chr5 complement(796355..796663,796665..796946) [591 ...   154   2e-47
Sklu_YGOB_EST3 Chr6 (413034..413324,413326..413625) [591 bp, 196...   150   2e-45
Skud_9.163 Chr9 complement(305622..305891,305890..306159) [540 b...   145   1e-43
NCAS0E02150 Chr5 complement(411717..411992,411994..412275) [558 ...   145   1e-43
Suva_9.195 Chr9 complement(324112..324381,324353..324373,324377....   141   4e-42
Smik_9.185 Chr9 complement(310275..310544,310543..310818) [546 b...   140   5e-42
Zrou_YGOB_EST3 Chr3 complement(410153..410401,410403..410660) [5...   139   1e-41
KNAG0L00960 Chr12 complement(176345..176620,176622..176903) [558...   134   2e-39
KAFR0L00480 Chr12 complement(87343..87603,87605..87886) [543 bp,...   122   5e-35
Kwal_YGOB_EST3 s55 complement(581681..581974,581976..582260) [57...   118   3e-33
CAGL0C03828g Chr3 (377164..377430,377432..377707) [543 bp, 180 a...   116   2e-32
TPHA0C04310 Chr3 (931642..931905,931907..932248) [606 bp, 201 aa...   110   5e-30
ADL016C Chr4 complement(680590..680914,680916..681199) [609 bp, ...   110   8e-30
Kpol_1062.55 s1062 (125085..125366,125368..125634) [549 bp, 182 ...   104   9e-28
TBLA0A00960 Chr1 complement(212858..213151,213153..213506) [648 ...    95   1e-23
Kthe_YGOB_EST3 Chr6 complement(1055444..1055740,1055742..1056026...    94   1e-23
KLLA0D14289g Chr4 (1215729..1216283) [555 bp, 184 aa] {ON} simil...    92   6e-23
Sklu_YGOB_Anc_7.128 Chr6 (413034..413330) [297 bp, 98 aa] {OFF} ...    70   1e-15
ZYRO0C05258g Chr3 complement(410397..410660) [264 bp, 87 aa] {OF...    67   3e-14
Kwal_55.20848 s55 complement(581970..582260) [291 bp, 96 aa] {OF...    58   8e-11
KLTH0F12606g Chr6 complement(1055736..1056026) [291 bp, 96 aa] {...    51   2e-08
ZYRO0A08228g Chr1 (661528..663150) [1623 bp, 540 aa] {ON} simila...    33   0.51 
Skud_2.243 Chr2 complement(438373..442551) [4179 bp, 1392 aa] {O...    31   1.7  
SAKL0H00902g Chr8 complement(103678..105420) [1743 bp, 580 aa] {...    31   2.4  
CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} simila...    30   2.8  
NDAI0E01090 Chr5 (214700..216085) [1386 bp, 461 aa] {ON} Anc_8.6...    30   5.3  
KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa] ...    29   6.0  
Kpol_1051.25 s1051 complement(51521..57427) [5907 bp, 1968 aa] {...    29   9.6  

>TDEL0H02900 Chr8 complement(482608..482892,482894..483175) [567 bp,
           188 aa] {ON} Anc_7.128 YIL009C-A
          Length = 188

 Score =  387 bits (994), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 188/188 (100%), Positives = 188/188 (100%)

Query: 1   MPKTILSSSSKQKDTVFLLPWIEKSIGPLIADESDIRLPVFNFIPKLQLKDLRKPQLSPR 60
           MPKTILSSSSKQKDTVFLLPWIEKSIGPLIADESDIRLPVFNFIPKLQLKDLRKPQLSPR
Sbjct: 1   MPKTILSSSSKQKDTVFLLPWIEKSIGPLIADESDIRLPVFNFIPKLQLKDLRKPQLSPR 60

Query: 61  ILRNPSHFVKVVKFHSVNRFQVFATVRDSAHQILVEFTPQCVSEFERTHRSRITLETEHS 120
           ILRNPSHFVKVVKFHSVNRFQVFATVRDSAHQILVEFTPQCVSEFERTHRSRITLETEHS
Sbjct: 61  ILRNPSHFVKVVKFHSVNRFQVFATVRDSAHQILVEFTPQCVSEFERTHRSRITLETEHS 120

Query: 121 LFIISDCKLYHRDRNYILKNFGIDMKNWQSAANHKRCSTIPVLIVNQASQFEMDQIESFE 180
           LFIISDCKLYHRDRNYILKNFGIDMKNWQSAANHKRCSTIPVLIVNQASQFEMDQIESFE
Sbjct: 121 LFIISDCKLYHRDRNYILKNFGIDMKNWQSAANHKRCSTIPVLIVNQASQFEMDQIESFE 180

Query: 181 HFPYLYTL 188
           HFPYLYTL
Sbjct: 181 HFPYLYTL 188

>YIL009C-A Chr9 complement(335666..335935,335937..336212) [546 bp,
           181 aa] {ON}  EST3Component of the telomerase
           holoenzyme, involved in telomere replication
          Length = 181

 Score =  159 bits (401), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 116/188 (61%), Gaps = 12/188 (6%)

Query: 1   MPKTILSSSSKQKDTVFLLPWIEKSIGPLIADES--DIRLPVFNFIPKLQLKDLRKPQLS 58
           MPK IL S SK  D+VFL PWI+     LI D S  D   P  + IP L  +DL  P +S
Sbjct: 1   MPKVILESHSKPTDSVFLQPWIKA----LIEDNSEHDQYHPSGHVIPSLTKQDLALPHMS 56

Query: 59  PRILRNPSHFVKVVKFHSVNRFQVFATVRDSAHQILVEFTPQCVSEFERTHRSRITLETE 118
           P IL NP HF K+ KF++V  ++V+A++RDS+HQILVEF+ +CVS FERTH  RIT ET 
Sbjct: 57  PTILTNPCHFAKITKFYNVCDYKVYASIRDSSHQILVEFSQECVSNFERTHNCRITSETT 116

Query: 119 HSLFIISDCKLYHRDRNYILKNFGIDMKNWQSAANHKRCSTIPVLIVNQASQFEMDQIES 178
           + L II D  L +   +  + +F I + N  S         +PVL VNQA+ F++DQ+ S
Sbjct: 117 NCLMIIGDADLVYVTNSRAMSHFKICLSNISSK------EIVPVLNVNQATIFDIDQVGS 170

Query: 179 FEHFPYLY 186
              FP++Y
Sbjct: 171 LSTFPFVY 178

>NDAI0E03690 Chr5 complement(796355..796663,796665..796946) [591 bp,
           196 aa] {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 196

 Score =  154 bits (390), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 119/193 (61%), Gaps = 11/193 (5%)

Query: 1   MPKTILSSSSKQKDTVFLLPWIEKSIGPLIADESDI----RLPVFNFIPKLQLKDLRKPQ 56
           MP+ ILSS     D+VFL PWI   I   I  ++ +    RL     I +L  +D+  P+
Sbjct: 1   MPRVILSSKQTVSDSVFLQPWIANIIRKEIQAKTYLPGNQRLS----IARLSRRDMDAPE 56

Query: 57  LSPRILRNPSHFVKVVKFHSVNRFQVFATVRDSAHQILVEFTPQCVSEFERTHRSRITLE 116
           +S  IL N SHF KV KF SVN +++FA++RDS +QILVEFTPQCV EFER +RSRIT E
Sbjct: 57  ISETILNNYSHFAKVTKFFSVNNYKIFASIRDSTYQILVEFTPQCVLEFERVYRSRITSE 116

Query: 117 TEHSLFIISDCKLYHRDRNYILKNF-GIDMKNWQSAANHKR--CSTIPVLIVNQASQFEM 173
           T + LF+I DC + ++ R+ I  +F   D+++     N  +      PVL +NQAS F+ 
Sbjct: 117 TVNCLFVIGDCTVIYKTRSQIRSSFPKFDLQSLAGEKNSNKNGFGLFPVLQINQASLFDS 176

Query: 174 DQIESFEHFPYLY 186
           DQ++    FP++Y
Sbjct: 177 DQVQLLFEFPFIY 189

>Sklu_YGOB_EST3 Chr6 (413034..413324,413326..413625) [591 bp, 196
           aa] {ON} ANNOTATED BY YGOB - Ribosomal frameshifting
           (Farabaugh, J Mol Evol 63:545, 2006)
          Length = 196

 Score =  150 bits (378), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 83/189 (43%), Positives = 117/189 (61%), Gaps = 8/189 (4%)

Query: 1   MPKTILSSSSKQKDTVFLLPWIEKSIGPLIADESDIRL--PVFNFIPKLQLKDLRKP-QL 57
           MPK  LSS +K+ D+++L  WI  SI P + ++  I +   V +F+P L  KD+     L
Sbjct: 1   MPKVALSSRNKESDSIYLHNWIVHSILPHVREKWAIGIIGDVRSFVPSLDDKDITSDVHL 60

Query: 58  SPRILRNPSHFVKVVKFHSVNRFQVFATVRDSAHQILVEFTPQCVSEFERTHRSRITLET 117
           S +I+ N  HF+K+ KF+ VN +QV+A+ RDS   ILVEFT  CVS FER H SRIT ET
Sbjct: 61  SRKIILNHRHFIKLTKFYQVNNYQVYASARDSLCSILVEFTACCVSNFERLHHSRITSET 120

Query: 118 EHSLFIISDCKLYHRDRNYILKNFGIDMKNWQSAANHKRCSTIPVLIVNQASQFEMDQIE 177
            ++LF+I D KL   D+  + + FGID+  +    N      +P+L VNQA  ++MDQ+E
Sbjct: 121 TNTLFVIGDVKLVFMDKASVSQKFGIDITQFNPQLN-----LVPILRVNQAFVYDMDQVE 175

Query: 178 SFEHFPYLY 186
           S   FP+ Y
Sbjct: 176 SNRKFPFFY 184

>Skud_9.163 Chr9 complement(305622..305891,305890..306159) [540 bp,
           180 aa] {ON} YIL009C-A (REAL)
          Length = 180

 Score =  145 bits (365), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 78/187 (41%), Positives = 112/187 (59%), Gaps = 11/187 (5%)

Query: 1   MPKTILSSSSKQKDTVFLLPWIEKSIGPLIADESDIRLPVFNFIPKLQLKDLRKPQLSPR 60
           MP+ IL S SK  D++FL PWI+     L+ D SD   P    IP L  +DL  P +S +
Sbjct: 1   MPRIILESHSKPADSIFLQPWIKA----LVKDNSDQHRPSERVIPSLTRQDLLVPHMSAQ 56

Query: 61  ILRNPSHFVKVVKFHSVNRFQVFATVRDSAHQI-LVEFTPQCVSEFERTHRSRITLETEH 119
           IL NP HF K+ +F+ V+ ++V A++RDS HQI LVEF+ +CVS+FER+H  RIT ET +
Sbjct: 57  ILTNPCHFTKITRFYDVSNYKVCASIRDSTHQILLVEFSEECVSDFERSHNCRITSETIN 116

Query: 120 SLFIISDCKLYHRDRNYILKNFGIDMKNWQSAANHKRCSTIPVLIVNQASQFEMDQIESF 179
            L II D  L +   N ++  F I + +            +PVL +NQ + F++DQ+ S 
Sbjct: 117 CLMIIGDADLIYVTSNQVMARFKIRVSSISPN------EILPVLKINQTTIFDIDQVGSL 170

Query: 180 EHFPYLY 186
             FP++Y
Sbjct: 171 STFPFVY 177

>NCAS0E02150 Chr5 complement(411717..411992,411994..412275) [558 bp,
           185 aa] {ON} Anc_7.128 YIL009C-A
          Length = 185

 Score =  145 bits (365), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 74/187 (39%), Positives = 109/187 (58%), Gaps = 4/187 (2%)

Query: 1   MPKTILSSSSKQKDTVFLLPWIEKSIGPLIADESDIRLPVFNFIPKLQLKDLRKPQLSPR 60
           MP+ ILSS   Q D++FL PWIE  +   +  ++ +       +P L   DLR PQ SP+
Sbjct: 1   MPRVILSSKLSQTDSIFLQPWIEGLLRESLQKKTYLPGNQQREVPSLNEADLRAPQCSPK 60

Query: 61  ILRNPSHFVKVVKFHSVNRFQVFATVRDSAHQILVEFTPQCVSEFERTHRSRITLETEHS 120
           +L N  HF KV KF  +N + + A++RDS  Q+LVEFTP+CVS FER H  R+T ET + 
Sbjct: 61  VLTNHCHFTKVTKFFKINNYAISASIRDSRFQLLVEFTPKCVSNFERRHHRRLTSETLNC 120

Query: 121 LFIISDCKLYHRDRNYILKNFGIDMKNWQSAANHKRCSTIPVLIVNQASQFEMDQIESFE 180
           L +I D  + ++ R+ I   FG    N     +      +P+L +NQAS F+ DQ++   
Sbjct: 121 LLVIGDAAIIYKSRDQITTQFG----NIDFIISKNVSPLVPILQINQASLFDGDQVQHLR 176

Query: 181 HFPYLYT 187
            FP++Y+
Sbjct: 177 SFPFVYS 183

>Suva_9.195 Chr9
           complement(324112..324381,324353..324373,324377..324652)
           [567 bp, 189 aa] {ON} YIL009C-A (REAL)
          Length = 189

 Score =  141 bits (355), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 78/196 (39%), Positives = 119/196 (60%), Gaps = 20/196 (10%)

Query: 1   MPKTILSSSSKQKDTVFLLPWIEKSIGPLIADESDIR-LPVFNFIPKLQLKDLRKPQLSP 59
           MP+  L S+S+Q D++FL PWI+     LI D S+   +P  + IP L  +DL  P + P
Sbjct: 1   MPRVFLESNSRQVDSIFLQPWIKL----LIDDNSEHHHIPSDHVIPALAQQDLALPHMCP 56

Query: 60  RILRNPSHFVKVVKFHSVNRFQVFATVRDSAHQ---------ILVEFTPQCVSEFERTHR 110
           +IL NP HF ++ +F++V  ++V+A+VRDS HQ         ILVEF+ +CVS+FER + 
Sbjct: 57  QILTNPFHFARITRFYNVCDYRVYASVRDSTHQILSVFREMCILVEFSEKCVSDFERINN 116

Query: 111 SRITLETEHSLFIISDCKLYHRDRNYILKNFGIDMKNWQSAANHKRCSTIPVLIVNQASQ 170
            RIT ET + L II D  L +      L  F I + +  ++       T+P+LI+NQA+ 
Sbjct: 117 FRITSETTNCLMIIGDADLAYVTSTQALARFMIRLSSISTS------ETVPILIINQATI 170

Query: 171 FEMDQIESFEHFPYLY 186
           F++DQ+ S  +FP++Y
Sbjct: 171 FDIDQVGSLNNFPFVY 186

>Smik_9.185 Chr9 complement(310275..310544,310543..310818) [546 bp,
           182 aa] {ON} YIL009C-A (REAL)
          Length = 182

 Score =  140 bits (354), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 77/189 (40%), Positives = 114/189 (60%), Gaps = 13/189 (6%)

Query: 1   MPKTILSSSSKQKDTVFLLPWIEKSIGPLIADESDIRL--PVFNFIPKLQLKDLRKPQLS 58
           MP+ +L S SK  D++FL PWI+     L+ D S+     P  + IP L  +DL+ P +S
Sbjct: 1   MPRVVLESHSKPTDSIFLQPWIKA----LVEDNSEHHQYHPSDHVIPVLTEQDLKLPHMS 56

Query: 59  PRILRNPSHFVKVVKFHSVNRFQVFATVRDSAHQI-LVEFTPQCVSEFERTHRSRITLET 117
            +IL NP HF K+ +F++V  ++V A++RDS HQI LVEF+P+CVS FER H  RIT ET
Sbjct: 57  AKILTNPCHFAKITRFYNVCDYKVCASIRDSTHQILLVEFSPECVSNFERIHNCRITAET 116

Query: 118 EHSLFIISDCKLYHRDRNYILKNFGIDMKNWQSAANHKRCSTIPVLIVNQASQFEMDQIE 177
            + L II D  L +   + +  +F I + +  S         +PVL +NQ + F++DQ+ 
Sbjct: 117 VNCLMIIGDASLINATSSRVKSHFKIRLSSISSN------DLVPVLQINQVTIFDIDQVG 170

Query: 178 SFEHFPYLY 186
           S   FP++Y
Sbjct: 171 SLSAFPFVY 179

>Zrou_YGOB_EST3 Chr3 complement(410153..410401,410403..410660) [507
           bp, 168 aa] {ON} ANNOTATED BY YGOB - Ribosomal
           frameshifting (Farabaugh, J Mol Evol 63:545, 2006)
          Length = 168

 Score =  139 bits (350), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 78/183 (42%), Positives = 113/183 (61%), Gaps = 19/183 (10%)

Query: 1   MPKTILSSSSKQKDTVFLLPWIEKSIGPLIADESDIRLPVFNFIPKLQLKDLRKPQLSPR 60
           MP+ I+S   K  D+VFL PWI+ ++      E D RL     IP +  +DL +P+LS +
Sbjct: 1   MPQAIVSV--KPFDSVFLQPWIQTALA-----EHDPRLGD-RLIPPVPTQDLSQPELSSK 52

Query: 61  ILRNPSHFVKVVKFHSVNRFQVFATVRDSAHQILVEFTPQCVSEFERTHRSRITLETEHS 120
           +L N  HFVKV +F  V+ + V+A++RDS  Q+LVEFTPQCVS+FER + +RIT ET + 
Sbjct: 53  VLSNIRHFVKVTRFFDVDHYTVYASIRDSKAQLLVEFTPQCVSDFERRYYTRITAETTNC 112

Query: 121 LFIISDCKLYHRDRNYILKNFGIDMKNWQSAANHKRCSTIPVLIVNQASQFEMDQIESFE 180
           +FII+DC+L +   +YI  ++ I  +              PVL VNQ + F+ DQ+ES E
Sbjct: 113 VFIIADCQLIYHSPSYIENHYKIVTRG-----------ETPVLRVNQTAIFDWDQVESLE 161

Query: 181 HFP 183
            +P
Sbjct: 162 TYP 164

>KNAG0L00960 Chr12 complement(176345..176620,176622..176903) [558
           bp, 185 aa] {ON} Anc_7.128 YIL009C-A ribosomal
           frameshifting
          Length = 185

 Score =  134 bits (336), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 76/187 (40%), Positives = 112/187 (59%), Gaps = 6/187 (3%)

Query: 1   MPKTILSSSS-KQKDTVFLLPWIEKSIGPLIADESDIRLPVFNFIPKLQLKDLRKPQLSP 59
           MP   LS +  K ++ +F  PWI K++  L  +E  +  PV   IPKL   DL+ P  S 
Sbjct: 1   MPAVKLSQTGHKFQEWIFTHPWI-KNLVKLPTEEISLMRPVRQIIPKLTTNDLKNPTRSK 59

Query: 60  RILRNPSHFVKVVKFHSVNRFQVFATVRDSAHQILVEFTPQCVSEFERTHRSRITLETEH 119
           R+L+N +HF KV+KF+SV+ ++VFA +RDS  Q+LVEF P+CVS FER H  RIT  T +
Sbjct: 60  RVLKNKTHFAKVMKFYSVHNYKVFACIRDSECQLLVEFHPECVSYFERFHHCRITSGTVN 119

Query: 120 SLFIISDCKLYHRDRNYILKNFGIDMKNWQSAANHKRCSTIPVLIVNQASQFEMDQIESF 179
            LF+I +C L +R    +   F I++         K    IPVL++NQA+  +  Q+E+ 
Sbjct: 120 CLFVIGNCDLEYRSVARVNDEFRINI----LPRKQKLMDQIPVLVINQATVADWGQMEAQ 175

Query: 180 EHFPYLY 186
             FP+++
Sbjct: 176 TTFPFVH 182

>KAFR0L00480 Chr12 complement(87343..87603,87605..87886) [543 bp,
           180 aa] {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 180

 Score =  122 bits (307), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 112/191 (58%), Gaps = 17/191 (8%)

Query: 1   MPKTILSSSSKQKDTVFLLPWIEKSIGPLIADESDIRL-PVFNFIPKLQLKDLRKPQLS- 58
           MP   L+S   + D++F+  WI+    PL+ +     L P++  IP +   ++R P  S 
Sbjct: 1   MPTVKLTSQHTRPDSIFIHDWIK----PLLDENCQGLLRPIYRAIPPINNTNVRNPLSSR 56

Query: 59  PRIL--RNPSHFVKVVKFHSVNRFQVFATVRDSAHQILVEFTPQCVSEFERTHRSRITLE 116
           P +L  +   HF K+VKF+ V  F++FA++RD+  QILVEFTP CVS FERT+R R+T +
Sbjct: 57  PSLLTTKVKCHFTKIVKFYKVENFKIFASIRDTRFQILVEFTPHCVSTFERTNRCRLTSD 116

Query: 117 TEHSLFIISDCKLYHRDRNYILKNFGIDMKNWQSAANHKRCSTIPVLIVNQASQFEMDQI 176
           T +   +I DC + ++  + I +N+ ++  N       KR   +PVL +NQAS  + DQ 
Sbjct: 117 TTNCTLLIGDCSIEYKSSHEISQNYRLNFPN-------KR--LLPVLTINQASILDRDQA 167

Query: 177 ESFEHFPYLYT 187
              E FP++Y+
Sbjct: 168 TLLEQFPFVYS 178

>Kwal_YGOB_EST3 s55 complement(581681..581974,581976..582260) [579
           bp, 192 aa] {ON} ANNOTATED BY YGOB - Ribosomal
           frameshifting (Farabaugh, J Mol Evol 63:545, 2006)
          Length = 192

 Score =  118 bits (296), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 71/192 (36%), Positives = 110/192 (57%), Gaps = 13/192 (6%)

Query: 1   MPKTILSSSSKQKDTVFLLPWIEKSIGPLIADESDIRLPVF----NFIPKLQLKDLRKPQ 56
           MPK       KQ+++ FL  WI++ +  ++  +  + LPV+     F+P +   D    Q
Sbjct: 1   MPKPSAIYKKKQRESCFLRSWIQQDVCEVV--KGHVSLPVWPAVERFVPSIVRSD-GPMQ 57

Query: 57  LSPRILRNPSHFVKVVKFHSVNRFQVFATVRDSAHQILVEFTPQCVSEFERTHRSRITLE 116
           LS ++L+N  HF+K+  FH ++ F V+A+ RD + QILVEFTP+CVS+FER H  RIT  
Sbjct: 58  LSSQLLQNRRHFLKITGFHKIHNFAVYASGRDDSCQILVEFTPKCVSQFERRHGLRITAR 117

Query: 117 TEHSLFIISDCKLYHRDRNYILKNFGIDMKNWQSAANHKRCSTIPVLIVNQASQFEMDQI 176
           T +++F+I    +      YI      +   W S  +  R   +PVL+VN+ + F++DQ+
Sbjct: 118 TVNTIFLIGAVTI-----KYIPIYEVRETWCWASDLD-TRIPVLPVLVVNECTVFDLDQV 171

Query: 177 ESFEHFPYLYTL 188
           ES   F YLY L
Sbjct: 172 ESRRKFNYLYHL 183

>CAGL0C03828g Chr3 (377164..377430,377432..377707) [543 bp, 180 aa]
           {ON} similar to uniprot|Q03096 Saccharomyces cerevisiae
           YIL009ca
          Length = 180

 Score =  116 bits (291), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 72/186 (38%), Positives = 106/186 (56%), Gaps = 9/186 (4%)

Query: 1   MPKTILSSSSKQKDTVFLLPWIEKSIGPLIADESDIRLPVFNFIPKLQLKDLRKPQLSPR 60
           MP  I  S S   ++V+L  W+      L+  ++   + V   IP++   +   P LS R
Sbjct: 1   MPPFIPKSRSNAVESVYLHGWVRDM---LLESKTSQNIAV---IPRVDPDEASIPLLSRR 54

Query: 61  ILRNPSHFVKVVKFHSVNRFQVFATVRDSAHQILVEFTPQCVSEFERTHRSRITLETEHS 120
           I  N  HFVK+ KF  V+ + V+A+V+DS HQIL +FTP+CVSEFE  +RSRIT +T ++
Sbjct: 55  IYANRRHFVKITKFFQVHNYSVYASVKDSQHQILSQFTPKCVSEFESRNRSRITSDTVNT 114

Query: 121 LFIISDCKLYHRDRNYILKNFGIDMKNWQSAANHKRCSTIPVLIVNQASQFEMDQIESFE 180
           LF+I D KL     + +   FG   +   S  N      IP LI+NQA   + DQ+E+F+
Sbjct: 115 LFMIGDAKLGIMVVDELRHYFG---EKIVSLFNGLDMPYIPYLIINQAFILDYDQVEAFK 171

Query: 181 HFPYLY 186
             P++Y
Sbjct: 172 MTPFVY 177

>TPHA0C04310 Chr3 (931642..931905,931907..932248) [606 bp, 201 aa]
           {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 201

 Score =  110 bits (276), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 111/204 (54%), Gaps = 24/204 (11%)

Query: 1   MPKTILSSSSK-QKDTVFLLPWIEKSIGPLIADESDIRLPVFNFIPKLQLKDLRKPQLSP 59
           MPK IL S      D++FL PWI++     I D     +     + +L      K QL  
Sbjct: 1   MPKIILPSKVNLSPDSIFLKPWIKE----FIEDGKKNSIGKIGNLDELLNNTNVKLQL-- 54

Query: 60  RILRNPSHFVKVVKFHSVNRFQVFATVRDSAHQILVEFTPQCVSEFERTHRSRITLETEH 119
            IL+ P+  VK+   +++  + VF ++RD+ HQ+LVEFT  CVS FER ++ RIT +T++
Sbjct: 55  -ILKYPNQLVKLTNIYNILNYCVFGSIRDNKHQLLVEFTSNCVSNFERNYKIRITDQTKN 113

Query: 120 SLFIISDCKLYHRDRNYILKNFGI---------------DMKNWQSAANHKRCSTI-PVL 163
            LF+I DC + +   + +LKNF I               D K +    + +R + + P+L
Sbjct: 114 CLFLIGDCIIKYVTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGYILSERRFNRLYPIL 173

Query: 164 IVNQASQFEMDQIESFEHFPYLYT 187
            VNQ   F+ DQ+ +FE++P++Y+
Sbjct: 174 QVNQVMIFDWDQVVTFENYPFVYS 197

>ADL016C Chr4 complement(680590..680914,680916..681199) [609 bp, 202
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YIL009C-A (EST3)
          Length = 202

 Score =  110 bits (274), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 68/188 (36%), Positives = 99/188 (52%), Gaps = 12/188 (6%)

Query: 1   MPKTILSSSSKQKDTVFLLPWIEKSIGPLIADESDIRLP---VFNFIPKLQLKDLRKPQL 57
           MPK +L+S + + D++FL  W+  ++ P + + S    P   V  FIP L         L
Sbjct: 1   MPKVVLASRAHKADSIFLREWLVDAVVPAL-ERSGACAPWAGVECFIPALP-PATATLSL 58

Query: 58  SPRILRNPSHFVKVVKFHSVNRFQVFATVRDSAHQILVEFTPQCVSEFERTHRSRITLET 117
            P +++NP  F+++V+F  V+ F V A  RD+   ILVEFTP CVS FER +  RIT  T
Sbjct: 59  EPTVIQNPKRFLRIVRFTRVHDFAVCAVARDAGCCILVEFTPHCVSNFERRYHQRITSST 118

Query: 118 EHSLFIISDCKLYHRDRNYILKNFGIDMKNWQSAANHKRCSTIPVLIVNQASQFEMDQIE 177
            +SLF+I +  L    R+     F +        A     ST+PVL V   + F+ DQ+E
Sbjct: 119 VNSLFVIGNTSLLFYARSDAAAAFEVP-------ALMNGSSTLPVLRVGDCAIFDQDQVE 171

Query: 178 SFEHFPYL 185
           S   FP +
Sbjct: 172 SHRRFPLV 179

>Kpol_1062.55 s1062 (125085..125366,125368..125634) [549 bp, 182 aa]
           {ON} (125085..125366,125368..125634) [549 nt, 183 aa]
          Length = 182

 Score =  104 bits (259), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 72/191 (37%), Positives = 100/191 (52%), Gaps = 14/191 (7%)

Query: 1   MPKTIL-SSSSKQKDTVFLLPWIEKSIGPLIADES-DIRLPVFNFIPKLQLKDLRKPQLS 58
           MPK IL S+ S   D+ +L  WI+     LI D + D    V   + +    D +    S
Sbjct: 1   MPKIILPSNKSSCVDSTYLQEWID-----LIIDRNYDNTGEVIPILDEYGFNDSQSYMSS 55

Query: 59  --PRILRNPSHFVKVVKFHSVNRFQVFATVRDSAHQILVEFTPQCVSEFERTHRSRITLE 116
               I++ P HF KV  F +V  + V+A++RD   Q+L EFT  CVS FER + SRIT  
Sbjct: 56  VINLIIKKPYHFAKVTNFFNVVDYSVYASIRDRKFQVLSEFTSNCVSSFERLYNSRITEN 115

Query: 117 TEHSLFIISDCKLYHRDRNYILKNFGIDMKNWQSAANHKRCSTIPVLIVNQASQFEMDQI 176
           T + LF+I DCKL       I + + +D+    S  N    S  PVL +NQA  F+  QI
Sbjct: 116 TINCLFLIGDCKLKFMTYWEIKELYKLDL---SSICNKN--SLYPVLSINQARMFDWSQI 170

Query: 177 ESFEHFPYLYT 187
           +SFE F ++Y 
Sbjct: 171 KSFEKFDWIYN 181

>TBLA0A00960 Chr1 complement(212858..213151,213153..213506) [648 bp,
           215 aa] {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 215

 Score = 94.7 bits (234), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 49/123 (39%), Positives = 75/123 (60%), Gaps = 2/123 (1%)

Query: 67  HFVKVVKFHSVNRFQVFATVRDSAHQILVEFTPQCVSEFERTHRSRITLETEHSLFIISD 126
           H +K+ KF  VN +++ A+V+D+  QILVE TP CV+E+ER  R R+T  T   LF+I D
Sbjct: 91  HIIKITKFFKVNNYKICASVQDAECQILVELTPICVTEYERKTRDRMTSNTLDCLFVIGD 150

Query: 127 CKLYHRDRNYILKNFGID-MKNWQSAANH-KRCSTIPVLIVNQASQFEMDQIESFEHFPY 184
           C+LY +++N +L NF  +  +N     N   R S IPVL++NQ    +    +S    P+
Sbjct: 151 CRLYFQNKNEVLHNFNCNTFRNIIPGLNALDRDSLIPVLVINQIICVDRHPSKSLSTLPF 210

Query: 185 LYT 187
           L++
Sbjct: 211 LHS 213

>Kthe_YGOB_EST3 Chr6 complement(1055444..1055740,1055742..1056026)
           [582 bp, 193 aa] {ON} ANNOTATED BY YGOB - Ribosomal
           frameshifting (Farabaugh, J Mol Evol 63:545, 2006).
           Replaces KLTH0F12606g.
          Length = 193

 Score = 94.0 bits (232), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 103/192 (53%), Gaps = 13/192 (6%)

Query: 1   MPKTILSSSSKQKDTVFLLPWIEKSIGPLIADESDIRLPVF----NFIPKLQLKDLRKPQ 56
           M K + S+  KQ ++VFL  WI   +  ++ + +   LP++    NF+P L       P 
Sbjct: 1   MNKIVSSAKEKQNESVFLREWILSDVLAVMKEHAP--LPIWPAVPNFVPPLAKLHGHVP- 57

Query: 57  LSPRILRNPSHFVKVVKFHSVNRFQVFATVRDSAHQILVEFTPQCVSEFERTHRSRITLE 116
               IL N  HF+K+  FH V +F VFA+ RD+  +ILVEFTPQCVS FER +  RIT +
Sbjct: 58  FKSEILLNRRHFLKITNFHRVEKFAVFASGRDNNCRILVEFTPQCVSAFERLNSIRITAK 117

Query: 117 TEHSLFIISDCKLYHRDRNYILKNFGIDMKNWQSAANHKRCSTIPVLIVNQASQFEMDQI 176
           T +++ +I    L +   +     + +      S     R   +PVL+V Q + F++DQ+
Sbjct: 118 TVNTILLIGSGTLKYLPVHEAYTQWSL------SIPLDPRVPVVPVLVVEQCAVFDLDQV 171

Query: 177 ESFEHFPYLYTL 188
           E+   F YLY L
Sbjct: 172 EARPSFDYLYQL 183

>KLLA0D14289g Chr4 (1215729..1216283) [555 bp, 184 aa] {ON} similar
           to uniprot|Q03096 Saccharomyces cerevisiae YIL009C-A
           EST3 Component of the telomerase holoenzyme involved in
           telomere replication
          Length = 184

 Score = 91.7 bits (226), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 61/199 (30%), Positives = 94/199 (47%), Gaps = 33/199 (16%)

Query: 1   MPKTILSSSSKQKDTVFLLPWIEKSIGP--LIADESDIRLPVFNFIPKLQLKDLRKPQLS 58
           MP  +LSS     D+VFL  WI+ S+ P  L  +++         +  L   D+ +    
Sbjct: 1   MPNVVLSSRLTNNDSVFLQEWIKPSVRPYYLKNEKTKFWPEQRELVTDLLEHDIIESAFQ 60

Query: 59  PRILRNPSHFVKVVKFHSVNRFQVFATVRDSAHQILVEFTPQCVSEFERTHRSRITLETE 118
             +   P  FV++VKFH VN + V+AT+RDS   IL  FT  CV ++E  +  RITL T 
Sbjct: 61  TALNPAPQRFVRIVKFHRVNDYTVYATIRDSTALILCYFTVDCVLDYETINNDRITLNTL 120

Query: 119 HSLFIISDCKLYHRDRNYILKNFGIDMKNWQSAANHKRCS-----------TIPVLIVNQ 167
           ++LF+I +                + ++ W    NH+ C             +PVL + +
Sbjct: 121 NTLFVIGN----------------VTLQFW----NHRECKLWFNQDFPGLRMVPVLKIEK 160

Query: 168 ASQFEMDQIESFEHFPYLY 186
           A  F+ DQI S   F ++Y
Sbjct: 161 ARMFDRDQISSNVQFEWVY 179

>Sklu_YGOB_Anc_7.128 Chr6 (413034..413330) [297 bp, 98 aa] {OFF}
          ANNOTATED BY YGOB -
          Length = 98

 Score = 70.5 bits (171), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 60/97 (61%), Gaps = 3/97 (3%)

Query: 1  MPKTILSSSSKQKDTVFLLPWIEKSIGPLIADESDIRL--PVFNFIPKLQLKDLRKP-QL 57
          MPK  LSS +K+ D+++L  WI  SI P + ++  I +   V +F+P L  KD+     L
Sbjct: 1  MPKVALSSRNKESDSIYLHNWIVHSILPHVREKWAIGIIGDVRSFVPSLDDKDITSDVHL 60

Query: 58 SPRILRNPSHFVKVVKFHSVNRFQVFATVRDSAHQIL 94
          S +I+ N  HF+K+ KF+ VN +QV+A+ RDS   IL
Sbjct: 61 SRKIILNHRHFIKLTKFYQVNNYQVYASARDSLCSIL 97

>ZYRO0C05258g Chr3 complement(410397..410660) [264 bp, 87 aa]
          {OFF} some similarities with uniprot|Q03096
          Saccharomyces cerevisiae YIL009C-A
          Length = 87

 Score = 66.6 bits (161), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 58/94 (61%), Gaps = 8/94 (8%)

Query: 1  MPKTILSSSSKQKDTVFLLPWIEKSIGPLIADESDIRLPVFNFIPKLQLKDLRKPQLSPR 60
          MP+ I+S   K  D+VFL PWI+ ++      E D RL     IP +  +DL +P+LS +
Sbjct: 1  MPQAIVSV--KPFDSVFLQPWIQTALA-----EHDPRL-GDRLIPPVPTQDLSQPELSSK 52

Query: 61 ILRNPSHFVKVVKFHSVNRFQVFATVRDSAHQIL 94
          +L N  HFVKV +F  V+ + V+A++RDS  Q+L
Sbjct: 53 VLSNIRHFVKVTRFFDVDHYTVYASIRDSKAQLL 86

>Kwal_55.20848 s55 complement(581970..582260) [291 bp, 96 aa]
          {OFF} [contig 138] FULL
          Length = 96

 Score = 57.8 bits (138), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 56/98 (57%), Gaps = 7/98 (7%)

Query: 1  MPKTILSSSSKQKDTVFLLPWIEKSIGPLIADESDIRLPVF----NFIPKLQLKDLRKPQ 56
          MPK       KQ+++ FL  WI++ +  ++  +  + LPV+     F+P +   D    Q
Sbjct: 1  MPKPSAIYKKKQRESCFLRSWIQQDVCEVV--KGHVSLPVWPAVERFVPSIVRSD-GPMQ 57

Query: 57 LSPRILRNPSHFVKVVKFHSVNRFQVFATVRDSAHQIL 94
          LS ++L+N  HF+K+  FH ++ F V+A+ RD + QIL
Sbjct: 58 LSSQLLQNRRHFLKITGFHKIHNFAVYASGRDDSCQIL 95

>KLTH0F12606g Chr6 complement(1055736..1056026) [291 bp, 96 aa]
          {OFF} no similarity
          Length = 96

 Score = 51.2 bits (121), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 52/98 (53%), Gaps = 7/98 (7%)

Query: 1  MPKTILSSSSKQKDTVFLLPWIEKSIGPLIADESDIRLPVF----NFIPKLQLKDLRKPQ 56
          M K + S+  KQ ++VFL  WI   +  ++ + +   LP++    NF+P L       P 
Sbjct: 1  MNKIVSSAKEKQNESVFLREWILSDVLAVMKEHAP--LPIWPAVPNFVPPLAKLHGHVP- 57

Query: 57 LSPRILRNPSHFVKVVKFHSVNRFQVFATVRDSAHQIL 94
              IL N  HF+K+  FH V +F VFA+ RD+  +IL
Sbjct: 58 FKSEILLNRRHFLKITNFHRVEKFAVFASGRDNNCRIL 95

>ZYRO0A08228g Chr1 (661528..663150) [1623 bp, 540 aa] {ON} similar
           to uniprot|P40215 Saccharomyces cerevisiae YMR145C NDE1
           Mitochondrial external NADH dehydrogenase
          Length = 540

 Score = 32.7 bits (73), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 42/113 (37%), Gaps = 23/113 (20%)

Query: 87  RDSAHQILVEFTPQCVSEFERTHRSRITLETEHSLFIISDCKLY----------HRDRNY 136
           RD    ++ +  PQ        +     L  E S+F I DC  Y          H++  Y
Sbjct: 367 RDVTKNLMNKLEPQDSRRGLLINEKLQLLGAEDSIFAIGDCTFYPGLFPTAQVAHQEGEY 426

Query: 137 ILKNF----GIDMKNWQSAANHKRCSTIPVLIVNQASQFEMDQIES-FEHFPY 184
           + K      G+D   WQ A   +           Q  +  +D+++  FEHF Y
Sbjct: 427 LAKALKKIHGVDQLKWQIAQAAEED--------KQMLESRLDKLQGDFEHFKY 471

>Skud_2.243 Chr2 complement(438373..442551) [4179 bp, 1392 aa] {ON}
            YBR115C (REAL)
          Length = 1392

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 41/90 (45%), Gaps = 18/90 (20%)

Query: 79   RFQVFATVRDSAHQILVEFTPQCVSEFERTHRSRITLETEHSLFIISDCKLYHRDRNYIL 138
            RF+VFA VR    +          + FER H++ IT  T +  F +S  ++   D +   
Sbjct: 999  RFKVFAHVRAKDEE----------AAFERLHKAGITYGTWNEKFALS-IEIVLGDLSK-- 1045

Query: 139  KNFGIDMKNWQSAANHKRCSTIPVLIVNQA 168
              FG+  + W   AN     TI V+I N A
Sbjct: 1046 SQFGLSDEKWSDLAN-----TIDVIIHNGA 1070

>SAKL0H00902g Chr8 complement(103678..105420) [1743 bp, 580 aa] {ON}
           highly similar to uniprot|Q751N4 Ashbya gossypii AGL337C
           AGL337Cp and similar to uniprot|P40308 YMR313C
           Saccharomyces cerevisiae TGL3 Triacylglycerol lipase of
           the lipid particle
          Length = 580

 Score = 30.8 bits (68), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 39/175 (22%), Positives = 73/175 (41%), Gaps = 16/175 (9%)

Query: 9   SSKQKDTVFLLPWIEKSIGPLIADESDIR--LPVFNFIPKLQLKDLRKPQLSPRILRNPS 66
           + K KD VFL P      G + +  + +     V NFI  L      +P L+P ++ +  
Sbjct: 377 TDKTKDLVFLTPQNASESGLIESPYTRLTELFNVNNFIVSLA-----RPYLAPLVINDLK 431

Query: 67  HFVKVVKFHSVNRFQVFATVRDSAHQI--LVEFTPQCVS---EFERTHRSRITLETEHSL 121
           H +K  K++    +        SAHQ+  L    P         ER  +  +T+E  H +
Sbjct: 432 HEIKTSKYYYYKHYPTDDIGAYSAHQLSTLTNVEPLAFKFKYHLERKIKQIVTMEFRHRV 491

Query: 122 FIISDCKLYHRDRNYILKNFGIDMKNWQSAANHKRCSTIPVLIVNQASQFEMDQI 176
            ++ +  +     ++ +K   ID K  +SA        +  L +++  + ++D I
Sbjct: 492 EVLDNLGIL----SHWIKILAIDEKTPRSATEVTIVPHLKSLSLSRVIEGQLDNI 542

>CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} similar
           to uniprot|P27895 Saccharomyces cerevisiae YEL061c CIN8
           Kinesin-like protein
          Length = 988

 Score = 30.4 bits (67), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 6/77 (7%)

Query: 3   KTILSSSSKQKDTVFLLPW----IEKSIGPLIADE-SDIRLPVFNFIPKLQLK-DLRKPQ 56
           K +  ++ + K T+ L  +    +++SI   I+DE S+IR  +   I  LQ   DL+  +
Sbjct: 594 KDVQGANEEMKKTIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTE 653

Query: 57  LSPRILRNPSHFVKVVK 73
           +S  ++R     VKV+K
Sbjct: 654 ISGNLMRLEKEVVKVIK 670

>NDAI0E01090 Chr5 (214700..216085) [1386 bp, 461 aa] {ON} Anc_8.690
           YOR250C
          Length = 461

 Score = 29.6 bits (65), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 28/54 (51%)

Query: 94  LVEFTPQCVSEFERTHRSRITLETEHSLFIISDCKLYHRDRNYILKNFGIDMKN 147
           L E TP+   +  +TH+  +   TE  + I +  KL  + R+ I + FG ++ N
Sbjct: 7   LTELTPELYLDVNKTHQLTLKESTEWKIDIPTSSKLTIKIRSGIAEIFGTELAN 60

>KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa]
          {ON} similar to uniprot|P40961 Saccharomyces cerevisiae
          YGR132C
          Length = 226

 Score = 29.3 bits (64), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 6/53 (11%)

Query: 13 KDTVFLLPWIEKSIGPLIADESDIRLPVFNFIPKLQLKDLRKPQLSPRILRNP 65
          + T FL+PW++KSI        D+R    N       KDL+   L+ R+L  P
Sbjct: 51 EGTHFLVPWLQKSI------LFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRP 97

>Kpol_1051.25 s1051 complement(51521..57427) [5907 bp, 1968 aa] {ON}
           complement(51521..57427) [5907 nt, 1969 aa]
          Length = 1968

 Score = 28.9 bits (63), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 43/89 (48%), Gaps = 1/89 (1%)

Query: 99  PQCVSEFERTHRSRITLETEHSLFIISDCKLYHRDRNYILKNFGIDMKNWQSAANHKRCS 158
           P+  +  E  H+S+ +L+++  L  +S   LY    +YI+     ++K++ SA      S
Sbjct: 414 PKSKAGREWVHKSKNSLQSKSILNALSRT-LYENLFDYIVSKINENLKSYHSATGSDVGS 472

Query: 159 TIPVLIVNQASQFEMDQIESFEHFPYLYT 187
               + +   + FE+ +  SFE F   YT
Sbjct: 473 NYKFISILDIAGFEIFEKNSFEQFCINYT 501

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.137    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,680,029
Number of extensions: 788379
Number of successful extensions: 2535
Number of sequences better than 10.0: 42
Number of HSP's gapped: 2552
Number of HSP's successfully gapped: 42
Length of query: 188
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 85
Effective length of database: 41,670,801
Effective search space: 3542018085
Effective search space used: 3542018085
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 62 (28.5 bits)