Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0H028807.126ON35435417010.0
SAKL0F05368g7.126ON2311546273e-80
KLLA0D14333g7.126ON2051626081e-77
CAGL0C03850g7.126ON2091526072e-77
KAFR0K012007.126ON2021576036e-77
NDAI0H013107.126ON2611666001e-75
Suva_9.1947.126ON2151765872e-74
ZYRO0C05214g7.126ON2701445905e-74
Smik_9.1847.126ON2141715855e-74
Ecym_83517.126ON2241475856e-74
Skud_9.1627.126ON2171605847e-74
Kpol_1062.577.126ON2191485831e-73
KNAG0G010207.126ON2071645784e-73
YIL010W (DOT5)7.126ON2151665733e-72
ADL018W7.126ON2441485738e-72
TBLA0A009407.126ON2881505647e-70
TPHA0C043307.126ON2091665402e-67
NCAS0F008107.126ON2311695362e-66
Kwal_55.208397.126ON3051485362e-65
KLTH0F12562g7.126ON2931774925e-59
Kpol_1004.598.300ON176109730.87
Smik_12.1698.300ON17695674.1
NDAI0D03540na 1ON110734694.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0H02880
         (354 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0H02880 Chr8 (479958..481022) [1065 bp, 354 aa] {ON} Anc_7.1...   659   0.0  
SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {O...   246   3e-80
KLLA0D14333g Chr4 complement(1218148..1218765) [618 bp, 205 aa] ...   238   1e-77
CAGL0C03850g Chr3 complement(377957..378586) [630 bp, 209 aa] {O...   238   2e-77
KAFR0K01200 Chr11 complement(247261..247869) [609 bp, 202 aa] {O...   236   6e-77
NDAI0H01310 Chr8 (318386..319171) [786 bp, 261 aa] {ON} Anc_7.12...   235   1e-75
Suva_9.194 Chr9 (323335..323982) [648 bp, 215 aa] {ON} YIL010W (...   230   2e-74
ZYRO0C05214g Chr3 (407597..408409) [813 bp, 270 aa] {ON} some si...   231   5e-74
Smik_9.184 Chr9 (309471..310115) [645 bp, 214 aa] {ON} YIL010W (...   229   5e-74
Ecym_8351 Chr8 complement(702059..702733) [675 bp, 224 aa] {ON} ...   229   6e-74
Skud_9.162 Chr9 (304819..305472) [654 bp, 217 aa] {ON} YIL010W (...   229   7e-74
Kpol_1062.57 s1062 complement(128150..128809) [660 bp, 219 aa] {...   229   1e-73
KNAG0G01020 Chr7 complement(217202..217825) [624 bp, 207 aa] {ON...   227   4e-73
YIL010W Chr9 (334882..335529) [648 bp, 215 aa] {ON}  DOT5Nuclear...   225   3e-72
ADL018W Chr4 (678193..678927) [735 bp, 244 aa] {ON} Syntenic hom...   225   8e-72
TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.12...   221   7e-70
TPHA0C04330 Chr3 complement(934432..935061) [630 bp, 209 aa] {ON...   212   2e-67
NCAS0F00810 Chr6 (165372..166067) [696 bp, 231 aa] {ON} Anc_7.12...   211   2e-66
Kwal_55.20839 s55 (579138..580055) [918 bp, 305 aa] {ON} YIL010W...   211   2e-65
KLTH0F12562g Chr6 (1052954..1053835) [882 bp, 293 aa] {ON} simil...   194   5e-59
Kpol_1004.59 s1004 (127836..128366) [531 bp, 176 aa] {ON} (12783...    33   0.87 
Smik_12.169 Chr12 (348877..349407) [531 bp, 176 aa] {ON} YLR109W...    30   4.1  
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    31   4.9  

>TDEL0H02880 Chr8 (479958..481022) [1065 bp, 354 aa] {ON} Anc_7.126
           YIL010W
          Length = 354

 Score =  659 bits (1701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/354 (93%), Positives = 332/354 (93%)

Query: 1   MXXXXXXXXXXXPPAGEDETGVKGEELWKLSKDESAPKGRRGSKSKKDATKPPAGEDETG 60
           M           PPAGEDETGVKGEELWKLSKDESAPKGRRGSKSKKDATKPPAGEDETG
Sbjct: 1   MSKKSKTSESTKPPAGEDETGVKGEELWKLSKDESAPKGRRGSKSKKDATKPPAGEDETG 60

Query: 61  GKGEELWKLPRGESASSKARRGSRTSKHKNDSSKPPAGEDETGVAGEELWKLPRKEGAES 120
           GKGEELWKLPRGESASSKARRGSRTSKHKNDSSKPPAGEDETGVAGEELWKLPRKEGAES
Sbjct: 61  GKGEELWKLPRGESASSKARRGSRTSKHKNDSSKPPAGEDETGVAGEELWKLPRKEGAES 120

Query: 121 ESTKPPAGEDETGKEGEELWKLHKDEGAKPRRGSKSSDKTKPLAXXXXXXXXXXXLWKLP 180
           ESTKPPAGEDETGKEGEELWKLHKDEGAKPRRGSKSSDKTKPLA           LWKLP
Sbjct: 121 ESTKPPAGEDETGKEGEELWKLHKDEGAKPRRGSKSSDKTKPLAGEDETGGEGEELWKLP 180

Query: 181 KKDEKETDVAEDSDQTAQSTELDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAYPK 240
           KKDEKETDVAEDSDQTAQSTELDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAYPK
Sbjct: 181 KKDEKETDVAEDSDQTAQSTELDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAYPK 240

Query: 241 ASTPGCTRQACGYRDNYDELKEHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVLIG 300
           ASTPGCTRQACGYRDNYDELKEHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVLIG
Sbjct: 241 ASTPGCTRQACGYRDNYDELKEHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVLIG 300

Query: 301 HLGAKKTAQSGTLRSHWVFFDGKLKYKRVKVSPEVSIQDGKKEVLELAASLQNE 354
           HLGAKKTAQSGTLRSHWVFFDGKLKYKRVKVSPEVSIQDGKKEVLELAASLQNE
Sbjct: 301 HLGAKKTAQSGTLRSHWVFFDGKLKYKRVKVSPEVSIQDGKKEVLELAASLQNE 354

>SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {ON}
           highly similar to gnl|GLV|KLLA0D14333g Kluyveromyces
           lactis KLLA0D14333g and similar to YIL010W
           uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 231

 Score =  246 bits (627), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 133/154 (86%)

Query: 199 STELDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAYPKASTPGCTRQACGYRDNYD 258
           S+EL++GD+IPD+ L+NQD KD+SL+++AK+++I++ FAYPKASTPGCTRQ CGYRDNY+
Sbjct: 71  SSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVFFAYPKASTPGCTRQVCGYRDNYE 130

Query: 259 ELKEHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVLIGHLGAKKTAQSGTLRSHWV 318
           +LKEHAAVFGLS D   AQK FQTKQSLP+DLL DP R  IG LGAKKT QSG +RSHWV
Sbjct: 131 DLKEHAAVFGLSADTTKAQKNFQTKQSLPYDLLSDPKREFIGLLGAKKTPQSGVIRSHWV 190

Query: 319 FFDGKLKYKRVKVSPEVSIQDGKKEVLELAASLQ 352
           F +GKL++KRVK+SPE S+ DGKKEVLELA  L+
Sbjct: 191 FSEGKLRFKRVKISPETSVADGKKEVLELAKDLE 224

>KLLA0D14333g Chr4 complement(1218148..1218765) [618 bp, 205 aa]
           {ON} similar to uniprot|P40553 Saccharomyces cerevisiae
           YIL010W DOT5 Nuclear thiol peroxidase
          Length = 205

 Score =  238 bits (608), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 110/162 (67%), Positives = 133/162 (82%)

Query: 190 AEDSDQTAQSTELDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAYPKASTPGCTRQ 249
            ++ D   +  EL IGD+IPD+TL NQD + +SL++VA ++K+++ FAYPKASTPGCTRQ
Sbjct: 44  VKNEDSANKLAELQIGDDIPDLTLLNQDDEPISLKEVASKNKLVVFFAYPKASTPGCTRQ 103

Query: 250 ACGYRDNYDELKEHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVLIGHLGAKKTAQ 309
           ACGYRDNY ELKEHAAVFGLS D   +QK FQTKQ+LPFDLL DP R  IG LGAKKTA 
Sbjct: 104 ACGYRDNYSELKEHAAVFGLSADAPKSQKSFQTKQALPFDLLSDPKREFIGALGAKKTAV 163

Query: 310 SGTLRSHWVFFDGKLKYKRVKVSPEVSIQDGKKEVLELAASL 351
           SG +RSHW+F +GKL+ KRV+VSPEVSI++GKKEVLELA SL
Sbjct: 164 SGVVRSHWIFKNGKLEVKRVQVSPEVSIEEGKKEVLELAKSL 205

>CAGL0C03850g Chr3 complement(377957..378586) [630 bp, 209 aa] {ON}
           similar to uniprot|P40553 Saccharomyces cerevisiae
           YIL010w DOT5 involved in derepression of telomeric
           silencing
          Length = 209

 Score =  238 bits (607), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 129/152 (84%)

Query: 202 LDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAYPKASTPGCTRQACGYRDNYDELK 261
           L++GD+IPD+TLQNQDGKDVSL+ +AKE+K+IIIF YPKASTPGCTRQACG+RDN+D+LK
Sbjct: 58  LEVGDDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGCTRQACGFRDNFDDLK 117

Query: 262 EHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVLIGHLGAKKTAQSGTLRSHWVFFD 321
           EH  V GLS D  +AQ KF+ K SLP+DLLCDP R  IG LGAKKT  SG++RSH+VF D
Sbjct: 118 EHGLVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAKKTPASGSIRSHFVFAD 177

Query: 322 GKLKYKRVKVSPEVSIQDGKKEVLELAASLQN 353
           GKLK+KR+K+SPE+S+ DGKKEVLELA    N
Sbjct: 178 GKLKFKRLKISPEISVADGKKEVLELAKQYSN 209

>KAFR0K01200 Chr11 complement(247261..247869) [609 bp, 202 aa] {ON}
           Anc_7.126 YIL010W
          Length = 202

 Score =  236 bits (603), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 131/157 (83%)

Query: 192 DSDQTAQSTELDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAYPKASTPGCTRQAC 251
           +S     S+EL IGD +PD+TL NQD + +SL++VAK +KI+++FAYPKASTPGCTRQAC
Sbjct: 41  ESSGNVSSSELQIGDIMPDITLMNQDNQKISLQEVAKNNKILVLFAYPKASTPGCTRQAC 100

Query: 252 GYRDNYDELKEHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVLIGHLGAKKTAQSG 311
           G+RDNYDE+K+HAAVFGLS D+  +QK+FQ KQ+LPF+LL DP R LIG LGAKKT QSG
Sbjct: 101 GFRDNYDEIKKHAAVFGLSADSVVSQKRFQEKQNLPFELLSDPKRELIGILGAKKTPQSG 160

Query: 312 TLRSHWVFFDGKLKYKRVKVSPEVSIQDGKKEVLELA 348
            +RSHWVF DGKL+++ +KVSPE SI + KKEV+ELA
Sbjct: 161 IIRSHWVFLDGKLRFRNIKVSPERSISESKKEVMELA 197

>NDAI0H01310 Chr8 (318386..319171) [786 bp, 261 aa] {ON} Anc_7.126
           YIL010W
          Length = 261

 Score =  235 bits (600), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 135/166 (81%)

Query: 186 ETDVAEDSDQTAQSTELDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAYPKASTPG 245
           E  V++ S       EL+IGD+IPD+TL NQ+GK++SL+++AK +KII+IFA+P+ASTPG
Sbjct: 93  EQQVSDKSANNDSIIELEIGDDIPDITLSNQNGKEISLKEIAKTNKIIVIFAFPRASTPG 152

Query: 246 CTRQACGYRDNYDELKEHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVLIGHLGAK 305
           CTRQACG+RDNYDELK++A VFGLS D  S+QKKF+ KQ LP+DLL DP R LIG LGAK
Sbjct: 153 CTRQACGFRDNYDELKKNAIVFGLSADAISSQKKFEEKQHLPYDLLSDPKRQLIGLLGAK 212

Query: 306 KTAQSGTLRSHWVFFDGKLKYKRVKVSPEVSIQDGKKEVLELAASL 351
           KT QSGT+RS+W+F +GKL  KR+KVSPE+S+ + KKEV+E A  L
Sbjct: 213 KTPQSGTVRSYWIFVEGKLSIKRIKVSPEISVAESKKEVIEFAKKL 258

>Suva_9.194 Chr9 (323335..323982) [648 bp, 215 aa] {ON} YIL010W
           (REAL)
          Length = 215

 Score =  230 bits (587), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 137/176 (77%), Gaps = 1/176 (0%)

Query: 179 LPKKDEKETDVAEDSDQTAQSTELDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAY 238
           +PK D +E    ED      + EL +GD+IPD++L N+D   VSL+++AKE+KI++ F Y
Sbjct: 41  VPKLDIEEPVKREDHSSLG-ANELKVGDDIPDLSLLNEDNDPVSLKEIAKENKIVVFFVY 99

Query: 239 PKASTPGCTRQACGYRDNYDELKEHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVL 298
           PKASTPGCTRQACG+RDNY++LKEHAAVFGLS D+  +QKKFQTKQ LP+ LL DP R  
Sbjct: 100 PKASTPGCTRQACGFRDNYEDLKEHAAVFGLSADSVISQKKFQTKQKLPYHLLSDPKREF 159

Query: 299 IGHLGAKKTAQSGTLRSHWVFFDGKLKYKRVKVSPEVSIQDGKKEVLELAASLQNE 354
           IG LGAKKT  SG++RSH+VF DGKL++KRVK+SPEVS+ D KKEV+ELA   + E
Sbjct: 160 IGLLGAKKTPLSGSIRSHFVFVDGKLRFKRVKISPEVSVGDAKKEVMELAEKFEKE 215

>ZYRO0C05214g Chr3 (407597..408409) [813 bp, 270 aa] {ON} some
           similarities with uniprot|P40553 Saccharomyces
           cerevisiae YIL010W DOT5 Nuclear thiol peroxidase
          Length = 270

 Score =  231 bits (590), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 125/144 (86%)

Query: 205 GDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAYPKASTPGCTRQACGYRDNYDELKEHA 264
           GD IPD+ L+NQDGK++SL+ V+ EHKI++IF YPKASTPGCTRQACG+RDNY+++KEHA
Sbjct: 95  GDPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHA 154

Query: 265 AVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVLIGHLGAKKTAQSGTLRSHWVFFDGKL 324
           AVFGLS D  +AQKKFQ KQ LPFDLL DP R L+G LGAKK+ +SG +RSHWVF DG L
Sbjct: 155 AVFGLSADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVL 214

Query: 325 KYKRVKVSPEVSIQDGKKEVLELA 348
           K+KRVK+SPEVSI++GKKEVLEL 
Sbjct: 215 KHKRVKISPEVSIEEGKKEVLELV 238

>Smik_9.184 Chr9 (309471..310115) [645 bp, 214 aa] {ON} YIL010W
           (REAL)
          Length = 214

 Score =  229 bits (585), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 104/171 (60%), Positives = 137/171 (80%), Gaps = 4/171 (2%)

Query: 182 KDEKETDVAEDSDQ----TAQSTELDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFA 237
           K + +  V+E  DQ     + STEL IGD IPD++L ++D   +SL+ +A+E+KI++ F 
Sbjct: 39  KTDLKVKVSETEDQGDNSASTSTELKIGDPIPDLSLLSEDNDSISLKKIAEENKIVVFFV 98

Query: 238 YPKASTPGCTRQACGYRDNYDELKEHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRV 297
           YPKASTPGCTRQACG+RDNYD+LK+H+AVFGLS D+ ++QK+FQTKQ+LP+ LL DP R 
Sbjct: 99  YPKASTPGCTRQACGFRDNYDDLKKHSAVFGLSSDSVTSQKRFQTKQNLPYHLLSDPKRE 158

Query: 298 LIGHLGAKKTAQSGTLRSHWVFFDGKLKYKRVKVSPEVSIQDGKKEVLELA 348
            IG LGAKKT  SG++RSH+VF DGKL++KRVK+SPEVS+ D KKE+LELA
Sbjct: 159 FIGLLGAKKTPLSGSIRSHFVFVDGKLRFKRVKISPEVSVNDAKKEILELA 209

>Ecym_8351 Chr8 complement(702059..702733) [675 bp, 224 aa] {ON}
           similar to Ashbya gossypii ADL018W
          Length = 224

 Score =  229 bits (585), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 128/147 (87%)

Query: 201 ELDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAYPKASTPGCTRQACGYRDNYDEL 260
           EL++GD +P++ L+NQD K+V+L+DVAK++KI++IFAYPKA+TPGCTRQACG+RDNY+EL
Sbjct: 70  ELEVGDNVPEIALKNQDDKEVNLKDVAKKNKIVLIFAYPKANTPGCTRQACGFRDNYEEL 129

Query: 261 KEHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVLIGHLGAKKTAQSGTLRSHWVFF 320
           ++HA +FG+S D+  +QK FQ+KQ LPFDLL DP R LIG LGAKKTAQ+G +RSHW+F 
Sbjct: 130 QKHAVIFGISSDSVKSQKAFQSKQHLPFDLLSDPDRELIGMLGAKKTAQAGVIRSHWIFC 189

Query: 321 DGKLKYKRVKVSPEVSIQDGKKEVLEL 347
           +GKLKYKRVKVSPE SI +G +EVL L
Sbjct: 190 NGKLKYKRVKVSPETSISEGLEEVLGL 216

>Skud_9.162 Chr9 (304819..305472) [654 bp, 217 aa] {ON} YIL010W
           (REAL)
          Length = 217

 Score =  229 bits (584), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 99/160 (61%), Positives = 133/160 (83%)

Query: 189 VAEDSDQTAQSTELDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAYPKASTPGCTR 248
           V  + D  + +TEL+IGD IPD++L ++D   +SL+++AKE+KI++ F YPKASTPGCTR
Sbjct: 50  VKSEDDSLSAATELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPGCTR 109

Query: 249 QACGYRDNYDELKEHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVLIGHLGAKKTA 308
           QACG+RDNY++LK+HAAVFGLS D  ++QKKFQTKQ+LP+ L+ DP R  IG LGAKKT 
Sbjct: 110 QACGFRDNYEDLKKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAKKTP 169

Query: 309 QSGTLRSHWVFFDGKLKYKRVKVSPEVSIQDGKKEVLELA 348
            SG++RSH+VF +GKL++KR+K+SPEVS+ D KKEVLE+A
Sbjct: 170 LSGSIRSHFVFVNGKLRFKRIKISPEVSVSDAKKEVLEIA 209

>Kpol_1062.57 s1062 complement(128150..128809) [660 bp, 219 aa] {ON}
           complement(128150..128809) [660 nt, 220 aa]
          Length = 219

 Score =  229 bits (583), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 125/148 (84%)

Query: 201 ELDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAYPKASTPGCTRQACGYRDNYDEL 260
           E++IGDEIPD+ L+NQDG  +SLR +AK++ I++ FAYP+A TPGCTRQACG+RD YD+L
Sbjct: 67  EVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGFRDTYDDL 126

Query: 261 KEHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVLIGHLGAKKTAQSGTLRSHWVFF 320
           K+HAAVFGLS D+  +QKKFQ K SLP+DLL DP R  IG LGAKKT QSG +RSH++F 
Sbjct: 127 KKHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFIGLLGAKKTPQSGIIRSHFIFV 186

Query: 321 DGKLKYKRVKVSPEVSIQDGKKEVLELA 348
           DGKL++KR+K+SPE+S+ DGKKEVLE+ 
Sbjct: 187 DGKLRFKRIKISPEISVNDGKKEVLEIV 214

>KNAG0G01020 Chr7 complement(217202..217825) [624 bp, 207 aa] {ON}
           Anc_7.126 YIL010W
          Length = 207

 Score =  227 bits (578), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 103/164 (62%), Positives = 133/164 (81%), Gaps = 1/164 (0%)

Query: 189 VAEDSDQ-TAQSTELDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAYPKASTPGCT 247
           VAE  D+    +  L+IGDEIPD+TL +Q+G+ VSL +VA  +KI++IFAYP+ASTPGCT
Sbjct: 44  VAETEDKPLVDAKVLEIGDEIPDLTLVDQEGELVSLTEVASNNKILVIFAYPRASTPGCT 103

Query: 248 RQACGYRDNYDELKEHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVLIGHLGAKKT 307
           RQACG+RDNY ELK+HAAV+GLS D  ++QKKFQTKQ+LP++LL DP R  IG LGAKKT
Sbjct: 104 RQACGFRDNYAELKKHAAVYGLSADTVASQKKFQTKQNLPYNLLSDPKREFIGVLGAKKT 163

Query: 308 AQSGTLRSHWVFFDGKLKYKRVKVSPEVSIQDGKKEVLELAASL 351
           +QSG +RS+W+FF+GKL+ K++KVSPE S+ + K EVLEL   L
Sbjct: 164 SQSGIIRSYWIFFNGKLRIKKIKVSPEASVAESKAEVLELVKEL 207

>YIL010W Chr9 (334882..335529) [648 bp, 215 aa] {ON}  DOT5Nuclear
           thiol peroxidase which functions as an
           alkyl-hydroperoxide reductase during post-diauxic growth
          Length = 215

 Score =  225 bits (573), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 134/166 (80%)

Query: 189 VAEDSDQTAQSTELDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAYPKASTPGCTR 248
           V +++++++   EL+IGD IPD++L N+D   +SL+ + + +++++ F YP+ASTPGCTR
Sbjct: 50  VVQEANRSSDVNELEIGDPIPDLSLLNEDNDSISLKKITENNRVVVFFVYPRASTPGCTR 109

Query: 249 QACGYRDNYDELKEHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVLIGHLGAKKTA 308
           QACG+RDNY ELK++AAVFGLS D+ ++QKKFQ+KQ+LP+ LL DP R  IG LGAKKT 
Sbjct: 110 QACGFRDNYQELKKYAAVFGLSADSVTSQKKFQSKQNLPYHLLSDPKREFIGLLGAKKTP 169

Query: 309 QSGTLRSHWVFFDGKLKYKRVKVSPEVSIQDGKKEVLELAASLQNE 354
            SG++RSH++F DGKLK+KRVK+SPEVS+ D KKEVLE+A   + E
Sbjct: 170 LSGSIRSHFIFVDGKLKFKRVKISPEVSVNDAKKEVLEVAEKFKEE 215

>ADL018W Chr4 (678193..678927) [735 bp, 244 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL010W (DOT5)
          Length = 244

 Score =  225 bits (573), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 120/148 (81%)

Query: 201 ELDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAYPKASTPGCTRQACGYRDNYDEL 260
           EL +GD +P++TL+NQD  DV L DV K++KI+++FAYPKASTPGCTRQACG+RDNY EL
Sbjct: 86  ELQVGDVLPEITLKNQDQADVKLSDVVKKNKIVVLFAYPKASTPGCTRQACGFRDNYQEL 145

Query: 261 KEHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVLIGHLGAKKTAQSGTLRSHWVFF 320
           ++HA VFG+S D+  +QK FQ KQ LPFDLL DP R LIG LGA+KTAQ+G +RSHWVF 
Sbjct: 146 QKHAVVFGISADSVKSQKSFQQKQKLPFDLLSDPKRELIGALGARKTAQTGVIRSHWVFV 205

Query: 321 DGKLKYKRVKVSPEVSIQDGKKEVLELA 348
           DGKL  KR+K+SPE+SI DG  EVL  A
Sbjct: 206 DGKLGSKRIKISPEMSIADGLSEVLLFA 233

>TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.126
           YIL010W
          Length = 288

 Score =  221 bits (564), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 124/150 (82%)

Query: 201 ELDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAYPKASTPGCTRQACGYRDNYDEL 260
           EL++GDE+PD  L+NQ+ + +SL+ V +E++I++IFAYPKA+TPGCTRQACG RDNY++L
Sbjct: 126 ELEVGDEVPDFELKNQNNETISLKKVMEENRIVVIFAYPKANTPGCTRQACGMRDNYNDL 185

Query: 261 KEHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVLIGHLGAKKTAQSGTLRSHWVFF 320
           K++A VFG+S D+ SAQK FQ KQ+LP+DLL D  R LIG LG KKT  SG +RSH++  
Sbjct: 186 KKYAVVFGISADSVSAQKSFQEKQNLPYDLLSDKNRELIGALGCKKTPTSGIIRSHFIIV 245

Query: 321 DGKLKYKRVKVSPEVSIQDGKKEVLELAAS 350
           +GKLK+KRVK+SPEVS+ D KKEVLE++ S
Sbjct: 246 NGKLKFKRVKISPEVSVSDCKKEVLEISKS 275

>TPHA0C04330 Chr3 complement(934432..935061) [630 bp, 209 aa] {ON}
           Anc_7.126 YIL010W
          Length = 209

 Score =  212 bits (540), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 99/166 (59%), Positives = 133/166 (80%), Gaps = 3/166 (1%)

Query: 186 ETDVAEDSDQTAQSTELDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAYPKASTPG 245
           ETD+ E   Q     E+ +GDEIPD+TL+NQ+G+++SLRD+A+++KII IF YP+ASTPG
Sbjct: 47  ETDLKET--QKDDYEEIQVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPG 104

Query: 246 CTRQACGYRDNYDELKEHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVLIGHLGAK 305
           CTRQACG+RDN+D+LK+++ + GLSGD+ +AQK F+TKQ+LP+DLLCD  + LI  LG K
Sbjct: 105 CTRQACGFRDNFDDLKKYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCK 164

Query: 306 KTAQSGTLRSHWVFFDGKLKYKRVKVSPEVSIQDGKKEVLELAASL 351
           K   SG +RS+++F DGKLK KRVKVSPEVSI + KKE+L+L   L
Sbjct: 165 KKP-SGIIRSYFIFVDGKLKLKRVKVSPEVSITESKKEILDLVKEL 209

>NCAS0F00810 Chr6 (165372..166067) [696 bp, 231 aa] {ON} Anc_7.126
           YIL010W
          Length = 231

 Score =  211 bits (536), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 96/169 (56%), Positives = 129/169 (76%)

Query: 182 KDEKETDVAEDSDQTAQSTELDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAYPKA 241
           K  KE D     +  +   EL IGD+IPD+ L +++G  VSL+ V +E+KI++ FA+PKA
Sbjct: 63  KSVKELDSTAVKNTDSIYKELQIGDDIPDIILPDEEGVSVSLKKVVEENKIVVFFAFPKA 122

Query: 242 STPGCTRQACGYRDNYDELKEHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVLIGH 301
           +TPGCTRQACG+RDNY ELKEHAAV+G+S D  +AQKKF+TKQ+LP+ LL D  R  IG 
Sbjct: 123 NTPGCTRQACGFRDNYKELKEHAAVYGISADPVTAQKKFKTKQNLPYSLLSDSKRDFIGL 182

Query: 302 LGAKKTAQSGTLRSHWVFFDGKLKYKRVKVSPEVSIQDGKKEVLELAAS 350
           LGAKKT QSG +RS+++F DGKLK KRVK+SPE+S+++ +KEV   A++
Sbjct: 183 LGAKKTPQSGVIRSYFIFVDGKLKVKRVKISPELSVEEARKEVSAFASN 231

>Kwal_55.20839 s55 (579138..580055) [918 bp, 305 aa] {ON} YIL010W
           (DOT5) - involved in telomeric silencing [contig 138]
           FULL
          Length = 305

 Score =  211 bits (536), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 99/148 (66%), Positives = 120/148 (81%), Gaps = 1/148 (0%)

Query: 201 ELDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAYPKASTPGCTRQACGYRDNYDEL 260
           EL++GDE+PDV L+NQD ++VSL+ VA+E+K++IIF+YPKASTPGCT QACG+RDNY++L
Sbjct: 46  ELEVGDEVPDVVLKNQDEEEVSLKKVAQENKVVIIFSYPKASTPGCTTQACGFRDNYEDL 105

Query: 261 KEHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVLIGHLGAKKTAQSGTLRSHWVFF 320
           KE  AVFGLS D  +AQ+KFQ   SLPFDLL DP R LIG LGAKK+  SGT RSHWVF 
Sbjct: 106 KEVGAVFGLSADTPAAQRKFQDAHSLPFDLLSDPKRELIGLLGAKKSP-SGTKRSHWVFA 164

Query: 321 DGKLKYKRVKVSPEVSIQDGKKEVLELA 348
           +GKL  KR+ VSPEVSI+D K E  E A
Sbjct: 165 NGKLINKRIAVSPEVSIRDAKTEAHEAA 192

>KLTH0F12562g Chr6 (1052954..1053835) [882 bp, 293 aa] {ON} similar
           to uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 293

 Score =  194 bits (492), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 99/177 (55%), Positives = 137/177 (77%), Gaps = 7/177 (3%)

Query: 180 PKKDEKETDVAEDSDQTAQST------ELDIGDEIPDVTLQNQDGKDVSLRDVAKEHKII 233
           PK+  +E +VA ++ +T ++       EL+ GDE+PDV L+NQ+G++VSL+ V +++K++
Sbjct: 16  PKRAPEEEEVAPNAPETKKAKTNGSKGELEEGDEVPDVVLKNQEGEEVSLKSVVQQNKVV 75

Query: 234 IIFAYPKASTPGCTRQACGYRDNYDELKEHAAVFGLSGDNASAQKKFQTKQSLPFDLLCD 293
           ++FAYPKASTPGCT+QACG+RDNY+ELK++AAVFGLS D  +AQ+KF+ K SLPFDLL D
Sbjct: 76  VVFAYPKASTPGCTKQACGFRDNYEELKKNAAVFGLSTDTPNAQQKFKEKNSLPFDLLSD 135

Query: 294 PGRVLIGHLGAKKTAQSGTLRSHWVFFDGKLKYKRVKVSPEVSIQDGKKEVLELAAS 350
           P R LIG LGA K+  SGT RS+WVF  GKL+ KR+ VSPE S+ + KKE +E A +
Sbjct: 136 PQRKLIGPLGASKSP-SGTKRSYWVFVQGKLRTKRISVSPEASVSEAKKEAIEAAQT 191

>Kpol_1004.59 s1004 (127836..128366) [531 bp, 176 aa] {ON}
           (127836..128366) [531 nt, 177 aa]
          Length = 176

 Score = 32.7 bits (73), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 45/109 (41%), Gaps = 9/109 (8%)

Query: 227 AKEHKIIIIFAYPKASTPGCTRQAC-GYRDNYDELKEHA-AVFGLSGDNASAQ----KKF 280
            KE+K I+I   P A +P C+     GY +  DEL + A  +  L+ DN  AQ    ++ 
Sbjct: 45  VKENKTIVITGAPAAFSPTCSISHIPGYLEKKDELLKKADQIIVLTVDNPFAQQAWARQL 104

Query: 281 QTKQSLPFDLLCDPGRVLIGHLGAKKTAQSGTLRS-HWVFF--DGKLKY 326
               +       D G   I  LG +    +G   S  W     DG + Y
Sbjct: 105 GVTDTTKLKFASDAGAHFIKSLGLELDVGNGVFWSGRWALVVKDGIVTY 153

>Smik_12.169 Chr12 (348877..349407) [531 bp, 176 aa] {ON} YLR109W
           (REAL)
          Length = 176

 Score = 30.4 bits (67), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 37/95 (38%), Gaps = 8/95 (8%)

Query: 229 EHKIIIIFAYPKASTPGCTRQAC-GYRDNYDEL---KEHAAVFGLSGDNASAQ----KKF 280
           E+K +II   P A +P CT     GY +  DEL   KE   V  ++ DN  A     K  
Sbjct: 45  ENKKVIITGAPAAFSPTCTVSHIPGYINYLDELVKEKEVDQVIVVTVDNPFANQAWAKSL 104

Query: 281 QTKQSLPFDLLCDPGRVLIGHLGAKKTAQSGTLRS 315
             K +       DPG      +G +     G   S
Sbjct: 105 GVKDTTHIKFASDPGCAFTKSIGFELAVGDGVFWS 139

>NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {ON}
           
          Length = 1107

 Score = 31.2 bits (69), Expect = 4.9,   Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 22/34 (64%)

Query: 311 GTLRSHWVFFDGKLKYKRVKVSPEVSIQDGKKEV 344
           GT+++ +  FDG L +KR   SPE S ++  KEV
Sbjct: 157 GTIKAPFAAFDGNLPFKRGPSSPENSSKNDCKEV 190

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.128    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,193,298
Number of extensions: 1723130
Number of successful extensions: 5224
Number of sequences better than 10.0: 181
Number of HSP's gapped: 5085
Number of HSP's successfully gapped: 232
Length of query: 354
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 243
Effective length of database: 40,753,473
Effective search space: 9903093939
Effective search space used: 9903093939
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 66 (30.0 bits)