Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0H028707.125ON58758727720.0
SAKL0F05390g7.125ON59559418750.0
ZYRO0C05192g7.125ON58855218540.0
YPL260W7.125ON55151718290.0
NCAS0E021307.125ON52650518240.0
Smik_6.4677.125ON54851518260.0
Suva_16.447.125ON54951518260.0
Skud_16.187.125ON55051818260.0
KLLA0D14355g7.125ON58855418240.0
KLTH0F12540g7.125ON59549217930.0
Kwal_55.208327.125ON57549317690.0
NDAI0E036707.125ON52251117630.0
CAGL0H09108g7.125ON53250817640.0
KNAG0L009407.125ON54952316800.0
Ecym_83527.125ON57956115920.0
TBLA0A009307.125ON58651315870.0
Kpol_322.77.125ON53449715640.0
TPHA0C016107.125ON55153715100.0
KAFR0L004607.125ON51148615010.0
ADL019W7.125ON52545213820.0
Kpol_1062.587.125ON4914184105e-43
Skud_14.881.110ON1316226800.45
KLLA0A04884g4.105ON1059111761.6
YGL151W (NUT1)2.316ON113274751.7
CAGL0H02805g1.295ON121957715.6
KLTH0H13354g1.369ON495132706.1
Suva_7.1132.316ON112874708.0
TPHA0F026206.70ON91899698.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0H02870
         (587 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0H02870 Chr8 (477363..479126) [1764 bp, 587 aa] {ON} Anc_7.1...  1072   0.0  
SAKL0F05390g Chr6 complement(416314..418101) [1788 bp, 595 aa] {...   726   0.0  
ZYRO0C05192g Chr3 (405401..407167) [1767 bp, 588 aa] {ON} simila...   718   0.0  
YPL260W Chr16 (49303..50958) [1656 bp, 551 aa] {ON} Putative sub...   709   0.0  
NCAS0E02130 Chr5 (408158..409738) [1581 bp, 526 aa] {ON} Anc_7.1...   707   0.0  
Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON...   707   0.0  
Suva_16.44 Chr16 (64828..66477) [1650 bp, 549 aa] {ON} YPL260W (...   707   0.0  
Skud_16.18 Chr16 (28372..30024) [1653 bp, 550 aa] {ON} YPL260W (...   707   0.0  
KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]...   707   0.0  
KLTH0F12540g Chr6 (1050879..1052666) [1788 bp, 595 aa] {ON} simi...   695   0.0  
Kwal_55.20832 s55 (577146..578873) [1728 bp, 575 aa] {ON} YPL260...   686   0.0  
NDAI0E03670 Chr5 (792667..794235) [1569 bp, 522 aa] {ON} Anc_7.1...   683   0.0  
CAGL0H09108g Chr8 (889038..890636) [1599 bp, 532 aa] {ON} highly...   684   0.0  
KNAG0L00940 Chr12 (172417..174066) [1650 bp, 549 aa] {ON} Anc_7....   651   0.0  
Ecym_8352 Chr8 complement(703563..705302) [1740 bp, 579 aa] {ON}...   617   0.0  
TBLA0A00930 Chr1 (206453..208213) [1761 bp, 586 aa] {ON} Anc_7.1...   615   0.0  
Kpol_322.7 s322 (16650..18254) [1605 bp, 534 aa] {ON} (16650..18...   607   0.0  
TPHA0C01610 Chr3 (373462..375117) [1656 bp, 551 aa] {ON} Anc_7.1...   586   0.0  
KAFR0L00460 Chr12 (84023..85558) [1536 bp, 511 aa] {ON} Anc_7.12...   582   0.0  
ADL019W Chr4 (675941..677518) [1578 bp, 525 aa] {ON} Syntenic ho...   536   0.0  
Kpol_1062.58 s1062 complement(129362..129739,129741..130838) [14...   162   5e-43
Skud_14.88 Chr14 (164165..168115) [3951 bp, 1316 aa] {ON} YNL250...    35   0.45 
KLLA0A04884g Chr1 (433581..436760) [3180 bp, 1059 aa] {ON} simil...    34   1.6  
YGL151W Chr7 (217524..220922) [3399 bp, 1132 aa] {ON}  NUT1Compo...    33   1.7  
CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] ...    32   5.6  
KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) ...    32   6.1  
Suva_7.113 Chr7 (213621..217007) [3387 bp, 1128 aa] {ON} YGL151W...    32   8.0  
TPHA0F02620 Chr6 complement(577529..580285) [2757 bp, 918 aa] {O...    31   8.9  

>TDEL0H02870 Chr8 (477363..479126) [1764 bp, 587 aa] {ON} Anc_7.125
           YPL260W
          Length = 587

 Score = 1072 bits (2772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/587 (92%), Positives = 544/587 (92%)

Query: 1   MVVSLPVAASNSQHPQDVPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVL 60
           MVVSLPVAASNSQHPQDVPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVL
Sbjct: 1   MVVSLPVAASNSQHPQDVPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVL 60

Query: 61  TKVRELDQIRKSNHDTPSNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPA 120
           TKVRELDQIRKSNHDTPSNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPA
Sbjct: 61  TKVRELDQIRKSNHDTPSNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPA 120

Query: 121 TYASLSTVQRLLEHLNESNVFTQHDLRPIRERLLEISKIVENSSYKNEVSGDNLEDIDEK 180
           TYASLSTVQRLLEHLNESNVFTQHDLRPIRERLLEISKIVENSSYKNEVSGDNLEDIDEK
Sbjct: 121 TYASLSTVQRLLEHLNESNVFTQHDLRPIRERLLEISKIVENSSYKNEVSGDNLEDIDEK 180

Query: 181 LPEADRKFYEERNKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLFEIRR 240
           LPEADRKFYEERNKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLFEIRR
Sbjct: 181 LPEADRKFYEERNKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLFEIRR 240

Query: 241 GLLSLAASSKRSNPSLEKSPLSQEHVHEQVEKLESQLTELESHRDENGKFKSLETDKVED 300
           GLLSLAASSKRSNPSLEKSPLSQEHVHEQVEKLESQLTELESHRDENGKFKSLETDKVED
Sbjct: 241 GLLSLAASSKRSNPSLEKSPLSQEHVHEQVEKLESQLTELESHRDENGKFKSLETDKVED 300

Query: 301 KGQNVLNGLLDDCHDLISDLSHQKNGGIELDAKLQPIYEQLIDIKTSLENLLVTRRWTLR 360
           KGQNVLNGLLDDCHDLISDLSHQKNGGIELDAKLQPIYEQLIDIKTSLENLLVTRRWTLR
Sbjct: 301 KGQNVLNGLLDDCHDLISDLSHQKNGGIELDAKLQPIYEQLIDIKTSLENLLVTRRWTLR 360

Query: 361 ETDLFTFQKQLSEIDSLRVHGKFPTDSGTSKGQSILLYLLRRCFAIIYKXXXXXXXXXXX 420
           ETDLFTFQKQLSEIDSLRVHGKFPTDSGTSKGQSILLYLLRRCFAIIYK           
Sbjct: 361 ETDLFTFQKQLSEIDSLRVHGKFPTDSGTSKGQSILLYLLRRCFAIIYKLLESSEPVSES 420

Query: 421 XQPIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDDLRTDGKFYDSDGNIPEGQ 480
            QPIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDDLRTDGKFYDSDGNIPEGQ
Sbjct: 421 LQPIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDDLRTDGKFYDSDGNIPEGQ 480

Query: 481 GTLNALLAECFDIVHELKIXXXXXXXXXXXXXXXXXXDDGLVNDTDNDNDGDQPVARYLD 540
           GTLNALLAECFDIVHELKI                  DDGLVNDTDNDNDGDQPVARYLD
Sbjct: 481 GTLNALLAECFDIVHELKIEAQERAETESAQQSEAEQDDGLVNDTDNDNDGDQPVARYLD 540

Query: 541 VHNQYSNXXXXXXXXXXXXXASLTNASEHSYVDEEENDYHIPAKAHH 587
           VHNQYSN             ASLTNASEHSYVDEEENDYHIPAKAHH
Sbjct: 541 VHNQYSNDDDEDEEEEDGEEASLTNASEHSYVDEEENDYHIPAKAHH 587

>SAKL0F05390g Chr6 complement(416314..418101) [1788 bp, 595 aa] {ON}
           highly similar to gnl|GLV|CAGL0H09108g Candida glabrata
           CAGL0H09108g and similar to Q08977 YPL260W
           uniprot|Q7LGU3 Saccharomyces cerevisiae Hypothetical ORF
          Length = 595

 Score =  726 bits (1875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/594 (65%), Positives = 448/594 (75%), Gaps = 27/594 (4%)

Query: 11  NSQHPQDVPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVLTKVRELDQIR 70
           +S HPQ+VPKEEE ILNY L VR+ L +LKQNR Q+LNSK+V   YQQVLTKVRELD  R
Sbjct: 2   SSNHPQEVPKEEEEILNYFLDVRSFLSKLKQNRSQFLNSKDVMETYQQVLTKVRELDDTR 61

Query: 71  KSNHDTPSNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQR 130
           KS+H+TP++SATTLIHS +LHNRVDSVLDDVFQLLSL FLTVGLKNSAPATYASLSTVQR
Sbjct: 62  KSSHNTPASSATTLIHSVDLHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQR 121

Query: 131 LLEHLNESNVFTQHDLRPIRERLLEISKIVENSSYKNEVSGDNLEDIDEKLPEAD----- 185
           LLEHLNESNVFT HDLRPI+ERL E+S+IVE +SY+NE   +  +  +   PEA      
Sbjct: 122 LLEHLNESNVFTHHDLRPIKERLDEVSEIVEKNSYRNEPENNKGKPQE---PEAQEDEQD 178

Query: 186 ---RKFYEERNKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLFEIRRGL 242
              +K   E++KNK+EEDLLLRAKL+HCL EY + ESK+EEIDP L +IMEKLF+IRRGL
Sbjct: 179 IELKKADIEKDKNKVEEDLLLRAKLKHCLQEYFNIESKLEEIDPALQSIMEKLFQIRRGL 238

Query: 243 LSLAASSKR---SNPSLEKS----PLSQEHVHEQVEKLESQLTELESHRDENGKFKSLET 295
           LSLAAS+KR   S  SLE       +S   V+ ++ +L+ +L+ELESHRD +GKFKSLET
Sbjct: 239 LSLAASTKRNARSKESLEDKKRTHTVSPNFVNSKLNELQVELSELESHRDPSGKFKSLET 298

Query: 296 DKVEDKGQNVLNGLLDDCHDLISDLSHQKNGGIELDAKLQPIYEQLIDIKTSLENLLVTR 355
           DKVE++GQ+VLNGLLDDCHDLI+DLSHQ + GI LD KLQPIY+ LIDIKT+LENLLVTR
Sbjct: 299 DKVEERGQSVLNGLLDDCHDLINDLSHQTSRGISLDHKLQPIYDNLIDIKTTLENLLVTR 358

Query: 356 RWTLRETDLFTFQKQLSEIDSLRVHGKFPTDSGTSKGQSILLYLLRRCFAIIYKXXXXXX 415
           RWTLRETDLFT+QK+L EID+LRVHGKFPT+SG SKGQSILLYLLRRC+AIIYK      
Sbjct: 359 RWTLRETDLFTYQKRLGEIDNLRVHGKFPTESGDSKGQSILLYLLRRCYAIIYKLLESSE 418

Query: 416 XXXXXXQPIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDDLRTDGKFYDSDGN 475
                 Q IHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLD++R DGKFYD+DGN
Sbjct: 419 PVSEALQRIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDNMRVDGKFYDADGN 478

Query: 476 IPEGQGTLNALLAECFDIVHELKIXXXXXXXXX----XXXXXXXXXDDGLVNDTDNDNDG 531
           IPEGQGTLNALLAECFDI+HELKI                       D    D   D+  
Sbjct: 479 IPEGQGTLNALLAECFDILHELKIEAEEREEESGDNNATSDELELTKDPESRDEFEDDKT 538

Query: 532 DQPVARYLDVHNQYSNXXXXXXXXXXXXXASLTNASEHSYVDEEENDYHIPAKA 585
            Q  A++LDV  QY                 L N SEHSY D E++DY   + A
Sbjct: 539 AQHKAKFLDVPKQYD----DEEEDEEEDEDDLANYSEHSYED-EDDDYTTTSYA 587

>ZYRO0C05192g Chr3 (405401..407167) [1767 bp, 588 aa] {ON} similar
           to Q08977 YPL260W uniprot|Q7LGU3 Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/552 (66%), Positives = 432/552 (78%), Gaps = 23/552 (4%)

Query: 10  SNSQHPQDVPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVLTKVRELDQI 69
           ++SQHPQ VP+EEE +LNY L +R LL QLKQNR +YL+SK+VQ  Y+QVLT+VRELD +
Sbjct: 11  TSSQHPQHVPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQVLTRVRELDDV 70

Query: 70  RKSNHDTPSNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQ 129
           RKSNH+TPS+SATTLIH+ ELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPA Y+SLSTVQ
Sbjct: 71  RKSNHETPSSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPAAYSSLSTVQ 130

Query: 130 RLLEHLNESNVFTQHDLRPIRERLLEISKIVENSSYKNEVSG-------DNLEDIDEKLP 182
           RLLEHLNESNVFT HDLRPI+ERL+EI KIVE S  KN+ +         N  D+DE   
Sbjct: 131 RLLEHLNESNVFTMHDLRPIKERLIEIKKIVEKSCEKNKEAAKEEEEYLKNAPDLDE--- 187

Query: 183 EADRKFYEERNKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLFEIRRGL 242
            ADR   EE  +NKIEEDLLLRAKLQHCLDEY+STE+KVE +DP L+ IM+KLF+IRR L
Sbjct: 188 -ADRNLSEETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLFQIRREL 246

Query: 243 LSLAASSKRSNPSLE-------KSPLSQEHVHEQVEKLESQLTELESHRDENGKFKSLET 295
           LSLAAS+K++  S         K  L+ E V+ +VE L+ +L E+ES+RDE GKFKS E+
Sbjct: 247 LSLAASAKKTTSSASAEKELENKHVLAPESVNTRVELLQKELNEIESYRDETGKFKSPES 306

Query: 296 DKVEDKGQNVLNGLLDDCHDLISDLSHQKNGGIELDAKLQPIYEQLIDIKTSLENLLVTR 355
           ++  +KGQNVLNGLL DC+DL+ DLSHQKNGGIELD +LQPIY +LIDIKT+LENLL+TR
Sbjct: 307 EQSAEKGQNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPIYAKLIDIKTTLENLLITR 366

Query: 356 RWTLRETDLFTFQKQLSEIDSLRVHGKFPTDSGTSKGQSILLYLLRRCFAIIYKXXXXXX 415
           RWTLRETDLFT+QK+L EIDSLRV+ KFPTDSG +KGQ+ILLYLLRRC+AIIYK      
Sbjct: 367 RWTLRETDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILLYLLRRCYAIIYKLLESSE 426

Query: 416 XXXXXXQPIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDDLRTDGKFYDSDGN 475
                 QP+HNQLSTVRRCLL L+RMGG+NN RELYPYQMKLASLD LR DGKFYD DGN
Sbjct: 427 PVSESLQPLHNQLSTVRRCLLSLQRMGGINNSRELYPYQMKLASLDGLRVDGKFYDLDGN 486

Query: 476 IPEGQGTLNALLAECFDIVHELKIXXXXXXXXXXXXXXXXXXDDGLVNDTDNDNDGDQP- 534
           IPEGQ TLNALLAECFDI+HE+KI                  DD  +  T ++ + + P 
Sbjct: 487 IPEGQATLNALLAECFDIIHEMKIEAEEKTESETQSEAEGDGDD--LRQTYSEAERENPR 544

Query: 535 VARYLDVHNQYS 546
           +AR+LD  N YS
Sbjct: 545 LARFLD--NSYS 554

>YPL260W Chr16 (49303..50958) [1656 bp, 551 aa] {ON} Putative
           substrate of cAMP-dependent protein kinase (PKA); green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; YPL260W is not an essential
           gene
          Length = 551

 Score =  709 bits (1829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/517 (70%), Positives = 421/517 (81%), Gaps = 34/517 (6%)

Query: 8   AASNSQHPQDVPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVLTKVRELD 67
           A++  QHPQ VPKEEESILNYLL VR+ L +LKQNR QYLNSK+VQ  YQ VLTKVRELD
Sbjct: 3   ASAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELD 62

Query: 68  QIRKSNHDTPSNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST 127
            IRK++H+TP+ SA TLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST
Sbjct: 63  DIRKNSHETPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST 122

Query: 128 VQRLLEHLNESNVFTQHDLRPIRERLLEISKIVE--NSSYKNEVSGDNLEDIDEKLPEAD 185
           V+ LLEHLNESNVFT HDL PI+ERL EISKIVE  NSS   +  G+     D++L E D
Sbjct: 123 VESLLEHLNESNVFTHHDLSPIKERLEEISKIVEQKNSSPAYDEDGN-----DDRLREID 177

Query: 186 RKFYEERNKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLFEIRRGLLSL 245
                ER KNKIEEDLLLRAKL+HC DEY   E K+EEIDP L+T+MEKLF IRRGLLSL
Sbjct: 178 N----ERKKNKIEEDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSL 233

Query: 246 AASSKRS---------------------NPSL--EKSPLSQEHVHEQVEKLESQLTELES 282
            AS+K++                     N SL  +K  +SQE+VHE++  L+++L+ELES
Sbjct: 234 VASAKKTMSKSDINTNSLLQEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELES 293

Query: 283 HRDENGKFKSLETDKVEDKGQNVLNGLLDDCHDLISDLSHQKNGGIELDAKLQPIYEQLI 342
           +RD++GKFKSLE+ +V +KGQ+VLNGLLDDCHDL++DLSHQKNGG+ LD  LQPIYEQLI
Sbjct: 294 NRDDSGKFKSLESHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQLI 353

Query: 343 DIKTSLENLLVTRRWTLRETDLFTFQKQLSEIDSLRVHGKFPTDSGTSKGQSILLYLLRR 402
           DIKT+LENL++TRRWTLRETDLF++QK+L+EID+ R++GKFPT S  SKGQSILLYLLRR
Sbjct: 354 DIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRR 413

Query: 403 CFAIIYKXXXXXXXXXXXXQPIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDD 462
           C+AIIYK            QPIHNQLSTVRRCLLELKRMGGVNN+RELYPYQMKLASLD+
Sbjct: 414 CYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDN 473

Query: 463 LRTDGKFYDSDGNIPEGQGTLNALLAECFDIVHELKI 499
           LRT+G FYDSDGNIPEGQG LNALLAECFDI+HELK+
Sbjct: 474 LRTEGIFYDSDGNIPEGQGILNALLAECFDILHELKV 510

>NCAS0E02130 Chr5 (408158..409738) [1581 bp, 526 aa] {ON} Anc_7.125
           YPL260W
          Length = 526

 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/505 (71%), Positives = 412/505 (81%), Gaps = 26/505 (5%)

Query: 10  SNSQHPQDVPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVLTKVRELDQI 69
           SN+ HPQ+VPKEEE ILNYLL VR+ L +LKQNR QYLNSK+VQ  YQ VLTKVRELD+I
Sbjct: 6   SNTTHPQEVPKEEEDILNYLLDVRSFLSKLKQNRTQYLNSKDVQITYQNVLTKVRELDEI 65

Query: 70  RKSNHDTPSNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQ 129
           RK++HDTPS SATTLIHS ELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQ
Sbjct: 66  RKNSHDTPSKSATTLIHSNELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQ 125

Query: 130 RLLEHLNESNVFTQHDLRPIRERLLEISKIVENSSYK------NEVSGDNLEDIDEKLPE 183
            LLEHL+ESN+FT HDL PI++RL EISKIVE S  K      N+    NL+DID     
Sbjct: 126 SLLEHLSESNIFTHHDLSPIKDRLNEISKIVEKSCGKLPDEQLNDDEEQNLKDIDT---- 181

Query: 184 ADRKFYEERNKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLFEIRRGLL 243
                  ERNKNKIE+DLLLRAKLQHCLDEY   ESK+EEIDP LT+ MEKLF+IRRGLL
Sbjct: 182 -------ERNKNKIEQDLLLRAKLQHCLDEYKQIESKLEEIDPSLTSTMEKLFQIRRGLL 234

Query: 244 SLAASSKR--------SNPSLE-KSPLSQEHVHEQVEKLESQLTELESHRDENGKFKSLE 294
           SLAAS+K+        S   LE K  +SQE+V++++  LE+++  LE++RDE+GKFKSLE
Sbjct: 235 SLAASTKKNMNQGSLTSEKELENKHLVSQEYVNKKLHALEAEVQALEANRDESGKFKSLE 294

Query: 295 TDKVEDKGQNVLNGLLDDCHDLISDLSHQKNGGIELDAKLQPIYEQLIDIKTSLENLLVT 354
           T++V + GQNVLNGLLDDC DLI+DLSHQ NG + LD  LQPIYE LIDIKT+LENL++T
Sbjct: 295 TNEVAENGQNVLNGLLDDCLDLINDLSHQTNGHLNLDPTLQPIYEMLIDIKTTLENLMIT 354

Query: 355 RRWTLRETDLFTFQKQLSEIDSLRVHGKFPTDSGTSKGQSILLYLLRRCFAIIYKXXXXX 414
           RRWTLRETDLFT+QKQL EID++RV G+FPT    SKGQ ILLYLLRRC+AIIYK     
Sbjct: 355 RRWTLRETDLFTYQKQLGEIDNMRVEGRFPTKHIDSKGQFILLYLLRRCYAIIYKLLESS 414

Query: 415 XXXXXXXQPIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDDLRTDGKFYDSDG 474
                  QPIHNQLSTVRRCL+ELKRMGGV+NDRELYPYQMKLASLD+LR DGKFYDS+G
Sbjct: 415 EPVSESLQPIHNQLSTVRRCLMELKRMGGVDNDRELYPYQMKLASLDNLRVDGKFYDSEG 474

Query: 475 NIPEGQGTLNALLAECFDIVHELKI 499
           NIPEGQGTLNALLA CFDI+HELK+
Sbjct: 475 NIPEGQGTLNALLAACFDIMHELKV 499

>Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON}
           YPL260W (REAL)
          Length = 548

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/515 (70%), Positives = 416/515 (80%), Gaps = 30/515 (5%)

Query: 8   AASNSQHPQDVPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVLTKVRELD 67
           A++  QHPQ VPKEEESILNYLL VR+ L +LKQNR QYLNSK+VQ  YQ VLTKVRELD
Sbjct: 3   ASAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELD 62

Query: 68  QIRKSNHDTPSNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST 127
            IRK++H+TP+ SA TLIH+TELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST
Sbjct: 63  DIRKNSHETPAKSAATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST 122

Query: 128 VQRLLEHLNESNVFTQHDLRPIRERLLEISKIVENSSYKNEVSGDNLEDIDEKLPEADRK 187
           V+ LLEHLNESNVFT HDL PI+ERL EISKIVE    KN  S  N +  D++L E D  
Sbjct: 123 VESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQ---KNSSSTYNEDGNDDRLREIDN- 178

Query: 188 FYEERNKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLFEIRRGLLSLAA 247
              ER KNKIEEDLLLRAKL+HC DEY + ESK+EEIDP L+++MEKLF IRRGLLSL A
Sbjct: 179 ---ERKKNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVA 235

Query: 248 SSKRS---------------------NPSL--EKSPLSQEHVHEQVEKLESQLTELESHR 284
           S+K++                     N  L  +K  +SQE+VHE++  L+ +L ELES+R
Sbjct: 236 SAKKTMSKSSANINSLLREQNDSQANNNGLMDDKHLVSQEYVHEKLSVLKDELNELESNR 295

Query: 285 DENGKFKSLETDKVEDKGQNVLNGLLDDCHDLISDLSHQKNGGIELDAKLQPIYEQLIDI 344
           D++GKFKSLET +V   GQ+VLNGLLDDCHDLI+DLSHQ NGG+ LD  LQPIYEQLIDI
Sbjct: 296 DDSGKFKSLETHQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLIDI 355

Query: 345 KTSLENLLVTRRWTLRETDLFTFQKQLSEIDSLRVHGKFPTDSGTSKGQSILLYLLRRCF 404
           KT+LENL++TRRWTLRETDLF++QK+L+EID+ R++GKFPT S  SKGQSILLYLLRRC+
Sbjct: 356 KTTLENLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCY 415

Query: 405 AIIYKXXXXXXXXXXXXQPIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDDLR 464
           AIIYK            QPIHNQLSTVRRCLLELKRMGGVNN+RELYPYQMKLASLD+LR
Sbjct: 416 AIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLR 475

Query: 465 TDGKFYDSDGNIPEGQGTLNALLAECFDIVHELKI 499
           TDG FYDSDGNIPEGQG LNALLAECFDI+HELK+
Sbjct: 476 TDGIFYDSDGNIPEGQGILNALLAECFDILHELKV 510

>Suva_16.44 Chr16 (64828..66477) [1650 bp, 549 aa] {ON} YPL260W
           (REAL)
          Length = 549

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/515 (69%), Positives = 418/515 (81%), Gaps = 31/515 (6%)

Query: 8   AASNSQHPQDVPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVLTKVRELD 67
           +++  QHPQ VPKEEESILNYLL VR+ L +LKQNR QYLNSK+VQ  YQ VLTKVRELD
Sbjct: 3   SSAGQQHPQIVPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELD 62

Query: 68  QIRKSNHDTPSNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST 127
            IRK++HDTP+ SA TLIHSTELHNRVDSVLDDVFQL+SLCFLTVGLKNSAPATYASLST
Sbjct: 63  DIRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYASLST 122

Query: 128 VQRLLEHLNESNVFTQHDLRPIRERLLEISKIVENSSYKNEVSGDNLEDIDEKLPEADRK 187
           V+ LLEHLNESNVFT HDL PI+ERL EI KIVE ++  N     N    D++L E D  
Sbjct: 123 VESLLEHLNESNVFTHHDLSPIKERLEEIRKIVEKNTGPNYDEDGN----DDQLREIDN- 177

Query: 188 FYEERNKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLFEIRRGLLSLAA 247
              ERNKN+IEEDLLLRAKL+HC DEY + ESK+EEIDP L+T+MEKLF+IRRGLLSL A
Sbjct: 178 ---ERNKNRIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLVA 234

Query: 248 SSKR----SNPSL-------------------EKSPLSQEHVHEQVEKLESQLTELESHR 284
           S+K+    SN ++                   +K  +SQE+V+E++  L+++L ELES+R
Sbjct: 235 SAKKTMSQSNVNISSLLQKHNDLETNNNDLMDDKHLVSQEYVNEKLTALKNELNELESNR 294

Query: 285 DENGKFKSLETDKVEDKGQNVLNGLLDDCHDLISDLSHQKNGGIELDAKLQPIYEQLIDI 344
           DE+GKFKSLE+ KV + GQ+VLNGLLDDCHDL++DLSHQ NGG+ LD  LQPIYEQLIDI
Sbjct: 295 DESGKFKSLESHKVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDI 354

Query: 345 KTSLENLLVTRRWTLRETDLFTFQKQLSEIDSLRVHGKFPTDSGTSKGQSILLYLLRRCF 404
           KT+LENL++TRRWTLRETDLF++QK+L+EIDS RV GKFPT +  SKGQSILLYLLRRC+
Sbjct: 355 KTTLENLMITRRWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQSILLYLLRRCY 414

Query: 405 AIIYKXXXXXXXXXXXXQPIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDDLR 464
           AIIYK            QP+HNQLSTVRRCLLELKRMGGVNN+RELYPYQMKLASLD+LR
Sbjct: 415 AIIYKLLESSEPVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLR 474

Query: 465 TDGKFYDSDGNIPEGQGTLNALLAECFDIVHELKI 499
           TDG FYDSDGNIPEGQG LNALLAECFDI+HELK+
Sbjct: 475 TDGIFYDSDGNIPEGQGILNALLAECFDIMHELKV 509

>Skud_16.18 Chr16 (28372..30024) [1653 bp, 550 aa] {ON} YPL260W
           (REAL)
          Length = 550

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/518 (70%), Positives = 418/518 (80%), Gaps = 38/518 (7%)

Query: 9   ASNSQHPQDVPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVLTKVRELDQ 68
           +S  QHPQ VPKEEESILNYLL VR+ L +LKQNR QYLNSK+VQ  YQ VLTKVRELD 
Sbjct: 3   SSAGQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDD 62

Query: 69  IRKSNHDTPSNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTV 128
           IRK++HDTP+ SA TLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTV
Sbjct: 63  IRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTV 122

Query: 129 QRLLEHLNESNVFTQHDLRPIRERLLEISKIVE--NSS--YKNEVSGDNLEDIDEKLPEA 184
           + LLEHLNESNVFT HDL PI+ERL EISKIVE  NSS  Y+ + +   + +ID      
Sbjct: 123 ESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSPMYEEDANDARIREIDN----- 177

Query: 185 DRKFYEERNKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLFEIRRGLLS 244
                 ER +NKIEEDLLLRAKL+HC DEY + ESK+EEIDP L+T+MEKLF IRRGLLS
Sbjct: 178 ------ERKQNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLS 231

Query: 245 LAASSKRS--------NPSLE---------------KSPLSQEHVHEQVEKLESQLTELE 281
           L AS+K++        N  L+               K  +SQE+VHE++  L+++L+ELE
Sbjct: 232 LVASAKKTMSKSSANINSLLQEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLKNELSELE 291

Query: 282 SHRDENGKFKSLETDKVEDKGQNVLNGLLDDCHDLISDLSHQKNGGIELDAKLQPIYEQL 341
           S+RD++GKFKSLET +V +KGQ+VLNGLLDDCHDLISDLSHQ NGG+ LD  LQP YEQL
Sbjct: 292 SNRDDSGKFKSLETHEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQPTYEQL 351

Query: 342 IDIKTSLENLLVTRRWTLRETDLFTFQKQLSEIDSLRVHGKFPTDSGTSKGQSILLYLLR 401
           IDIKT+LENL++TRRWTLRETDLF++QK+L+EIDS R++GKFPT S  SKGQSILLYLLR
Sbjct: 352 IDIKTTLENLMITRRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSILLYLLR 411

Query: 402 RCFAIIYKXXXXXXXXXXXXQPIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLD 461
           RC+AIIYK            QPIHNQLSTVRRCLLELKRMGGVNN+RELYPYQMKLASLD
Sbjct: 412 RCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLD 471

Query: 462 DLRTDGKFYDSDGNIPEGQGTLNALLAECFDIVHELKI 499
           +LRT+G FYDSDGNIPEGQG LNALLAECFDI+HELK+
Sbjct: 472 NLRTNGIFYDSDGNIPEGQGILNALLAECFDIMHELKV 509

>KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]
           {ON} similar to uniprot|Q08977 YPL260W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/554 (65%), Positives = 428/554 (77%), Gaps = 26/554 (4%)

Query: 10  SNSQHPQDVPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVLTKVRELDQI 69
           S + HP  VP EEE IL Y L VR+ L ++KQNR Q+LNSK+V + YQ+VLTKVRELD++
Sbjct: 2   SVNSHPMAVPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDEL 61

Query: 70  RKSNHDTPSNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQ 129
           RK++H TPSNSATTLIHS+ELHNRVDSV+DDVFQLLSL FLTVGLKNSAPATYASLSTVQ
Sbjct: 62  RKNSHATPSNSATTLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLSTVQ 121

Query: 130 RLLEHLNESNVFTQHDLRPIRERLLEISKIVENSSY-----KNEVSGDNLEDIDEKLPEA 184
            LLEHLNESNV+T HDLRPI+ERL E+S IVE + Y        V+ D  +DI E   + 
Sbjct: 122 SLLEHLNESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNAD-ADDIGEFALQK 180

Query: 185 DRKFYEERNKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLFEIRRGLLS 244
           D    EE NKNKIEEDLLLRAKL+HC+DEY++ ESK+EEI P L + ME LF+IRRGLLS
Sbjct: 181 D----EELNKNKIEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLS 236

Query: 245 LAASSKR----------------SNPSLEKSPLSQEHVHEQVEKLESQLTELESHRDENG 288
           LA+S+KR                S  S +K+ L  + + E++++L+ QL +LESHRD NG
Sbjct: 237 LASSTKRPHQKQLVPDPAVLSVESEASEKKNVLPDQVIDEKLKQLQEQLEKLESHRDING 296

Query: 289 KFKSLETDKVEDKGQNVLNGLLDDCHDLISDLSHQKNGGIELDAKLQPIYEQLIDIKTSL 348
           KFKSLETDKVE+KGQNVLNGLLDDCHDL++DLSHQK+GGI LD KLQPIY+QL+DIKT+L
Sbjct: 297 KFKSLETDKVEEKGQNVLNGLLDDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIKTTL 356

Query: 349 ENLLVTRRWTLRETDLFTFQKQLSEIDSLRVHGKFPTDSGTSKGQSILLYLLRRCFAIIY 408
           ENLLVTRRWTLRETDLFT+QK+L EID+LRV+GKFPTD   SKGQSILLYLLRRC+AIIY
Sbjct: 357 ENLLVTRRWTLRETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAIIY 416

Query: 409 KXXXXXXXXXXXXQPIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDDLRTDGK 468
           K            Q +HNQLSTVRRCLLELKRMGGV+NDRELYPYQMKLASLD++R DGK
Sbjct: 417 KLLESSEPVSESLQRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRVDGK 476

Query: 469 FYDSDGNIPEGQGTLNALLAECFDIVHELKIXXXXXXXXXXXXXXXXXXDDGLVNDTDND 528
           FYD+DGNIPEGQGTLNALLAECFDI+HELKI                     +  D    
Sbjct: 477 FYDTDGNIPEGQGTLNALLAECFDIIHELKIEAEERVEERVDIHDDGEESVEMTKDPTMR 536

Query: 529 NDGDQPVARYLDVH 542
           +  ++P ARY+DV+
Sbjct: 537 DVQERPTARYMDVY 550

>KLTH0F12540g Chr6 (1050879..1052666) [1788 bp, 595 aa] {ON} similar
           to uniprot|Q08977 YPL260W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 595

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/492 (71%), Positives = 406/492 (82%), Gaps = 12/492 (2%)

Query: 13  QHPQDVPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVLTKVRELDQIRKS 72
           +HPQ+VP EEES L Y L VRN L +LKQNR QYLNSK+V + YQQVLTKVRELD IRKS
Sbjct: 3   KHPQEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIRKS 62

Query: 73  NHDTPSNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQRLL 132
           +H  P+NSATTLIH+ ELHNRVDSVLDDVFQLLSL FLTVGLKNSAPATYASLSTVQRLL
Sbjct: 63  SHHRPANSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLL 122

Query: 133 EHLNESNVFTQHDLRPIRERLLEISKIVENSSYKNEVSGDNLEDIDEKLPEADRKFYEER 192
           EHL+ESNVFT HDLRPI+ERL EIS+IV  SSY      D  E  D ++  A  K  +E+
Sbjct: 123 EHLDESNVFTHHDLRPIKERLDEISEIVSQSSYL-----DGTEISDGRIDFA--KIQDEK 175

Query: 193 NKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLFEIRRGLLSLAASSKRS 252
           ++NKIEEDLLLRAKLQHCL EY   ESK+EEIDP L + MEKLF++RRGLLSLAAS+KR+
Sbjct: 176 DRNKIEEDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSLAASTKRN 235

Query: 253 NPSLE--KSP---LSQEHVHEQVEKLESQLTELESHRDENGKFKSLETDKVEDKGQNVLN 307
             S +  K+P   L QE + +++ +LE++LTE+ESHRD +GKF SLET ++  KGQNVLN
Sbjct: 236 AMSKQGVKTPDSLLPQEGIKQRLHELEAELTEIESHRDSSGKFVSLETGEIAGKGQNVLN 295

Query: 308 GLLDDCHDLISDLSHQKNGGIELDAKLQPIYEQLIDIKTSLENLLVTRRWTLRETDLFTF 367
           GLLDDCHDLI+DLSH  N  + LD+KLQPIY+ LIDIKT+LENLLVTRRWTLRETDLF++
Sbjct: 296 GLLDDCHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLVTRRWTLRETDLFSY 355

Query: 368 QKQLSEIDSLRVHGKFPTDSGTSKGQSILLYLLRRCFAIIYKXXXXXXXXXXXXQPIHNQ 427
           QK+LSEID LRV GKFPT++  +KGQ+ILLYLLRRC+AIIYK            Q IHNQ
Sbjct: 356 QKRLSEIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLECSEPVSEALQKIHNQ 415

Query: 428 LSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDDLRTDGKFYDSDGNIPEGQGTLNALL 487
           LSTVRRCLLELKRMGGV NDRELYPYQMKLASLD++R DGKFYD DGNIPEGQGTLNALL
Sbjct: 416 LSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNIPEGQGTLNALL 475

Query: 488 AECFDIVHELKI 499
           AECFDI+HELKI
Sbjct: 476 AECFDILHELKI 487

>Kwal_55.20832 s55 (577146..578873) [1728 bp, 575 aa] {ON} YPL260W -
           Hypothetical ORF [contig 138] FULL
          Length = 575

 Score =  686 bits (1769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/493 (70%), Positives = 400/493 (81%), Gaps = 13/493 (2%)

Query: 13  QHPQDVPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVLTKVRELDQIRKS 72
           +HPQ+VP EEE+ L Y L VRN L +LKQNR QYLNSKEV + YQQVLTKVRELD+IRK 
Sbjct: 3   KHPQEVPAEEEASLAYFLEVRNYLSRLKQNRSQYLNSKEVMSAYQQVLTKVRELDEIRKR 62

Query: 73  NHDTPSNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQRLL 132
           +H  P NSATTLIH+ ELHNRVDSVLDDVFQLLSL FLTVGLKNSAPATYASLSTVQRLL
Sbjct: 63  SHSAPRNSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLL 122

Query: 133 EHLNESNVFTQHDLRPIRERLLEISKIVENSSYKNEVSGDNLEDIDEKLPEADRKFYEER 192
           EHL+ESNVFT HDLRPI+ERL EIS+IV  SS+  E    N   ID        K  +E+
Sbjct: 123 EHLDESNVFTHHDLRPIKERLDEISEIVTQSSFFKEGGEINNGSIDFT------KISDEK 176

Query: 193 NKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLFEIRRGLLSLAASSKRS 252
           ++NKIEEDLLLRAKL+HCL EY   ESK+EEIDP L   MEKLFE+RRGLLSLAAS+KR 
Sbjct: 177 DRNKIEEDLLLRAKLKHCLQEYAHIESKLEEIDPRLQKTMEKLFELRRGLLSLAASTKR- 235

Query: 253 NPSLE------KSPLSQEHVHEQVEKLESQLTELESHRDENGKFKSLETDKVEDKGQNVL 306
           N  L+      +SPLSQE V E++  LE++LT++ES R+ +G F S +T ++ ++GQ+VL
Sbjct: 236 NAMLKDGHKAPESPLSQESVKEKLHSLEAKLTQIESQRNASGYFVSADTGEIVERGQSVL 295

Query: 307 NGLLDDCHDLISDLSHQKNGGIELDAKLQPIYEQLIDIKTSLENLLVTRRWTLRETDLFT 366
           NGLLDDCHDLI+DLSH  N  + LD+KLQPIY+ LI+IKT+LENLLVTRRWTLRETDLF 
Sbjct: 296 NGLLDDCHDLINDLSHHANNVVTLDSKLQPIYDNLIEIKTTLENLLVTRRWTLRETDLFA 355

Query: 367 FQKQLSEIDSLRVHGKFPTDSGTSKGQSILLYLLRRCFAIIYKXXXXXXXXXXXXQPIHN 426
           +QK+LSEID LRV GKFPT+SG +KGQ+ILLYLLRRC+AIIYK            Q IHN
Sbjct: 356 YQKRLSEIDKLRVGGKFPTESGDAKGQAILLYLLRRCYAIIYKLLECSEPVSEALQKIHN 415

Query: 427 QLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDDLRTDGKFYDSDGNIPEGQGTLNAL 486
           QLSTVRRCLLELKRMGGV NDRELYPYQMKLASLD++R DGKFYD DGNIPEGQGTLNAL
Sbjct: 416 QLSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNIPEGQGTLNAL 475

Query: 487 LAECFDIVHELKI 499
           LAECFDI+HELKI
Sbjct: 476 LAECFDILHELKI 488

>NDAI0E03670 Chr5 (792667..794235) [1569 bp, 522 aa] {ON} Anc_7.125
           YPL260W
          Length = 522

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/511 (68%), Positives = 409/511 (80%), Gaps = 22/511 (4%)

Query: 1   MVVSLPVAASNSQHPQDVPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVL 60
           M V L    SNS HPQ VPKEEE IL YLL VRN L  LK+NR QYLNS+ VQ  YQ+VL
Sbjct: 1   MSVQLSNYPSNSTHPQLVPKEEEGILKYLLDVRNYLQNLKRNRTQYLNSQAVQKTYQEVL 60

Query: 61  TKVRELDQIRKSNHDTPSNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPA 120
           TKVRELD+IRK+NH TPSNSATTLIHS ELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPA
Sbjct: 61  TKVRELDEIRKNNHATPSNSATTLIHSMELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPA 120

Query: 121 TYASLSTVQRLLEHLNESNVFTQHDLRPIRERLLEISKIVENSSYKNEVSGDNLEDIDEK 180
           TYASLSTVQ LLEHLNESN+FT HDL PI+ERL +ISKIVE S  + E+  DN       
Sbjct: 121 TYASLSTVQSLLEHLNESNIFTHHDLGPIKERLDQISKIVEESCSQ-EIKLDN------- 172

Query: 181 LPEADRKFYE-------ERNKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIME 233
             E D +F +       E+N+NKIE+DLLLRAKLQHCLDEYH  ESK+EEIDP L +I+E
Sbjct: 173 --EGDDQFNQYLDETELEQNQNKIEQDLLLRAKLQHCLDEYHEIESKLEEIDPSLNSILE 230

Query: 234 KLFEIRRGLLSLAASSKR----SNPSL-EKSPLSQEHVHEQVEKLESQLTELESHRDENG 288
           KLF+IRRGLLSL AS+K+    S   L EK  +S E++++++ +LE +  +LES+RDE G
Sbjct: 231 KLFQIRRGLLSLVASAKKNSLLSQKELDEKHLISPEYLNKKLLELEKEFKDLESNRDEFG 290

Query: 289 KFKSLETDKVEDKGQNVLNGLLDDCHDLISDLSHQKNGGIELDAKLQPIYEQLIDIKTSL 348
           KFKSLET ++ + GQNVL GL DDC+DLI+DLSHQ NG + LD  LQP+YEQLI+IKT+L
Sbjct: 291 KFKSLETGEIPENGQNVLKGLEDDCNDLINDLSHQTNGRLTLDPDLQPVYEQLIEIKTTL 350

Query: 349 ENLLVTRRWTLRETDLFTFQKQLSEIDSLRVHGKFPTDSGTSKGQSILLYLLRRCFAIIY 408
           E L++TRRWTLRETDLFT+QK+L EID+LRV GKFP+ S  SKGQ I+LYLLRRC+AIIY
Sbjct: 351 EKLMITRRWTLRETDLFTYQKKLGEIDNLRVKGKFPSKSSDSKGQFIILYLLRRCYAIIY 410

Query: 409 KXXXXXXXXXXXXQPIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDDLRTDGK 468
           K            QPIHNQLSTVRRCLL++KR+GGV+N+RELYPYQMKLASLD+LR DG 
Sbjct: 411 KLLECSEPVSESLQPIHNQLSTVRRCLLDIKRLGGVSNERELYPYQMKLASLDNLRKDGI 470

Query: 469 FYDSDGNIPEGQGTLNALLAECFDIVHELKI 499
           FYDSDGNIPEGQGTLNALLA CFDIVHE+K+
Sbjct: 471 FYDSDGNIPEGQGTLNALLAACFDIVHEMKV 501

>CAGL0H09108g Chr8 (889038..890636) [1599 bp, 532 aa] {ON} highly
           similar to uniprot|Q08977 Saccharomyces cerevisiae
           YPL260w
          Length = 532

 Score =  684 bits (1764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/508 (68%), Positives = 405/508 (79%), Gaps = 22/508 (4%)

Query: 4   SLPVAASNSQHPQDVPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVLTKV 63
            +P++ S + HPQDVPKEEE ILNYLL VR+ L +LK+NR QYLNSK+V N YQ+VLT+V
Sbjct: 3   GVPMSVSGTNHPQDVPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLTRV 62

Query: 64  RELDQIRKSNHDTP--SNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPAT 121
           RELD IRKS+ D       ATTLIH T++HNRVDSVLDDVFQLLSLCFLTVGLKNSAPAT
Sbjct: 63  RELDGIRKSSTDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAPAT 122

Query: 122 YASLSTVQRLLEHLNESNVFTQHDLRPIRERLLEISKIVENSSYKNEVSGDNLEDIDEKL 181
           YASLSTVQ LLEHL ESNVFT HDLRPI+ERL EISKIVE S           ED   + 
Sbjct: 123 YASLSTVQCLLEHLCESNVFTHHDLRPIKERLDEISKIVEKSVESRP------EDEVAEF 176

Query: 182 PEADRKFYEERNKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLFEIRRG 241
            E D     ERNKN+IE+DLLL+AKLQHC+DEY+  ESK+EEI P L+ IME+LF++RRG
Sbjct: 177 KEID----TERNKNRIEQDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVRRG 232

Query: 242 LLSLAASSKRSNPSLE-KSP---------LSQEHVHEQVEKLESQLTELESHRDENGKFK 291
           LLSLAASSK++ P    K P         LSQE++   +EK + ++ ++E+ RDENG+F 
Sbjct: 233 LLSLAASSKKNIPDENYKEPAKLDDSKHVLSQEYLSNSLEKYKKEVAKMEAMRDENGQFV 292

Query: 292 SLETDKVEDKGQNVLNGLLDDCHDLISDLSHQKNGGIELDAKLQPIYEQLIDIKTSLENL 351
           S  T K E +GQN+LNGLLDDC+DLI+DLSHQ NGG+ LD  LQPIYE+LIDIKT+LENL
Sbjct: 293 SKSTGKAEQRGQNILNGLLDDCNDLINDLSHQTNGGLTLDPYLQPIYEKLIDIKTTLENL 352

Query: 352 LVTRRWTLRETDLFTFQKQLSEIDSLRVHGKFPTDSGTSKGQSILLYLLRRCFAIIYKXX 411
           ++TRRWTLRETDLFT+QKQL+EID++RVHGKFPT S  SKGQSI+LYLLRRC+AIIYK  
Sbjct: 353 MITRRWTLRETDLFTYQKQLTEIDNMRVHGKFPTKSPDSKGQSIILYLLRRCYAIIYKLL 412

Query: 412 XXXXXXXXXXQPIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDDLRTDGKFYD 471
                     QP+HNQLSTVRRCLLELKRMGGVNN+RELYPYQMKLASLD+LR DGKFYD
Sbjct: 413 ESSEPVSESLQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRKDGKFYD 472

Query: 472 SDGNIPEGQGTLNALLAECFDIVHELKI 499
           SDGNIPEGQG LNALLA CFDI+HELK+
Sbjct: 473 SDGNIPEGQGILNALLAGCFDILHELKV 500

>KNAG0L00940 Chr12 (172417..174066) [1650 bp, 549 aa] {ON} Anc_7.125
           YPL260W
          Length = 549

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/523 (62%), Positives = 401/523 (76%), Gaps = 36/523 (6%)

Query: 10  SNSQHPQDVPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVLTKVRELDQI 69
           +++Q  Q+VPKEEE ILNY L VR  L QLK+NR QYLNS EVQ  YQ+VLTKVRELD I
Sbjct: 7   TSTQPAQNVPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKVRELDAI 66

Query: 70  RKSNHDTPSNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQ 129
           RK NHD  + +  TLIH+ +LHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTV+
Sbjct: 67  RKKNHDAVATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVE 126

Query: 130 RLLEHLNESNVFTQHDLRPIRERLLEISKIVENSSYKNEVSGDNLEDIDEKLPEADRKFY 189
            LL+HL E+ ++T HDL+PI++RL EISKIVE S  +     D LE+ +E   +A +   
Sbjct: 127 SLLQHLEEAKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQDALENDEE---QAIKDID 183

Query: 190 EERNKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLFEIRRGLLSLAASS 249
            ER +NK+E++LLL+AKL+HC+D Y+  ESK+E+IDP LT++MEKLF+IRRGLLSL ASS
Sbjct: 184 AERTRNKLEQNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRRGLLSLVASS 243

Query: 250 KR----------------------SNP-------SLEKSPLSQEHVHEQVEKLESQLTEL 280
           +                       +NP         +K+ +S + V E+ E L + L  L
Sbjct: 244 RNMDSQISEEDLDTSSRTSSQSNIANPLGNELGSEQKKNAISHKLVREKFEVLRNDLKNL 303

Query: 281 ESHRDENGKFKSLETDKVEDKGQNVLNGLLDDCHDLISDLSHQKNGG----IELDAKLQP 336
           E+HRDE+GKFKSLETDKV + GQ VLNGLLDDC+DL+SDLSHQ   G    + +D  LQP
Sbjct: 304 EAHRDEDGKFKSLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPSLQP 363

Query: 337 IYEQLIDIKTSLENLLVTRRWTLRETDLFTFQKQLSEIDSLRVHGKFPTDSGTSKGQSIL 396
           +YE+L++IKT+LENL++TRRWTLRETDLF++QK+L+EID+LRV+G+FPT++  S+GQSIL
Sbjct: 364 VYERLLEIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTETADSRGQSIL 423

Query: 397 LYLLRRCFAIIYKXXXXXXXXXXXXQPIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMK 456
           LYLLRRC+AIIYK            QPIHNQLSTVRRCLLELKRMGGVNN+RELYPYQMK
Sbjct: 424 LYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMK 483

Query: 457 LASLDDLRTDGKFYDSDGNIPEGQGTLNALLAECFDIVHELKI 499
           LASLD+LR DG FYDSDGNIPEGQG LNALLA CFDI+HELK+
Sbjct: 484 LASLDNLRQDGIFYDSDGNIPEGQGILNALLAGCFDIIHELKV 526

>Ecym_8352 Chr8 complement(703563..705302) [1740 bp, 579 aa] {ON}
           similar to Ashbya gossypii ADL019W
          Length = 579

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/561 (58%), Positives = 406/561 (72%), Gaps = 40/561 (7%)

Query: 9   ASNSQHPQDVPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVLTKVRELDQ 68
           +S +Q  Q +PKEEE IL+Y L +RN L +LKQNR Q+L SK+V   YQ+VLTKVRELD+
Sbjct: 2   SSANQGEQGIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELDK 61

Query: 69  IRKSNHDTPSN--SATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLS 126
           IRK+ H++  N    TTLIHS +LHNRVDSV+DDVFQLLSLCFLTVGLKNSAPATYASLS
Sbjct: 62  IRKTTHESSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASLS 121

Query: 127 TVQRLLEHLNESNVFTQHDLRPIRERLLEISKIVENSSYKN--------EVSGDNLEDID 178
           TVQ LL+HLNESNV+T +DL+PI+ERL EIS+IVE +SY N            D+LED  
Sbjct: 122 TVQSLLDHLNESNVYTHNDLKPIKERLDEISEIVEKNSYWNIPTDGGDGNAFADDLED-- 179

Query: 179 EKLPEADRKFYEERNKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLFEI 238
                       +R +N IEE+LLLRAKL++CL  Y+  E+K+E I   L   ME+LF+I
Sbjct: 180 ------------KRKENNIEENLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQI 227

Query: 239 RRGLLSLAASSKRSNPSLEKSP-------LSQEHVHEQVEKLESQLTELESHRDENGKFK 291
           RRGLLSLAAS+K      E+         LS E ++E+++ LE++L ++ SHR+E+GKF 
Sbjct: 228 RRGLLSLAASAKSRVEQEEQDENDDELCILSHEKINERLKALETELADVRSHRNESGKFV 287

Query: 292 SL-ETDKVEDKGQNVLNGLLDDCHDLISDLSHQKNGGIELDAKLQPIYEQLIDIKTSLEN 350
           S+ + + V +KGQ VLNGLLDDCHDLI DLSHQ + G++LD  +QPIY+ L+ IKT LEN
Sbjct: 288 SVNDPNDVPEKGQFVLNGLLDDCHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKTILEN 347

Query: 351 LLVTRRWTLRETDLFTFQKQLSEIDSLRVHGKFPTDSGTSKGQSILLYLLRRCFAIIYKX 410
           LLVTRRWTLRETDLFT+QK+L+E+DSLRV+GKFP++S  SKGQ+ILLYLLRRC+AIIYK 
Sbjct: 348 LLVTRRWTLRETDLFTYQKKLAELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAIIYKL 407

Query: 411 XXXXXXXXXXXQPIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDDLRTDGKFY 470
                      + IHNQLSTVR CLLELKRMGGV+N+RELYPYQMKLASLD++R DGKFY
Sbjct: 408 LESSEPVSESLERIHNQLSTVRHCLLELKRMGGVDNERELYPYQMKLASLDNMRVDGKFY 467

Query: 471 DSDGNIPEGQGTLNALLAECFDIVHELKIXXXXXXXXXXXXXXXXXXDDGLVNDT-DNDN 529
           D DGNIPEGQGTLNALLAECFDI+HE+KI                   + + N T     
Sbjct: 468 DPDGNIPEGQGTLNALLAECFDILHEMKIEAEVREEAAQSNEAGEKPPNNINNQTIQMTK 527

Query: 530 DGD-------QPVARYLDVHN 543
           DG        +P  RYLDV+N
Sbjct: 528 DGTNRDVAEVRPNIRYLDVYN 548

>TBLA0A00930 Chr1 (206453..208213) [1761 bp, 586 aa] {ON} Anc_7.125
           YPL260W
          Length = 586

 Score =  615 bits (1587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/513 (61%), Positives = 396/513 (77%), Gaps = 22/513 (4%)

Query: 1   MVVSLPVAASNSQHPQDVPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVL 60
           M   L   AS + HPQ VP EEE ILN+LL VR  L +LKQNR Q+LN+K+VQ  YQ VL
Sbjct: 1   MSAQLTPLASRNNHPQIVPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVL 60

Query: 61  TKVRELDQIRKSNHDTPSNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPA 120
           TKVRELD+IRK++  TP+ +ATTLIH ++LHNRVDSVLDDVFQLLSLCFLTVG+KNSAPA
Sbjct: 61  TKVRELDEIRKNSLTTPAKTATTLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPA 120

Query: 121 TYASLSTVQRLLEHLNESNVFTQHDLRPIRERLLEISKIVENSSYKNEVSGDN----LED 176
           TY+SLSTVQ LLEHLNES +FT HDLRPI+ERL EI +IVE SSY+N+   D+    L  
Sbjct: 121 TYSSLSTVQCLLEHLNESRMFTMHDLRPIKERLDEIQEIVEKSSYRNDEFNDSALVGLSK 180

Query: 177 IDEKLPEADRKFYEERNKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLF 236
            + +L E +     ER +N+IEEDLL+RAKLQ C+++++  ES++E+I+P+L++I++KL+
Sbjct: 181 QEHELIEIEN----ERTRNRIEEDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLY 236

Query: 237 EIRRGLLSLAASSKRSNPSLEKSP-----------LSQEHVHEQVEKLESQLTELESHRD 285
            IRRGLLSLA+ +   N +L KS              + H    + K++ QL E+ES RD
Sbjct: 237 HIRRGLLSLASPT---NDTLSKSDNNHIASTNHNVSDKSHKELVLLKMKKQLVEIESQRD 293

Query: 286 ENGKFKSLETDKVEDKGQNVLNGLLDDCHDLISDLSHQKNGGIELDAKLQPIYEQLIDIK 345
           ENG +KSLET+KVE +GQ ++N L+DDC+DLI+DLSH +NG I  D  LQ IY+ LIDIK
Sbjct: 294 ENGYYKSLETNKVEMEGQGIVNKLVDDCNDLINDLSHTQNGNIITDPYLQQIYKNLIDIK 353

Query: 346 TSLENLLVTRRWTLRETDLFTFQKQLSEIDSLRVHGKFPTDSGTSKGQSILLYLLRRCFA 405
           T+L NL+VTRRWTLRETDLF++QK+L+EIDSLRV+GKF + +  +KGQSI+LYLLRRC+A
Sbjct: 354 TNLANLMVTRRWTLRETDLFSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILYLLRRCYA 413

Query: 406 IIYKXXXXXXXXXXXXQPIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDDLRT 465
           IIYK            Q IH QLSTVRRCL+ LKR+GGV + +ELYPYQMKLASLD+LR 
Sbjct: 414 IIYKLLESSEPISESLQSIHTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLASLDELRI 473

Query: 466 DGKFYDSDGNIPEGQGTLNALLAECFDIVHELK 498
           DGKFYD++G+IPEGQG LNA+LAECFD+VHELK
Sbjct: 474 DGKFYDANGDIPEGQGILNAMLAECFDMVHELK 506

>Kpol_322.7 s322 (16650..18254) [1605 bp, 534 aa] {ON}
           (16650..18254) [1605 nt, 535 aa]
          Length = 534

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/497 (63%), Positives = 389/497 (78%), Gaps = 10/497 (2%)

Query: 4   SLPVAASNSQHPQDVPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVLTKV 63
           S+   A  S++   VPKEEESIL YLL VR  L +LK NR Q+LNSKEVQN++Q+VLTKV
Sbjct: 6   SVASTADLSKYMYGVPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQEVLTKV 65

Query: 64  RELDQIRKSNHDTPSNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYA 123
           RELD IRK      +  + T+IH+  LHN+VDS+LDDVFQLLSLCFLTVGLKNSAPATY+
Sbjct: 66  RELDDIRKRQAGEDAVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNSAPATYS 125

Query: 124 SLSTVQRLLEHLNESNVFTQHDLRPIRERLLEISKIVENSSYKNEVSGDNLEDIDEKLPE 183
           SLSTVQ+LLEHL+ESN+FT HDLRPI++RL EIS IVEN+SY+N        D D   P 
Sbjct: 126 SLSTVQKLLEHLDESNIFTNHDLRPIKDRLDEISTIVENNSYRNY-------DFDLTNPA 178

Query: 184 ADRKFYEERNKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLFEIRRGLL 243
            + +  E+RNKNKIEEDLLLRAKL+HCLDEY+   SK+EEI P L++IMEKL+ IRR LL
Sbjct: 179 DETE--EKRNKNKIEEDLLLRAKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIRRSLL 236

Query: 244 SLAASSKRSNPSLEKSPL-SQEHVHEQVEKLESQLTELESHRDENGKFKSLETDKVEDKG 302
           SLA+ S++ +   + S   S +   E +  LE +L ELESHRDENG FKSLET +V  KG
Sbjct: 237 SLASPSRKIDTREDFSQFNSSKESQEALSSLEQELEELESHRDENGNFKSLETGEVVLKG 296

Query: 303 QNVLNGLLDDCHDLISDLSHQKNGGIELDAKLQPIYEQLIDIKTSLENLLVTRRWTLRET 362
           QNVL GL+D+CHDLI+D ++  NG   +D +L+PIY++LI+IKT+L NL++TRRWTLR+T
Sbjct: 297 QNVLAGLVDNCHDLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTLRDT 356

Query: 363 DLFTFQKQLSEIDSLRVHGKFPTDSGTSKGQSILLYLLRRCFAIIYKXXXXXXXXXXXXQ 422
           DLF +QK+L  ID+ RV+GKFPT SG +KGQ+ILLYLLRRC+AIIYK            Q
Sbjct: 357 DLFQYQKKLQAIDNKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKLLESSVPVSESLQ 416

Query: 423 PIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDDLRTDGKFYDSDGNIPEGQGT 482
            IHNQLST RRCLL LKRMGGVN++RELYPYQ+KLASLD+LR DGKF+D++G IPEGQGT
Sbjct: 417 SIHNQLSTARRCLLSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEIPEGQGT 476

Query: 483 LNALLAECFDIVHELKI 499
           LNALLAECFDI+HEL+I
Sbjct: 477 LNALLAECFDIMHELEI 493

>TPHA0C01610 Chr3 (373462..375117) [1656 bp, 551 aa] {ON} Anc_7.125
           YPL260W
          Length = 551

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/537 (58%), Positives = 385/537 (71%), Gaps = 29/537 (5%)

Query: 18  VPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVLTKVRELDQIRKSN---- 73
           VP+ E  IL YL+ VR  L QLK NR +YLNSKEV+ ++Q+VLTKVRELD IRKS     
Sbjct: 17  VPESEHDILKYLIDVRVRLTQLKTNRSKYLNSKEVRLLHQEVLTKVRELDDIRKSKLKDD 76

Query: 74  --HDTPSNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQRL 131
              D+ +   TTL+ +  LHN+VDS++DDVFQLLSLCFLTVGLKNSAPATY SLSTVQ+L
Sbjct: 77  GQDDSQTQQITTLLCNLTLHNKVDSLVDDVFQLLSLCFLTVGLKNSAPATYTSLSTVQKL 136

Query: 132 LEHLNESNVFTQHDLRPIRERLLEISKIVENSSYKN------EVSGDNLEDIDEKLPEAD 185
           LEHL+ESN+FT HDLRPI+ERL EISKIV+N+SYKN      E++ + ++D         
Sbjct: 137 LEHLDESNIFTNHDLRPIKERLDEISKIVQNNSYKNYEFNEDEINPNQVDD--------- 187

Query: 186 RKFYEERNKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLFEIRRGLLSL 245
               +E  +N IEEDLLLRAKL+ C DE+    SK+EEIDP L +IMEKL+ IRR LLSL
Sbjct: 188 ----DEIKQNLIEEDLLLRAKLKFCNDEFARIHSKLEEIDPELNSIMEKLYHIRRNLLSL 243

Query: 246 AASSKRSNPSLEKSPLSQ-EHVHEQVEKLESQLTELESHRDENGKFKSLETDKVEDKGQN 304
           A+ + + + +   S  +  E   + ++ L  +LTELE+HRDE+G FKSLET++V+ KGQN
Sbjct: 244 ASPTHKIDTTENISIFNNNEESRKMLKHLSDELTELETHRDEDGNFKSLETNEVKLKGQN 303

Query: 305 VLNGLLDDCHDLISDLSHQKNGGIELDAKLQPIYEQLIDIKTSLENLLVTRRWTLRETDL 364
            L GL+D+CHDLI+D ++       LD  LQPIY  LI+IKT+L NL++TRRWTLRETDL
Sbjct: 304 ALAGLVDNCHDLINDFTNSSGDNQILDKNLQPIYNNLINIKTNLANLMITRRWTLRETDL 363

Query: 365 FTFQKQLSEIDSLRVHGKFPTDSGTSKGQSILLYLLRRCFAIIYKXXXXXXXXXXXXQPI 424
           F +QK+L EID  RV+GKFP++SG +KGQSILLYLLRRC+AIIYK            QPI
Sbjct: 364 FQYQKRLKEIDDQRVNGKFPSESGNTKGQSILLYLLRRCYAIIYKLLESSEPVSESLQPI 423

Query: 425 HNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDDLRTDGKFYDSDGNIPEGQGTLN 484
           HNQLST RRCLL LKRMGGVN+ RELYPYQ+KLASLD+LR DGKFYDS G IPEGQGTLN
Sbjct: 424 HNQLSTTRRCLLALKRMGGVNSPRELYPYQLKLASLDELRIDGKFYDSSGEIPEGQGTLN 483

Query: 485 ALLAECFDIVHELKIXXXXXXXXXXXXXXXXXXDDGLVNDTDNDNDGDQPVARYLDV 541
           ALLAECFD++HEL+I                  D+    D  +D   D+P AR L+ 
Sbjct: 484 ALLAECFDMLHELEIESEESVDNENDTADSIQDDNEDYRDVSDD---DRPAARSLNT 537

>KAFR0L00460 Chr12 (84023..85558) [1536 bp, 511 aa] {ON} Anc_7.125
           YPL260W
          Length = 511

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/486 (62%), Positives = 370/486 (76%), Gaps = 15/486 (3%)

Query: 16  QDVPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVLTKVRELDQIRKSNH- 74
           Q VPKEEE  L+YLL VR  L  LKQNR Q+LNSK++Q  YQ+VLTKVRELD+IR+  H 
Sbjct: 10  QAVPKEEEVFLDYLLKVRQNLSDLKQNRSQFLNSKDIQFTYQRVLTKVRELDEIRRQKHG 69

Query: 75  DTPSNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQRLLEH 134
           ++      T +HS ELHNRVD+VLDDVFQLLSLCF+T GLKNSAPATYASLSTVQ LLEH
Sbjct: 70  NSQETEIKTFVHSPELHNRVDNVLDDVFQLLSLCFITCGLKNSAPATYASLSTVQSLLEH 129

Query: 135 LNESNVFTQHDLRPIRERLLEISKIVENSSYKNEVS-GDNLEDIDEKLPEADRKFYEERN 193
           L ES ++T HDL+PI+ERL EI+KIV+ +   N       L+D D ++   D     ERN
Sbjct: 130 LIESKIYTHHDLKPIKERLDEIAKIVDQNCESNTYQDASTLDDDDNEVSRID----NERN 185

Query: 194 KNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLFEIRRGLLSLAASSKRSN 253
           KNKIE++LLL+AKL HCL EY+  ES++EE+DP   +++EKLF+IRR L+SL   SK SN
Sbjct: 186 KNKIEQNLLLQAKLNHCLHEYNYIESQLEEVDPSSNSLVEKLFQIRRNLVSLVEISK-SN 244

Query: 254 PSLEKSPLSQEHVHEQVEKLESQLTELESHRDENGKFKSLETDKVEDKGQNVLNGLLDDC 313
             +      Q+ + ++++ L+ QL E+E++RD +G F S+E+     KG NVLNGL DDC
Sbjct: 245 TGV------QDQIDKKLKHLQLQLNEIENNRDPDGNFVSIESGNPIIKGSNVLNGLSDDC 298

Query: 314 HDLISDLSHQKNGGIELDAKLQPIYEQLIDIKTSLENLLVTRRWTLRETDLFTFQKQLSE 373
           HDLISDL+H       LD  LQ +Y+ LID+K SLENL+VTRRWTLRETDLF++ K+L+E
Sbjct: 299 HDLISDLTHHTKTF--LDPDLQNVYDNLIDVKGSLENLMVTRRWTLRETDLFSYLKKLNE 356

Query: 374 IDSLRVHGKFPTDSGTSKGQSILLYLLRRCFAIIYKXXXXXXXXXXXXQPIHNQLSTVRR 433
           ID+LRV GKFPT SG++KGQ+ILLYLLRRC+ +IYK            QPIHNQLSTVRR
Sbjct: 357 IDNLRVDGKFPTKSGSTKGQAILLYLLRRCYTLIYKLLESSEPVSEALQPIHNQLSTVRR 416

Query: 434 CLLELKRMGGVNNDRELYPYQMKLASLDDLRTDGKFYDSDGNIPEGQGTLNALLAECFDI 493
           CLL+LKRMGGVNN+RELYPYQMKLASLD+LR DGKFYDS GNIPEGQG LNALLA CFDI
Sbjct: 417 CLLDLKRMGGVNNERELYPYQMKLASLDNLRKDGKFYDSKGNIPEGQGILNALLAGCFDI 476

Query: 494 VHELKI 499
           +HELKI
Sbjct: 477 LHELKI 482

>ADL019W Chr4 (675941..677518) [1578 bp, 525 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL260W
          Length = 525

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/452 (61%), Positives = 339/452 (75%), Gaps = 18/452 (3%)

Query: 56  YQQVLTKVRELDQIRKSNHDTP-SNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGL 114
           YQ VLTKVR LDQ+RK  H    +    TLIHS  LHNRVDSVLDDVFQLLSL FLTVGL
Sbjct: 4   YQAVLTKVRLLDQVRKQRHGAEDTTGGFTLIHSAALHNRVDSVLDDVFQLLSLSFLTVGL 63

Query: 115 KNSAPATYASLSTVQRLLEHLNESNVFTQHDLRPIRERLLEISKIVENSSYKNEVSGDNL 174
           KN+APATYASLSTVQRLLEH+ E+NV+T  DLRPI+ERL EI +IVE +SY + V  +  
Sbjct: 64  KNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEKNSYMSMVEDE-- 121

Query: 175 EDIDEKLPEADRKFYEERNKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEK 234
             +DE          EE+  NK+EEDLL+RAKLQHC+D Y   +SK   I P L  + +K
Sbjct: 122 APLDE--------LAEEKRLNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQPLSDK 173

Query: 235 LFEIRRGLLSLAASSKRSNPSLEKS------PLSQEHVHEQVEKLESQLTELESHRDENG 288
           LF IRR LLSLAAS+K    + E S      P S   +  +++ LES + E+ESHRD++G
Sbjct: 174 LFHIRRELLSLAASAKTDRAAGEGSTERSTTPASPNTLASRLKDLESMILEVESHRDDSG 233

Query: 289 KFKSLE-TDKVEDKGQNVLNGLLDDCHDLISDLSHQKNGGIELDAKLQPIYEQLIDIKTS 347
           KF S +  D V  KGQ+ LNGLLDDC +L  DLSHQ +G + LD +LQPIYE+L++IKT+
Sbjct: 234 KFISPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQLQPIYEELLEIKTT 293

Query: 348 LENLLVTRRWTLRETDLFTFQKQLSEIDSLRVHGKFPTDSGTSKGQSILLYLLRRCFAII 407
           LENLLVTRRWTLRETDLF +QK+L+E+D+LRV+ K P+ S  SKGQ+++LYLLRRC+A I
Sbjct: 294 LENLLVTRRWTLRETDLFAYQKRLAELDNLRVNRKSPSSSSASKGQALILYLLRRCYATI 353

Query: 408 YKXXXXXXXXXXXXQPIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDDLRTDG 467
           YK            Q IHNQLSTVRRCL ELKRMGGV+++R+LYPYQMKLASLD++R DG
Sbjct: 354 YKLLESSEPVSESLQKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQMKLASLDNMRVDG 413

Query: 468 KFYDSDGNIPEGQGTLNALLAECFDIVHELKI 499
           KFYD+DGNIPEGQGTLNALLAECFDI+HE+KI
Sbjct: 414 KFYDADGNIPEGQGTLNALLAECFDILHEMKI 445

>Kpol_1062.58 s1062 complement(129362..129739,129741..130838) [1476
           bp, 491 aa] {ON}
           complement(129362..129739,129741..130838) [1476 nt, 492
           aa]
          Length = 491

 Score =  162 bits (410), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 130/418 (31%), Positives = 211/418 (50%), Gaps = 49/418 (11%)

Query: 120 ATYASLSTVQRLLEHLNESNVFTQHDLRPIRERLLEISKIVENSSYK------------- 166
           + Y+S+  ++ LL  LN+SN+FT +DL P++ RL EI  I+E + Y              
Sbjct: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILE-ADYSLLQECEENDNEDN 131

Query: 167 -------------NEVSGDNLEDIDEKLPEADRKFYEERNKNKIEEDLLLRAKLQH---C 210
                        NE+ G N  DI       D   YE     K ++  L +   Q    C
Sbjct: 132 EDNEDNDENIQGVNEIGG-NSGDIPTPQTSYD---YENGKLQKCDDSNLKKYIFQELDDC 187

Query: 211 LDEYHSTESKVEEIDPHLTTIMEKLFEIRRGLLSLAASSKRSNPSLEKSPLSQEHVHEQV 270
              ++  E K + ID +L+++++K+  +R+ LL +  S  +S     +  + ++  H   
Sbjct: 188 YKVHNVIELKTDNIDVNLSSLLDKVLVVRKDLLYIVFSRVKS--VFPQCFVLKDPNHMSN 245

Query: 271 EKLESQLTELESHRDENGKFKSLETDKVEDK---------GQNVLNGLLDDCHDLISDLS 321
              + +L E++ + D   K K+ E D+ + +         GQ +LNGL+D C ++I D+ 
Sbjct: 246 STFDKKLNEIQRNLDV-IKEKNTEYDEGQSQRNKNEGNINGQRILNGLVDYCQEVIHDVK 304

Query: 322 HQKNGGIELDAKLQPIYEQLIDIKTSLENLLVTRRWTLRETDLFTFQKQLSEIDSLRVHG 381
                 I+ D K   ++E+ + +K  LE +LVT R +L+  DLF   K+LS+++   +  
Sbjct: 305 LLAIDKID-DEKKANLFEKSLLLKIKLETILVTNRHSLKSLDLFNLHKELSKLEKRTIRH 363

Query: 382 KFPTDSGTSKGQSILLYLLRRCFAIIYKXXXXXXXXXXXXQPIHNQLSTVRRCLLELKRM 441
               DS  +K  SI+++ LRRC  IIYK            +P++NQLST+ R LL+LK  
Sbjct: 364 YNIEDSFQAK--SIIIFFLRRCHCIIYKILESSEPVPHCLRPLYNQLSTLARYLLKLKIA 421

Query: 442 GGVNNDRELYPYQMKLASLDDLRTDGKFYDSDGNIPEGQGTLNALLAECFDIVHELKI 499
           GGV    +L P ++KL ++ D R +  F D  GNIP GQ  LNALL EC +++  L+I
Sbjct: 422 GGVEKMDDLLPVELKLNNIIDRRINENFPDESGNIPGGQRALNALLHECMELLKILEI 479

>Skud_14.88 Chr14 (164165..168115) [3951 bp, 1316 aa] {ON} YNL250W
           (REAL)
          Length = 1316

 Score = 35.4 bits (80), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 58/226 (25%), Positives = 100/226 (44%), Gaps = 42/226 (18%)

Query: 141 FTQHDLRPIRERLLEISKIVEN-----SSYKNEVS-----GDNLEDIDEKLPEADRKFYE 190
           F + D+RP+ ER   + K +++      S  +E+S     GD ++ +DE L +  RK  +
Sbjct: 791 FAESDIRPLIERFTYVEKEIKDLENNSKSISDELSIYSTSGDGIQTVDE-LRDQQRKMND 849

Query: 191 ERNKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLFEIRRGLLSLAASSK 250
                       LR   +H L      + KV+E    ++   EK  ++     SL     
Sbjct: 850 S-----------LRQLRKHILGIQMEKDEKVKESSRIISLTKEKELKVSEIESSLTQKQN 898

Query: 251 RSNPSLEKSPLSQEHVHEQVEKLESQLTELESHRDENGKFKSLETDKVEDKGQNVLNGLL 310
             N S++   ++ + +  +VE LES++  L++ RDE                +NVL+ L 
Sbjct: 899 IDN-SIKSKEVNIKDIDSRVEALESRIVSLQNKRDE---------------SKNVLDQLK 942

Query: 311 DDCHDLISDLSHQKNGG--IELDAKLQPIYEQLIDIKTSLENLLVT 354
           ++    IS  S QKN      L  + Q IY+++ID ++   N L T
Sbjct: 943 NERDLQIS--SKQKNVADVNRLIDRYQTIYKEVIDFESKGFNELQT 986

>KLLA0A04884g Chr1 (433581..436760) [3180 bp, 1059 aa] {ON} similar
           to uniprot|P32767 Saccharomyces cerevisiae YGL016W
           KAP122 Karyopherin beta responsible for import of the
           Toa1p-Toa2p complex into the nucleus binds to
           nucleoporins Nup1p and Nup2p may play a role in
           regulation of pleiotropic drug resistance
          Length = 1059

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 53/111 (47%), Gaps = 21/111 (18%)

Query: 51  EVQNIYQQVLTKVRELDQIRKSNHDTPSNSATTLIHSTELHNRVDSVLDDVFQLLSLCFL 110
           ++ +I+Q  L  +  +  +  SN   P+ ++  L+  T+L +            LSL FL
Sbjct: 76  QLWSIFQGNLVHLTRMMFLFTSN---PAAASNLLVTITKLMSN-----------LSLIFL 121

Query: 111 TVGL------KNSAPATYASLSTVQRLLEHLNESNVF-TQHDLRPIRERLL 154
           T+         N  PA    ++T  +LL+H NESN+F  + D   I ERL+
Sbjct: 122 TINSDAIGADSNKIPAWRNPVNTCIKLLQHCNESNLFEWRTDNSEIAERLV 172

>YGL151W Chr7 (217524..220922) [3399 bp, 1132 aa] {ON}
           NUT1Component of the RNA polymerase II mediator complex,
           which is required for transcriptional activation and
           also has a role in basal transcription
          Length = 1132

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 15/74 (20%)

Query: 150 RERLLEISK-----IVENSSYKNEVSGDNLEDIDEKLPEADRKFYEERNKNKI-EEDLLL 203
           R+ ++ I+K     I+ENSS    V  + L++IDEK+ +A R ++ E++ NK   EDL  
Sbjct: 371 RKWVIFITKHLPLLILENSSRSPRVVTNALDNIDEKVVKAIRIYFTEKDDNKTNNEDL-- 428

Query: 204 RAKLQHCLDEYHST 217
                   D+Y ST
Sbjct: 429 -------FDDYPST 435

>CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa]
           {ON} similar to uniprot|P47037 Saccharomyces cerevisiae
           YJL074c SMC3 required for structural maintenance of
           chromosomes
          Length = 1219

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 31/57 (54%)

Query: 241 GLLSLAASSKRSNPSLEKSPLSQEHVHEQVEKLESQLTELESHRDENGKFKSLETDK 297
           G  S     K S   ++++   +  +  ++E+LES+L E+E  R E  K+ SLE D+
Sbjct: 172 GAKSFEVKLKASMKQMDETEQKRAQISAEMEELESKLNEMEKERKELEKYNSLERDR 228

>KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035)
           [1488 bp, 495 aa] {ON} similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 495

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 57/132 (43%), Gaps = 23/132 (17%)

Query: 84  LIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQRLLEHLNESNVFTQ 143
           L+   +  +R    LD+  Q+  L  L VGLKN     Y + ST+Q L            
Sbjct: 78  LVSKPQKEHRFIEDLDESAQMQHLSQLPVGLKNLGNTCYMN-STLQAL------------ 124

Query: 144 HDLRPIRERLLEISKIVENSSYKNEVSGDNLEDIDEKLPEADRKFYEERNK-NKIEEDLL 202
           + +RP+RE +L      EN S +  +         + + E  R F + R++  +    +L
Sbjct: 125 YQIRPLREEILNFQPPKENRSGEQHI---------QLVAELKRCFQQLRDRPQESTTPIL 175

Query: 203 LRAKLQHCLDEY 214
           L A L+ C  ++
Sbjct: 176 LLATLRKCYPQF 187

>Suva_7.113 Chr7 (213621..217007) [3387 bp, 1128 aa] {ON} YGL151W
           (REAL)
          Length = 1128

 Score = 31.6 bits (70), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 15/74 (20%)

Query: 150 RERLLEISK-----IVENSSYKNEVSGDNLEDIDEKLPEADRKFYEERNKNK-IEEDLLL 203
           R+ ++ ISK     I+ENSS    V  + L++IDEK+ +A R ++ E++  K   EDL  
Sbjct: 371 RQWVIFISKHLPLLILENSSRSPRVVTNALDNIDEKVIKAIRIYFTEKDDIKSTNEDL-- 428

Query: 204 RAKLQHCLDEYHST 217
                   D+Y ST
Sbjct: 429 -------FDDYPST 435

>TPHA0F02620 Chr6 complement(577529..580285) [2757 bp, 918 aa] {ON}
           Anc_6.70 YLR273C
          Length = 918

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 44/99 (44%), Gaps = 8/99 (8%)

Query: 277 LTELESHRDENGKFKSLETDKVEDKGQNVLNGLLDDCHDLISDLSHQKNGGIELDAK--- 333
           L + E + D + KF   E +   D+G + L+ L+++ +    DL  + N       K   
Sbjct: 172 LRQFEINNDNDSKFPFFENNDDSDEGDSELDHLINNSYLFSKDLFFKSNKNYTFSPKPMN 231

Query: 334 ----LQPIYEQLIDIKTSLENLLVTRRWTLRETDLFTFQ 368
               +       ID  TSL   + T+ W L ++++ +F+
Sbjct: 232 QNQNIDDAINDFIDC-TSLHRAVTTKNWKLLKSNVSSFE 269

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.132    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,040,511
Number of extensions: 2773884
Number of successful extensions: 12583
Number of sequences better than 10.0: 580
Number of HSP's gapped: 12992
Number of HSP's successfully gapped: 737
Length of query: 587
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 472
Effective length of database: 40,294,809
Effective search space: 19019149848
Effective search space used: 19019149848
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)