Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0H025307.194ON31131116750.0
ZYRO0D15796g7.194ON30831313900.0
YIL021W (RPB3)7.194ON31831913890.0
NCAS0E018307.194ON31831813820.0
KAFR0A026507.194ON31231613790.0
Suva_9.1787.194ON31932013770.0
Skud_9.1487.194ON31831913750.0
Smik_9.1697.194ON31831913730.0
CAGL0J02420g7.194ON31231513600.0
NDAI0G020007.194ON31131113470.0
SAKL0F07458g7.194ON31532013350.0
Kpol_1063.117.194ON31631713120.0
TBLA0J015207.194ON33527512951e-180
TPHA0C045107.194ON31031212831e-179
KNAG0H027007.194ON32632612831e-179
ADL120C7.194ON31132212641e-176
KLLA0D16170g7.194ON30731312601e-176
KLTH0E04598g7.194ON32829312621e-175
Kwal_55.203807.194ON32328512511e-174
Ecym_43827.194ON31130912461e-173
Kpol_1018.1393.428ON3352922454e-23
CAGL0B04125g3.428ON3342902368e-22
Kpol_473.33.428ON3202842296e-21
ZYRO0C12364g3.428ON3352912296e-21
KAFR0A055203.428ON3342972262e-20
KLLA0D14861g3.428ON3342872253e-20
TPHA0D039203.428ON3352912243e-20
Smik_16.3533.428ON3352892226e-20
ADR031C3.428ON3642912211e-19
TDEL0F031003.428ON3351962192e-19
Suva_16.4383.428ON3352962182e-19
KNAG0A076003.428ON3341952173e-19
TBLA0F017003.428ON3331952173e-19
SAKL0F06028g3.428ON3342872174e-19
YPR110C (RPC40)3.428ON3352892164e-19
Skud_16.3973.428ON3352852139e-19
KLTH0F12056g3.428ON3502742131e-18
NDAI0A047703.428ON3352972103e-18
Ecym_44503.428ON3342872093e-18
NCAS0A115203.428ON3351972077e-18
Kwal_23.39983.428ON3341952069e-18
NDAI0G050201.427ON109775741.1
KNAG0B004103.544ON77178712.6
Kwal_27.123358.798ON48760702.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0H02530
         (311 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0H02530 Chr8 (425329..426264) [936 bp, 311 aa] {ON} Anc_7.19...   649   0.0  
ZYRO0D15796g Chr4 complement(1319952..1320878) [927 bp, 308 aa] ...   540   0.0  
YIL021W Chr9 (312905..313861) [957 bp, 318 aa] {ON}  RPB3RNA pol...   539   0.0  
NCAS0E01830 Chr5 (355752..356708) [957 bp, 318 aa] {ON} Anc_7.19...   536   0.0  
KAFR0A02650 Chr1 (548878..549816) [939 bp, 312 aa] {ON} Anc_7.19...   535   0.0  
Suva_9.178 Chr9 (300119..301078) [960 bp, 319 aa] {ON} YIL021W (...   535   0.0  
Skud_9.148 Chr9 (282540..283496) [957 bp, 318 aa] {ON} YIL021W (...   534   0.0  
Smik_9.169 Chr9 (287469..288425) [957 bp, 318 aa] {ON} YIL021W (...   533   0.0  
CAGL0J02420g Chr10 complement(234977..235915) [939 bp, 312 aa] {...   528   0.0  
NDAI0G02000 Chr7 (449842..450777) [936 bp, 311 aa] {ON} Anc_7.19...   523   0.0  
SAKL0F07458g Chr6 complement(570134..571081) [948 bp, 315 aa] {O...   518   0.0  
Kpol_1063.11 s1063 (29092..29787,29789..30043) [951 bp, 316 aa] ...   509   0.0  
TBLA0J01520 Chr10 (344746..345753) [1008 bp, 335 aa] {ON} Anc_7....   503   e-180
TPHA0C04510 Chr3 complement(973590..974522) [933 bp, 310 aa] {ON...   498   e-179
KNAG0H02700 Chr8 (498753..499733) [981 bp, 326 aa] {ON} Anc_7.19...   498   e-179
ADL120C Chr4 complement(477033..477968) [936 bp, 311 aa] {ON} Sy...   491   e-176
KLLA0D16170g Chr4 complement(1362809..1363732) [924 bp, 307 aa] ...   489   e-176
KLTH0E04598g Chr5 (415348..416334) [987 bp, 328 aa] {ON} similar...   490   e-175
Kwal_55.20380 s55 (379749..380720) [972 bp, 323 aa] {ON} YIL021W...   486   e-174
Ecym_4382 Chr4 (803602..804537) [936 bp, 311 aa] {ON} similar to...   484   e-173
Kpol_1018.139 s1018 (370051..371058) [1008 bp, 335 aa] {ON} (370...    99   4e-23
CAGL0B04125g Chr2 complement(401513..402517) [1005 bp, 334 aa] {...    96   8e-22
Kpol_473.3 s473 complement(6708..7670) [963 bp, 320 aa] {ON} com...    93   6e-21
ZYRO0C12364g Chr3 complement(976920..977927) [1008 bp, 335 aa] {...    93   6e-21
KAFR0A05520 Chr1 (1101190..1102194) [1005 bp, 334 aa] {ON} Anc_3...    92   2e-20
KLLA0D14861g Chr4 complement(1253023..1254027) [1005 bp, 334 aa]...    91   3e-20
TPHA0D03920 Chr4 complement(821790..822797) [1008 bp, 335 aa] {O...    91   3e-20
Smik_16.353 Chr16 complement(623974..624981) [1008 bp, 335 aa] {...    90   6e-20
ADR031C Chr4 complement(761933..763027) [1095 bp, 364 aa] {ON} S...    90   1e-19
TDEL0F03100 Chr6 complement(567682..568689) [1008 bp, 335 aa] {O...    89   2e-19
Suva_16.438 Chr16 complement(753618..754625) [1008 bp, 335 aa] {...    89   2e-19
KNAG0A07600 Chr1 complement(1192867..1193871) [1005 bp, 334 aa] ...    88   3e-19
TBLA0F01700 Chr6 (423582..424583) [1002 bp, 333 aa] {ON} Anc_3.4...    88   3e-19
SAKL0F06028g Chr6 complement(453180..454184) [1005 bp, 334 aa] {...    88   4e-19
YPR110C Chr16 complement(745828..746835) [1008 bp, 335 aa] {ON} ...    88   4e-19
Skud_16.397 Chr16 complement(710663..711670) [1008 bp, 335 aa] {...    87   9e-19
KLTH0F12056g Chr6 (1016695..1017747) [1053 bp, 350 aa] {ON} high...    87   1e-18
NDAI0A04770 Chr1 (1091856..1092863) [1008 bp, 335 aa] {ON} Anc_3...    86   3e-18
Ecym_4450 Chr4 (921163..922167) [1005 bp, 334 aa] {ON} similar t...    85   3e-18
NCAS0A11520 Chr1 complement(2279808..2280815) [1008 bp, 335 aa] ...    84   7e-18
Kwal_23.3998 s23 (519065..520069) [1005 bp, 334 aa] {ON} YPR110C...    84   9e-18
NDAI0G05020 Chr7 (1217458..1220751) [3294 bp, 1097 aa] {ON} Anc_...    33   1.1  
KNAG0B00410 Chr2 (69475..71790) [2316 bp, 771 aa] {ON} Anc_3.544...    32   2.6  
Kwal_27.12335 s27 (1183798..1185261) [1464 bp, 487 aa] {ON} YOR3...    32   2.6  

>TDEL0H02530 Chr8 (425329..426264) [936 bp, 311 aa] {ON} Anc_7.194
           YIL021W
          Length = 311

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/311 (100%), Positives = 311/311 (100%)

Query: 1   MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLAD 60
           MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLAD
Sbjct: 1   MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY 180
           VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIAT 240
           DPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIAT
Sbjct: 181 DPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIAT 240

Query: 241 DQVVLRGIDTLQKKVASILLALNQMDQERVNFGTANNTGAIQDAGNVDVAMDGVQDQNPY 300
           DQVVLRGIDTLQKKVASILLALNQMDQERVNFGTANNTGAIQDAGNVDVAMDGVQDQNPY
Sbjct: 241 DQVVLRGIDTLQKKVASILLALNQMDQERVNFGTANNTGAIQDAGNVDVAMDGVQDQNPY 300

Query: 301 SNGGGAYDEAW 311
           SNGGGAYDEAW
Sbjct: 301 SNGGGAYDEAW 311

>ZYRO0D15796g Chr4 complement(1319952..1320878) [927 bp, 308 aa]
           {ON} highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 308

 Score =  540 bits (1390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/313 (81%), Positives = 285/313 (91%), Gaps = 7/313 (2%)

Query: 1   MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLAD 60
           MSE GPQVKIREAT++NVDFILS V+LAMANSLRR+M+AEIPTLAIDSVE+ETNT+VLAD
Sbjct: 1   MSEEGPQVKIREATRENVDFILSHVELAMANSLRRVMIAEIPTLAIDSVEVETNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY 180
           VSNLMGRN+GHPIIQDKEGNGVLICKLRKGQEL++KCVAKKGI+KEHAKWGP+AAIEFEY
Sbjct: 121 VSNLMGRNLGHPIIQDKEGNGVLICKLRKGQELTLKCVAKKGIAKEHAKWGPSAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIAT 240
           DPWNKLKHT+YW+EQD +KEWPLSKNSEYEDPPN+ + FDY+A ANTFYMNVE+VGS++T
Sbjct: 181 DPWNKLKHTEYWHEQDPAKEWPLSKNSEYEDPPNEGEPFDYRATANTFYMNVESVGSLST 240

Query: 241 DQVVLRGIDTLQKKVASILLALNQMDQERVNFGTANNTGAIQDAGNVDVAMDGVQDQNPY 300
           DQVVLRGIDTLQKKVASILLAL QMDQ++VNF +    GA+ D    D  M+G  D  PY
Sbjct: 241 DQVVLRGIDTLQKKVASILLALTQMDQDKVNFASGAPMGAVGDG---DTMMNG--DDYPY 295

Query: 301 --SNGGGAYDEAW 311
             + G G YD++W
Sbjct: 296 GATGGSGVYDDSW 308

>YIL021W Chr9 (312905..313861) [957 bp, 318 aa] {ON}  RPB3RNA
           polymerase II third largest subunit B44, part of central
           core; similar to prokaryotic alpha subunit
          Length = 318

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/319 (81%), Positives = 280/319 (87%), Gaps = 9/319 (2%)

Query: 1   MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLAD 60
           MSE GPQVKIREA+KDNVDFILS VDLAMANSLRR+M+AEIPTLAIDSVE+ETNTTVLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS DIEQLEY RDCFCEDHCDKCSVVLTLQA GESESTTNVY+KDLVI
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY 180
           VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQEL + CVAKKGI+KEHAKWGPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIAT 240
           DPWNKLKHTDYWYEQD +KEWP SKN EYEDPPN+ D FDYKA+A+TFYMNVE+VGSI  
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV 240

Query: 241 DQVVLRGIDTLQKKVASILLALNQMDQERVNFGTA-NNTGAIQDAGNVDVAMDGVQDQNP 299
           DQVV+RGIDTLQKKVASILLAL QMDQ++VNF +  NNT +     N DV M G + Q+P
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAE-QDP 299

Query: 300 YSN-------GGGAYDEAW 311
           YSN       G G YD AW
Sbjct: 300 YSNASQMGNTGSGGYDNAW 318

>NCAS0E01830 Chr5 (355752..356708) [957 bp, 318 aa] {ON} Anc_7.194
           YIL021W
          Length = 318

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/318 (81%), Positives = 279/318 (87%), Gaps = 7/318 (2%)

Query: 1   MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLAD 60
           MSE GPQVKIREATKDNVDFILS VDLA+ANS RR+M+AEIPTLAIDSV+IETNTTVLAD
Sbjct: 1   MSEAGPQVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS DIEQLEY RDCFCEDHCDKCSVVLTLQA GESESTTNVYAKDLVI
Sbjct: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHPIIQD+EGNGVLICKLRKGQEL + C+AKKGI+KEHAKWGPAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIAT 240
           DPWNKLKHTDYWYEQD +KEWP SKN EYEDPPN+ + FDYKAKA TFYMNVETVGSI  
Sbjct: 181 DPWNKLKHTDYWYEQDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPV 240

Query: 241 DQVVLRGIDTLQKKVASILLALNQMDQERVNFGTANN----TGAIQDAGNVDVAMDGVQD 296
           DQVV+RG+DTLQKKVASILLAL QMDQE+VNF T  N       + + G+ DV MDG  +
Sbjct: 241 DQVVVRGVDTLQKKVASILLALTQMDQEKVNFATNPNGVSGREGMMNGGDNDVNMDGGME 300

Query: 297 QNPY---SNGGGAYDEAW 311
           QN Y   +N GGAYD AW
Sbjct: 301 QNSYANVANPGGAYDNAW 318

>KAFR0A02650 Chr1 (548878..549816) [939 bp, 312 aa] {ON} Anc_7.194
           YIL021W
          Length = 312

 Score =  535 bits (1379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/316 (81%), Positives = 277/316 (87%), Gaps = 9/316 (2%)

Query: 1   MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLAD 60
           MSE GPQVKIREATKDNVDFILS VDLAMANSLRR+M+AEIPTLAIDSVE+ETNTTVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQSTDIEQLEY RDCFCEDHCDKCSVVLTLQA+GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHPIIQDKEGNGVLICKLRKGQEL + C+AKKGISKEHAKW PAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIAT 240
           DPWNKLKHT+YWYEQD  KEWP SKN EYEDPPN++D FDYKAKA+TFYMNVETVGSI+ 
Sbjct: 181 DPWNKLKHTNYWYEQDPEKEWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISV 240

Query: 241 DQVVLRGIDTLQKKVASILLALNQMDQERVNFGTANNTGAIQDAGNVDVAMDGVQ----- 295
           DQVV+RG+DTLQKKVASILLALNQMDQE+VN+     +GA  D    D+AM G +     
Sbjct: 241 DQVVVRGVDTLQKKVASILLALNQMDQEKVNYA----SGATADMNQGDIAMGGAEQDAFY 296

Query: 296 DQNPYSNGGGAYDEAW 311
              P SN  G YD AW
Sbjct: 297 SNMPNSNANGIYDNAW 312

>Suva_9.178 Chr9 (300119..301078) [960 bp, 319 aa] {ON} YIL021W
           (REAL)
          Length = 319

 Score =  535 bits (1377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/320 (80%), Positives = 280/320 (87%), Gaps = 10/320 (3%)

Query: 1   MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLAD 60
           MSE GPQVKIREA+KDNVDFIL+ VDLAMANSLRRIM+AEIPTLAIDSVE+ETNTTVLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS DIEQLEY RDCFCEDHCDKCSVVLTLQA GESESTTNVYAKDLVI
Sbjct: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHP+IQDKEGNGVLICKLRKGQEL + CVAKKGI+KEHAKWGPAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIAT 240
           DPWNKLKHTDYWYEQD +KEWP SKN EYEDPPN+ DAFDYKA+A+TFYMNVE+VGSI  
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITV 240

Query: 241 DQVVLRGIDTLQKKVASILLALNQMDQERVNFGTANNTGAIQDAG-NVDVAMDGVQDQNP 299
           DQVV+RGIDTLQKKVASILLAL QMDQ++VNF + +N  A    G N DV M G + Q+P
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNVASNMLGTNEDVMMTGAE-QDP 299

Query: 300 YSNG--------GGAYDEAW 311
           Y+N          G YD AW
Sbjct: 300 YANASQMGNTGSSGGYDNAW 319

>Skud_9.148 Chr9 (282540..283496) [957 bp, 318 aa] {ON} YIL021W
           (REAL)
          Length = 318

 Score =  534 bits (1375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/319 (81%), Positives = 278/319 (87%), Gaps = 9/319 (2%)

Query: 1   MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLAD 60
           MSE GPQVKIREA+KD VDFILS VDLAMANSLRR+M+AEIPTLAIDSVE+ETNTTVLAD
Sbjct: 1   MSEEGPQVKIREASKDGVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS DIEQLEY RDCFCEDHCDKCSVVLTLQA GESESTTNVY+KDLVI
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY 180
           VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQEL + CVAKKGI+KEHAKWGPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIAT 240
           DPWNKLKHTDYWYEQD +KEWP SKN EYEDPPN+ D FDYKA+A+TFYMNVE+VGSI  
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAEADTFYMNVESVGSIPV 240

Query: 241 DQVVLRGIDTLQKKVASILLALNQMDQERVNFGTANNTGAIQDAG-NVDVAMDGVQDQNP 299
           DQVV+RGIDTLQKKVASILLAL QMDQ++VNF + +N  A    G N DV M G + Q+P
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNAAPNMLGTNEDVVMTGAE-QDP 299

Query: 300 YSN-------GGGAYDEAW 311
           YSN       G   YD AW
Sbjct: 300 YSNASQMGNTGSSGYDNAW 318

>Smik_9.169 Chr9 (287469..288425) [957 bp, 318 aa] {ON} YIL021W
           (REAL)
          Length = 318

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/319 (81%), Positives = 279/319 (87%), Gaps = 9/319 (2%)

Query: 1   MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLAD 60
           MSE GPQVKIREA+KDNVDFILS VDLAMANSLRR+M+AEIPTLAIDSVE+ETNTTVLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS DIEQLEY RDCFCEDHCDKCSVVLTLQA GESESTTNVY+KDLVI
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY 180
           VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQEL + CVAKKGI+KEHAKWGPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIAT 240
           DPWNKLKHTDYWYEQD +KEWP SKN EYED PN+ D FDYKA+A+TFYMNVE+VGSI  
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDAPNEGDPFDYKAEADTFYMNVESVGSIPV 240

Query: 241 DQVVLRGIDTLQKKVASILLALNQMDQERVNFGTANNTGAIQDAG-NVDVAMDGVQDQNP 299
           DQVV+RGIDTLQKKVASILLAL QMDQ++VNF + +N  +    G N DV M G + Q+P
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNPSSNILGTNEDVMMAGAE-QDP 299

Query: 300 YSN-------GGGAYDEAW 311
           YSN       G G YD AW
Sbjct: 300 YSNASQMGNSGSGGYDSAW 318

>CAGL0J02420g Chr10 complement(234977..235915) [939 bp, 312 aa] {ON}
           highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021w RPB3
          Length = 312

 Score =  528 bits (1360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/315 (80%), Positives = 280/315 (88%), Gaps = 7/315 (2%)

Query: 1   MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLAD 60
           MSE GPQVKIREAT+DNVDFILS VDLA+ANSLRR+M+AEIPTLAIDSVE+ETNTTVLAD
Sbjct: 1   MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120
           EF+AHRLGLIPLQSTDIEQLEY RDCFCEDHCDKCSVVLTLQA+GESESTTNVYAKDL+I
Sbjct: 61  EFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLLI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY 180
           VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQEL + C+AKKGI+KEHAKWGPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIAT 240
           DPWNKL+HTDYWYE+DI KEWP SKN EYEDPPN D+ FDYKAKA+TFYMNVE VGSIA 
Sbjct: 181 DPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKADTFYMNVEAVGSIAV 240

Query: 241 DQVVLRGIDTLQKKVASILLALNQMDQERVNFGTANNTG-AIQDAGNVDVAMDGVQDQNP 299
           DQVVLRGIDTLQKKVASI+LALNQMDQE+VNF T +  G  I++ G+  + M+G     P
Sbjct: 241 DQVVLRGIDTLQKKVASIMLALNQMDQEKVNFATGDAKGNGIEEDGDA-MMMNG--HDGP 297

Query: 300 YSNGGGA---YDEAW 311
           Y + G +   Y  AW
Sbjct: 298 YGDNGRSSDTYGSAW 312

>NDAI0G02000 Chr7 (449842..450777) [936 bp, 311 aa] {ON} Anc_7.194
           YIL021W
          Length = 311

 Score =  523 bits (1347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/311 (80%), Positives = 272/311 (87%)

Query: 1   MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLAD 60
           MSE GPQVKIREATKDNVDFILS +DLA+ANS RR+M+AEIPTLAIDSV+IETNTTVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNIDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQSTDIEQLEY RDCFCEDHCDKCSVVLTLQA GESESTTNVYAKDLVI
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHPIIQDKE NGVLICKLRKGQEL + CVAKKGI+KEHAKWGPAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKENNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIAT 240
           DPWNKLKHTDYWYEQD  KEWP SKN EYEDPPN+ + FDYKAKA TFYMNVETVGSI+ 
Sbjct: 181 DPWNKLKHTDYWYEQDPQKEWPNSKNCEYEDPPNEGEPFDYKAKAETFYMNVETVGSISV 240

Query: 241 DQVVLRGIDTLQKKVASILLALNQMDQERVNFGTANNTGAIQDAGNVDVAMDGVQDQNPY 300
           DQVV+RGI+TLQ+KVASILLAL QMDQE++ + T        +  N DV MDG    N  
Sbjct: 241 DQVVVRGINTLQQKVASILLALTQMDQEKMQYATVTEGQQGNNMMNQDVDMDGDAYANGA 300

Query: 301 SNGGGAYDEAW 311
           +N  GAY++AW
Sbjct: 301 NNQPGAYNDAW 311

>SAKL0F07458g Chr6 complement(570134..571081) [948 bp, 315 aa] {ON}
           highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 315

 Score =  518 bits (1335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/320 (77%), Positives = 277/320 (86%), Gaps = 14/320 (4%)

Query: 1   MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLAD 60
           M+E GPQVKIREATKD+VDFILS VD+A+ANS RR+M+AEIPTLAIDSVE+ETNTTVLAD
Sbjct: 1   MTEEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS DI  L YCRDC+CEDHCD+CSVVLTLQA+GESESTTNVYAKDLVI
Sbjct: 61  EFIAHRLGLIPLQSADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY 180
           VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQEL +KC+AKKGISKEHAKW PA+AIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIAT 240
           DPWNKLKHTDYWYEQD++ EWP SKN EYEDPPN+DD FDY AK NTFYM+VETVGS+ +
Sbjct: 181 DPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTS 240

Query: 241 DQVVLRGIDTLQKKVASILLALNQMDQERVNFGTANNTGAIQDAGNVDVAMDGVQD-QNP 299
           DQVV+RGI TLQ KVA IL +L +MDQERVNFG     GA  +A NVDVAMDG  +  +P
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQERVNFG-----GAGGNADNVDVAMDGENEMSDP 295

Query: 300 YS------NGG--GAYDEAW 311
           Y+      NGG    +D+AW
Sbjct: 296 YTSNQDQYNGGPSAGFDDAW 315

>Kpol_1063.11 s1063 (29092..29787,29789..30043) [951 bp, 316 aa]
           {ON} (29092..29787,29789..30043) [951 nt, 317 aa]
          Length = 316

 Score =  509 bits (1312), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/317 (77%), Positives = 275/317 (86%), Gaps = 7/317 (2%)

Query: 1   MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLAD 60
           MSE GPQVKIREATKDNVDFILS VD+A+ANSLRR+M+AEIPTLAIDSVE+ TNTTVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSHVDMALANSLRRVMIAEIPTLAIDSVEVITNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120
           EFIAHRLGL+PLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQA+GESESTTNVY+KDL I
Sbjct: 61  EFIAHRLGLVPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYSKDLDI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY 180
           VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQEL + C+AKKGISKEHAKWGPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIAT 240
           DPWNKLKHTD+W+EQD +KEWP SKN EYEDPP++ + FDYKA+A+ F    ETVG+I++
Sbjct: 181 DPWNKLKHTDFWFEQDPAKEWPQSKNCEYEDPPHEGEVFDYKAQADAFLYECETVGTISS 240

Query: 241 DQVVLRGIDTLQKKVASILLALNQMDQERVNFGTANNTGAIQDAGNVDVAMDGVQDQNPY 300
           DQVVLRGIDTLQKKVASILLAL QMDQ++V +    N GA    GN D+ M G  + +PY
Sbjct: 241 DQVVLRGIDTLQKKVASILLALTQMDQDKVKYAGNTNIGAGGMEGNGDINMGGTGN-DPY 299

Query: 301 S------NGGGAYDEAW 311
           S       G G YD+AW
Sbjct: 300 SNNGGEMGGNGVYDDAW 316

>TBLA0J01520 Chr10 (344746..345753) [1008 bp, 335 aa] {ON} Anc_7.194
           YIL021W
          Length = 335

 Score =  503 bits (1295), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 233/275 (84%), Positives = 254/275 (92%)

Query: 1   MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLAD 60
           MSE GPQ+KIREATKDNVDFILS +D+A+ANSLRR+M+AEIPTLAIDSVE+E NTTVLAD
Sbjct: 1   MSEEGPQIKIREATKDNVDFILSNIDMALANSLRRVMIAEIPTLAIDSVEVEMNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120
           EFI+HRLGLIPLQS DI+QLEYCRDCFCEDHCDKCSVVLTLQA+GESESTTNVYAKDLVI
Sbjct: 61  EFISHRLGLIPLQSADIDQLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHPIIQDKEGNGVLICKLRKGQEL M CVAKKGI+KEHAKWG  AAIE+EY
Sbjct: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKMTCVAKKGIAKEHAKWGATAAIEYEY 180

Query: 181 DPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIAT 240
           DPWNKLKHTDYWYE D  KEWP SKN +YEDPP + + FDYKAKANTFYMNVE VGSI T
Sbjct: 181 DPWNKLKHTDYWYENDPLKEWPHSKNCQYEDPPTEGELFDYKAKANTFYMNVEAVGSITT 240

Query: 241 DQVVLRGIDTLQKKVASILLALNQMDQERVNFGTA 275
           DQV++RGIDTLQKK A ILLAL+QM+QE+VNFGT 
Sbjct: 241 DQVIIRGIDTLQKKTAGILLALSQMEQEKVNFGTG 275

>TPHA0C04510 Chr3 complement(973590..974522) [933 bp, 310 aa] {ON}
           Anc_7.194 YIL021W
          Length = 310

 Score =  498 bits (1283), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 239/312 (76%), Positives = 277/312 (88%), Gaps = 3/312 (0%)

Query: 1   MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLAD 60
           MS+ GPQVKIREATKDNVDFI+S VDLAMAN+ RR+M+AEIPTLAIDSVE+ +NTTVLAD
Sbjct: 1   MSDEGPQVKIREATKDNVDFIVSNVDLAMANAFRRVMIAEIPTLAIDSVEVISNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120
           EFIAHRLGL+PLQS DIEQLEY RDCFCEDHCDKCSVVLTLQA+GESESTTNVY+KDLVI
Sbjct: 61  EFIAHRLGLVPLQSADIEQLEYSRDCFCEDHCDKCSVVLTLQALGESESTTNVYSKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY 180
           VS+L+GRNIGHPIIQDKEGNGVLICKLRKGQEL   C+AKKGI+KEHAKWGPAAAIEFEY
Sbjct: 121 VSDLLGRNIGHPIIQDKEGNGVLICKLRKGQELKFTCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIAT 240
           DPWNKLKHT+YWYEQD +KEWP SKN EYEDPPN+   FDYKAKA+TFYMNVET+G++ +
Sbjct: 181 DPWNKLKHTEYWYEQDAAKEWPQSKNCEYEDPPNEGSEFDYKAKADTFYMNVETIGTVTS 240

Query: 241 DQVVLRGIDTLQKKVASILLALNQMDQERVNFGTANNTGAIQDAGNVDVAMDGVQDQNPY 300
           DQV++RGID LQKKVASILLALN++DQ++VN+   NN    +  G  D+ M+G ++ +PY
Sbjct: 241 DQVIVRGIDILQKKVASILLALNRLDQDKVNYAGNNNVNNGEMDGE-DITMNGTEN-DPY 298

Query: 301 SNG-GGAYDEAW 311
           ++G   +YD AW
Sbjct: 299 ASGNNNSYDGAW 310

>KNAG0H02700 Chr8 (498753..499733) [981 bp, 326 aa] {ON} Anc_7.194
           YIL021W
          Length = 326

 Score =  498 bits (1283), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 240/326 (73%), Positives = 269/326 (82%), Gaps = 15/326 (4%)

Query: 1   MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLAD 60
           M+E GPQVKIREA +DNVDFILS V+LAMANSLRR+M+AEIPTLAIDSV++ETNTTVLAD
Sbjct: 1   MNEEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS DIE+LEYCRDCFCEDHCDKCSVVLTLQA+GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSMDIERLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY 180
           VSNLMGRNIGHPIIQDKE NGVLICKLRKGQEL M C+AKKGI+KEHAKWGP +AIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTSAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIAT 240
           DPWNKLKHT YWYE D ++EWP S+N EYEDPP + + FDYK+KA TFYMNVET+GSI+ 
Sbjct: 181 DPWNKLKHTSYWYEVDAAQEWPNSENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISV 240

Query: 241 DQVVLRGIDTLQKKVASILLALNQMDQERVNFGTANNTGA---IQDAGNVDVAMDGVQDQ 297
           DQVV+RGIDTLQKKVASILL+L QM+QE+ NF   N  G    + ++G  D    G  DQ
Sbjct: 241 DQVVVRGIDTLQKKVASILLSLTQMEQEKTNFAQGNVPGIEGNMINSGGADTGFAGGNDQ 300

Query: 298 NPYSNGG------------GAYDEAW 311
           + Y                G YD+AW
Sbjct: 301 DMYVPNAGTGGNIGSGSGSGVYDDAW 326

>ADL120C Chr4 complement(477033..477968) [936 bp, 311 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL021W
           (RPB3)
          Length = 311

 Score =  491 bits (1264), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 237/322 (73%), Positives = 267/322 (82%), Gaps = 22/322 (6%)

Query: 1   MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLAD 60
           MSE GPQVKIREATKDNVDFILS VDL++ANSLRRIM+AEIPTLAIDSVEIE+NT+VLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120
           EFI+HRLGL+PLQS DI+QL YCRDCFCEDHCD+CSV+LTL A+GESESTTNVYAKDL I
Sbjct: 61  EFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESESTTNVYAKDLQI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY 180
           VS+L G+NIGHPIIQDKE NGVLICKLRKGQEL +KCVAKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIAT 240
           DPWNKL+HTDYW+EQD   EWP SKN E+EDPPN+DD FDY AK NTFYMNVE+VGSI +
Sbjct: 181 DPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPS 240

Query: 241 DQVVLRGIDTLQKKVASILLALNQMDQERVNFGTANNTGAIQDAGNVDVAMDGVQDQNPY 300
           DQVV+RGI TLQ KVA IL +L +MDQ++V FG     G   DA  ++V      DQ+PY
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFG-----GPTGDAAPMEV------DQDPY 289

Query: 301 S-----------NGGGAYDEAW 311
           S           N   AYD+AW
Sbjct: 290 SATSGRFNEYNDNAHAAYDDAW 311

>KLLA0D16170g Chr4 complement(1362809..1363732) [924 bp, 307 aa]
           {ON} highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 307

 Score =  489 bits (1260), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 233/313 (74%), Positives = 265/313 (84%), Gaps = 8/313 (2%)

Query: 1   MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLAD 60
           MSE GPQVKIREATKDNVDFILS VDLA+ANSLRR+M++EIPTLAIDSVEIETNTTVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLALANSLRRVMISEIPTLAIDSVEIETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS DI+Q+ YCRDC+CEDHCD+CSV L L AIGESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSADIDQVVYCRDCYCEDHCDRCSVELILHAIGESESTTNVYAKDLQI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY 180
            S+L GRNIGHPIIQD+E NGVLICKLRKGQE+ +KC+AKKGISKEHAKW P+AAIEFEY
Sbjct: 121 TSDLKGRNIGHPIIQDREANGVLICKLRKGQEIRVKCIAKKGISKEHAKWSPSAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIAT 240
           DPWNKLKHTDYWYEQD   EWP SKN E+EDPPN+D+ FDY+AK NTFY+NVE+VGSI +
Sbjct: 181 DPWNKLKHTDYWYEQDARDEWPQSKNCEFEDPPNEDEDFDYRAKPNTFYINVESVGSITS 240

Query: 241 DQVVLRGIDTLQKKVASILLALNQMDQERVNFGTANNTGAIQDAGNVDVAMDGVQDQNPY 300
           +QVV+RGI TLQ KVA IL +L +MDQE+VNF      GA+    +  V M+  +D +PY
Sbjct: 241 EQVVVRGIKTLQDKVADILFSLKKMDQEKVNFA----AGAVSTHVSQQVPME--EDMDPY 294

Query: 301 SN--GGGAYDEAW 311
               GG  YD+AW
Sbjct: 295 GGPVGGSGYDDAW 307

>KLTH0E04598g Chr5 (415348..416334) [987 bp, 328 aa] {ON} similar to
           uniprot|P16370 Saccharomyces cerevisiae YIL021W
          Length = 328

 Score =  490 bits (1262), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 232/293 (79%), Positives = 258/293 (88%), Gaps = 3/293 (1%)

Query: 1   MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLAD 60
           M+E GPQVKIREATKDNVDFILS VD+ MANSLRR+M+AEIPTLAIDSVE+ETNT+VLAD
Sbjct: 1   MAEEGPQVKIREATKDNVDFILSNVDITMANSLRRVMIAEIPTLAIDSVEVETNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120
           EFI+HRLGLIPLQS+DI  L YCRDC+CEDHCD+CSVVLTLQA+GESESTTNVYAKDLVI
Sbjct: 61  EFISHRLGLIPLQSSDINDLIYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY 180
           VSNLMGRNIGHPIIQDK+GNGVLICKLRKGQEL +KCVAKKGISKEHAKW PAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKDGNGVLICKLRKGQELKLKCVAKKGISKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIAT 240
           DPWNKLKHTDYW+E D + EWP SKN EYEDPPN+D+AFDY AK  TFYMNVETVGS+  
Sbjct: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDEAFDYNAKPTTFYMNVETVGSLTV 240

Query: 241 DQVVLRGIDTLQKKVASILLALNQMDQERVNFGTANNTGAI-QDAGNVDVAMD 292
           DQVV+RG+ TLQ KVA IL +L +MDQ++VNFG     G + QD G + V  D
Sbjct: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFG--GTAGMVDQDGGAMPVEPD 291

>Kwal_55.20380 s55 (379749..380720) [972 bp, 323 aa] {ON} YIL021W
           (RPB3) - 45 kDa subunit of RNA polymerase II [contig
           149] FULL
          Length = 323

 Score =  486 bits (1251), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 226/285 (79%), Positives = 256/285 (89%), Gaps = 1/285 (0%)

Query: 1   MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLAD 60
           M+E GPQVKIREATKDNVDFILS VD+AMANSLRR+M+AEIPT+AIDSVE+ETNT+VLAD
Sbjct: 1   MAEEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120
           EFI+HRLGL+PLQS+DI  L YCRDC+CED+CD+CSVVLTLQA+GESESTTNVYAKDLVI
Sbjct: 61  EFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHPIIQDK+ NGVLICKLRKGQEL +KCVAKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIAT 240
           DPWNKLKHTDYW+E D + EWP SKN EYEDPPN+DDAFDY+AK  TFYMNVE+VGS+  
Sbjct: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTV 240

Query: 241 DQVVLRGIDTLQKKVASILLALNQMDQERVNFGTANNTGAIQDAG 285
           DQVV+RG+ TLQ KVA IL +L +MDQ++VNFG A    A QD G
Sbjct: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFGGAAGL-AEQDGG 284

>Ecym_4382 Chr4 (803602..804537) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii ADL120C
          Length = 311

 Score =  484 bits (1246), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 230/309 (74%), Positives = 259/309 (83%), Gaps = 11/309 (3%)

Query: 1   MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLAD 60
           MSE GPQVKIREATKDNVDFILS VDL++ANSLRRIM+AEIPTLAIDSVEIETNT+VLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120
           EFI+HRLGLIPLQS DI+QL YCRDC+CEDHCD+CSVVLTLQA+GESESTTNVYAKDL I
Sbjct: 61  EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLQI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY 180
           VS+L G+NIGHPIIQDKE NG+L+CKLRKGQEL +KCVAKKGISKEHAKW PAAAIEFEY
Sbjct: 121 VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIAT 240
           DPWNKLKHTDYW+EQD + EWP SKN E+EDP N DD FDY AK N FY+NVE+VGSI +
Sbjct: 181 DPWNKLKHTDYWFEQDATSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITS 240

Query: 241 DQVVLRGIDTLQKKVASILLALNQMDQERVNFGTANNTGAIQDAGNVDVAMDGVQDQNPY 300
           DQVV+RGI TLQ KVA IL +L +MDQ++V FG   +  A  +            D +PY
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPTSENAPMEV-----------DHDPY 289

Query: 301 SNGGGAYDE 309
           S   G Y+E
Sbjct: 290 SGTNGQYNE 298

>Kpol_1018.139 s1018 (370051..371058) [1008 bp, 335 aa] {ON}
           (370051..371058) [1008 nt, 336 aa]
          Length = 335

 Score = 99.0 bits (245), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 79/292 (27%), Positives = 134/292 (45%), Gaps = 53/292 (18%)

Query: 7   QVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLADEFIAHR 66
           ++ I        +F L  +D ++AN+ RRIM++E+P++A++ V    NT+VL DE +AHR
Sbjct: 41  EINISSINSREANFDLINIDTSIANAFRRIMISEVPSVAVEYVYFLNNTSVLQDEVLAHR 100

Query: 67  LGLIPLQSTDIEQLEYCRDCFCEDH--CDKCSVVLTLQAIGESES--------------T 110
           +GL+PL+  D + L +      E+    D+ ++VL+L                       
Sbjct: 101 IGLVPLK-VDPDMLSWIDSELPEEEKFTDENTIVLSLNVKCTMNPDAPKDCTDPKILYKN 159

Query: 111 TNVYAKDLVIVSNLMGRNI----GHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKE 166
           +NVYA+DL       G+ +     +P++       +L+CKLR GQE+S+K     GI  +
Sbjct: 160 SNVYARDLKFEP--QGKQVESFANYPVVP--ANPDILLCKLRPGQEISLKAHCILGIGSD 215

Query: 167 HAKWGPAAAIEFEYDPWNKL----------KHTDYWYEQDISKEWPLSKNSE-YEDPPNK 215
           HAK+ P A   +   P   +          K   Y+    I     ++ N E Y     K
Sbjct: 216 HAKFSPVATASYRLMPHINITQPITGEDAKKFQKYFMPGVIG----INDNGEAYVKDARK 271

Query: 216 DDA---------FDYKAK----ANTFYMNVETVGSIATDQVVLRGIDTLQKK 254
           D           F+ K K     N F +NVE+ G++  +++  + +  L+ K
Sbjct: 272 DTVSREVFRHPEFEGKVKLGRVRNHFIVNVESTGAMTPEEIFFKSVRILRNK 323

>CAGL0B04125g Chr2 complement(401513..402517) [1005 bp, 334 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110c RPC40 DNA-directed RNA polymerase I
           III
          Length = 334

 Score = 95.5 bits (236), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 87/290 (30%), Positives = 141/290 (48%), Gaps = 51/290 (17%)

Query: 7   QVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLADEFIAHR 66
           QV   E  + N D I   +D ++AN+ RRIM+AE+P +A + V I+ NT+V+ DE +AHR
Sbjct: 43  QVSSHEERELNFDMI--GIDTSLANAFRRIMIAEVPAVAPEYVYIQNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQ--STDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESE--------------ST 110
           +GL+PL+     +E+L+       E H DK ++V+TL                     + 
Sbjct: 101 IGLVPLKVDPEKLERLDTSDPDNLEFH-DKNTIVMTLNVKCTRNPDAPKDCTDPTILYNN 159

Query: 111 TNVYAKDLVI--VSNLMGRNIGHPIIQ-DKEGNGVLICKLRKGQELSMKCVAKKGISKEH 167
            +VYA+DL     S+ +      P++  D +   +L+ KLR GQE+S+      G  K+H
Sbjct: 160 AHVYARDLKFEPHSSQVETFADCPVVPCDPD---ILLAKLRPGQEISLSTHCILGEGKDH 216

Query: 168 AKWGPAAAIEFEYDPWNKLKHTDYWYEQDISKEWP---------LSKNSE-YEDPPNKD- 216
           AK+ P A   +   P  ++         D +K +          +++N E Y   P KD 
Sbjct: 217 AKFSPVATASYRLLPHIEILEP---ITGDSAKRFQACFPKGVIGINENGEAYVLDPRKDT 273

Query: 217 --------DAFDYKAK----ANTFYMNVETVGSIATDQVVLRGIDTLQKK 254
                   + F+ K K     + F  NVE+ G++  + +VL+ ID L+KK
Sbjct: 274 VSREVLRHEEFEGKVKLGRVRDHFVFNVESTGAMQPEDIVLKSIDILKKK 323

>Kpol_473.3 s473 complement(6708..7670) [963 bp, 320 aa] {ON}
           complement(6708..7670) [963 nt, 321 aa]
          Length = 320

 Score = 92.8 bits (229), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 79/284 (27%), Positives = 135/284 (47%), Gaps = 59/284 (20%)

Query: 17  NVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLADEFIAHRLGLIPLQSTD 76
           N+D I   VD ++AN+LRRIM++E+P++A + + I  NT+V+ DE IA R+GLIPL+  D
Sbjct: 39  NLDLI--NVDTSIANALRRIMISEVPSVAAEYIYILNNTSVIQDEVIAQRIGLIPLK-VD 95

Query: 77  IEQLEYCRDCFCEDH--CDKCSVVLTLQA-----IGESESTT---------NVYAKDLVI 120
            ++L +  +   ED    D+ ++VL+L       +   +  T         ++YA+DL  
Sbjct: 96  PDRLTWLNNDLPEDEKFTDENTIVLSLNVKCTRNLDAPKDCTDPSILYHNAHIYARDLKF 155

Query: 121 VSNLMGRN----IGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAI 176
                G+        P++       +LI KLR GQE+S++     GI  +HAK+ P    
Sbjct: 156 EP--QGKQEETFADSPVVS--ADPDILIAKLRPGQEISLRAHCILGIGADHAKFSPVCTA 211

Query: 177 EFEYDP----WNKLK-------------------HTDYWYEQDISKE---WPLSKNSEYE 210
            +   P      K+K                     D  Y +D  K+     + ++ E++
Sbjct: 212 SYRLMPKIIITEKIKGESAKRFQKCFPPGVIDINENDEAYVKDARKDTMTREVLRHEEFQ 271

Query: 211 DPPNKDDAFDYKAKANTFYMNVETVGSIATDQVVLRGIDTLQKK 254
           D    D         N F  N+ETVG+++ +++ L+ +  L+ K
Sbjct: 272 DKVKLDRV------RNHFIFNIETVGAMSAEEIFLKSVKILKNK 309

>ZYRO0C12364g Chr3 complement(976920..977927) [1008 bp, 335 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 335

 Score = 92.8 bits (229), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 74/291 (25%), Positives = 130/291 (44%), Gaps = 52/291 (17%)

Query: 8   VKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLADEFIAHRL 67
           V+I   T+   +F L  VD ++AN+ RRIM++E+P++A + V    NT+V+ DE +AHR+
Sbjct: 42  VRIGSLTEREANFDLVHVDTSIANAFRRIMISEVPSVATEYVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSTDIEQLEYCRDCFCEDH--CDKCSVVLTLQAIGESES--------------TT 111
           GL+PL+  D + L +      E+    D+ ++V+TL                       +
Sbjct: 102 GLVPLK-VDPDMLTWVDHSLPEEEKFTDENTIVMTLNVKCTRNPDAPKDCTDPKILYRNS 160

Query: 112 NVYAKDLVIVSNLMGRNIGH----PIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEH 167
           ++YA+DL       G  +      P+I       +L+ KLR GQE+S++     G+  +H
Sbjct: 161 HIYARDLKF--EPQGSQVETFAKCPVIPTDP--DILLAKLRPGQEISLRAHCILGVGSDH 216

Query: 168 AKWGPAAAIEFEYDPWNKLKH------------------------TDYWYEQDISKEWPL 203
           AK+ P A   +   P   ++                         TD  Y QD  K+   
Sbjct: 217 AKFSPVATASYRLLPHIDIREPIKGELAQKFQKCFPPGVIGINESTDEAYVQDARKDTVS 276

Query: 204 SKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIATDQVVLRGIDTLQKK 254
            +   +E+  NK          + F  NVE+ G++  +++  + +  L+ K
Sbjct: 277 REVLRHEEFSNK---VKLGRVRDHFVFNVESTGAMTPEEIFFKSVRVLKNK 324

>KAFR0A05520 Chr1 (1101190..1102194) [1005 bp, 334 aa] {ON}
           Anc_3.428 YPR110C
          Length = 334

 Score = 91.7 bits (226), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 78/297 (26%), Positives = 130/297 (43%), Gaps = 65/297 (21%)

Query: 8   VKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLADEFIAHRL 67
           VKI    +   +F L  +D ++AN+ RRIM++E+P +A++ V    NT+V+ DE +AHR+
Sbjct: 42  VKISSMNEREANFDLVHIDTSVANAFRRIMISEVPAVAVEYVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSTDIEQLEYCRDCFCEDH--CDKCSVVLTLQAIGESES--------------TT 111
           GL+PL+  D + L +      +D    D+ ++VLTL                       +
Sbjct: 102 GLVPLK-VDPDMLTWIDSSLPDDEKFTDENTIVLTLNVKCTRNPDAPRDCTDPNILYRNS 160

Query: 112 NVYAKDLVIVSNLMGRNIGHPIIQDKEGNGVLIC-------KLRKGQELSMKCVAKKGIS 164
           NVYA DL       G+      ++    N V+ C       KLR GQE+S++     GI 
Sbjct: 161 NVYASDLKF--EPQGKQ-----VETFANNAVVPCDPKILLAKLRPGQEISLRAHCILGIG 213

Query: 165 KEHAKWGPAAAIEFEYDP---------------WNK--------LKHTDYWYEQDISKEW 201
            +HAK+ P A   +   P               + K        +K     Y QD  K+ 
Sbjct: 214 SDHAKFSPVATASYRLLPHIEITEPITGESAKRFQKCFPAGVIGIKENGDAYVQDSRKDT 273

Query: 202 PLSKNSEYEDPPNKDDAFDYKAK----ANTFYMNVETVGSIATDQVVLRGIDTLQKK 254
              +   +E+       F+ K K     + F  NVE+ G++  +++  + +  L+ K
Sbjct: 274 VSREVYRHEE-------FNGKVKLGRIRDHFVFNVESTGAMTPEEIFFKSVRILKNK 323

>KLLA0D14861g Chr4 complement(1253023..1254027) [1005 bp, 334 aa]
           {ON} highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 334

 Score = 91.3 bits (225), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 77/287 (26%), Positives = 133/287 (46%), Gaps = 45/287 (15%)

Query: 8   VKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLADEFIAHRL 67
           V+I    +  V+F L  VD ++AN+ RRIM++E+P++A + V    NT+VL DE +AHR+
Sbjct: 42  VQIESLDEREVNFDLVHVDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVLQDEVLAHRI 101

Query: 68  GLIPLQSTDIEQLEYCRDCF--CEDHCDKCSVVLTLQ--------AIGESE------STT 111
           GL+PL+  D + L +        E   D+ ++V++L         A  + E         
Sbjct: 102 GLVPLK-VDPDMLSWVDTSLPESERFTDENTIVMSLNVKCTRNPDAPKDCEDPKVLYRNA 160

Query: 112 NVYAKDLVIVSNLMGRNIGH----PIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEH 167
           ++YA+DL       G+ +      P++       +L+ KLR GQE+S++     GI  +H
Sbjct: 161 HIYARDLKF--EPQGKQVEQFAKCPVVA--ADPDILLAKLRPGQEISLRAHCILGIGADH 216

Query: 168 AKWGPAAAIEFEYDPWNKLKHTDYWYE-QDISKEWPL------SKNSEYEDPPNKD---- 216
           AK+ P +   +   P  ++       + +   K +P        K   Y   P KD    
Sbjct: 217 AKFSPVSTASYRLLPHIQITQPITGDDAKKFVKCFPKGVADVNEKGEAYIKDPRKDTVSR 276

Query: 217 -----DAFDYKAK----ANTFYMNVETVGSIATDQVVLRGIDTLQKK 254
                D F  K K     + F  NVE+ G++  +++  + +  L+ K
Sbjct: 277 EVLRHDEFQGKVKLGRVRDHFIFNVESSGAMTPEEIFFKSVRILKNK 323

>TPHA0D03920 Chr4 complement(821790..822797) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score = 90.9 bits (224), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 78/291 (26%), Positives = 131/291 (45%), Gaps = 53/291 (18%)

Query: 8   VKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLADEFIAHRL 67
           + I   T+   +F L  +D ++AN+ RRIM+AE+P++A + V    NT+V+ DE +AHR+
Sbjct: 42  IHISSLTEKEANFDLVHIDTSIANAFRRIMIAEVPSVAAEYVYFMNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSTDIEQLEYCRDCFC--EDHCDKCSVVLTLQAI------GESEST--------T 111
           GLIPL+  D ++L +        E   D+ ++V+TL A          ++T         
Sbjct: 102 GLIPLR-VDPDKLSWIDSELPDEEKFTDENTIVITLDAKCTRNPDAPKDATDPKVLYRNA 160

Query: 112 NVYAKDLVI-----VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKE 166
           +VYA+DL        + L        I  D     +LI KLR GQE+S++     GI  +
Sbjct: 161 HVYARDLKFEPQGKQAELFADQPVEAIDPD-----ILIAKLRPGQEISLRAHCILGIGGD 215

Query: 167 HAKWGPAAAIEFEYDPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKAN 226
           HAK+ P A   +   P   +         + +K +     S      +KD+AF   A+ +
Sbjct: 216 HAKFSPVATASYRLLPHINITSP---ISGESAKRFQKCFPSGVIGINDKDEAFVKDARKD 272

Query: 227 T-----------------------FYMNVETVGSIATDQVVLRGIDTLQKK 254
           T                       F  NVE+ G++  +++  + +  L+ K
Sbjct: 273 TVSREVLRHEEFQNKVKLGRVRDHFVFNVESTGAMTPEEIFFKSVRILKNK 323

>Smik_16.353 Chr16 complement(623974..624981) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 90.1 bits (222), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 78/289 (26%), Positives = 130/289 (44%), Gaps = 46/289 (15%)

Query: 7   QVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLADEFIAHR 66
           +V I        +F L  +D ++AN+ RRIM++E+P++A + V    NT+V+ DE +AHR
Sbjct: 41  EVNISSLDAREANFDLINIDTSIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSTDIEQLEYCRDCFCEDH--CDKCSVVLTLQA--------------IGESEST 110
           +GL+PL+  D + L +      +D    D+ ++VL+L                  E  + 
Sbjct: 101 IGLVPLK-VDPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNN 159

Query: 111 TNVYAKDLVIVSNLMGRN----IGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKE 166
            +VYA+DL       G+        P++       +L+ KLR GQE+S+K     GI  +
Sbjct: 160 AHVYARDLKF--EPQGKQSTTFADFPVV--PADPDILLAKLRPGQEISLKAHCILGIGGD 215

Query: 167 HAKWGPAAAIEFEYDPW-NKLKHTDYWYEQDISKEWPL-------SKNSEYEDPPNKD-- 216
           HAK+ P +   +   P  N L+       +   K +P        S +  Y     KD  
Sbjct: 216 HAKFSPVSTASYRLLPQINILQPIKGESARRFQKCFPPGVIGIDESSDEVYVKDARKDTV 275

Query: 217 -------DAFDYKAK----ANTFYMNVETVGSIATDQVVLRGIDTLQKK 254
                  D F  K K     N F  NVE+ G++  +++  + +  L+ K
Sbjct: 276 SREVLRYDEFADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRILKNK 324

>ADR031C Chr4 complement(761933..763027) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR110C
           (RPC40)
          Length = 364

 Score = 89.7 bits (221), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 75/291 (25%), Positives = 133/291 (45%), Gaps = 53/291 (18%)

Query: 8   VKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLADEFIAHRL 67
           V+I+   +   +F L +VD ++AN+ RRIM++E+P++A + V    NT+V+ DE +AHR+
Sbjct: 72  VQIKSLDEREANFDLLRVDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 131

Query: 68  GLIPLQSTDIEQLEYCRDCF--CEDHCDKCSVVLTLQA--------------IGESESTT 111
           GL+PL+  D + L +        E   D+ +VVL+L                  E     
Sbjct: 132 GLVPLK-VDPDMLTWVDKSLPEAERFTDENTVVLSLNVKCTHNPDAPKGSTDPKELYRNA 190

Query: 112 NVYAKDLVIVSNLMGRNIGH----PIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEH 167
           ++YA+DL       G+ +      P++       +L+ KLR GQE+S++     GI  +H
Sbjct: 191 HIYARDLKF--EPQGKQLETFAKCPVV--PADPDILLAKLRPGQEISLRVHCILGIGSDH 246

Query: 168 AKWGPAAAIEFEYDPW-NKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKAN 226
           AK+ P A   +   P+ N ++       +   K +P    +  E    K +AF   A+ +
Sbjct: 247 AKFSPVATASYRLMPYINIVEPITGPDAEKFVKCFPPGVAAINE----KGEAFVQDARKD 302

Query: 227 T-----------------------FYMNVETVGSIATDQVVLRGIDTLQKK 254
           T                       F  NVE+ G++  +++  + +  L+ K
Sbjct: 303 TVSREVLRHPELEQKVKLGRVRDHFIFNVESAGAMTPEEIFFKSVRILKNK 353

>TDEL0F03100 Chr6 complement(567682..568689) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score = 89.0 bits (219), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 60/196 (30%), Positives = 97/196 (49%), Gaps = 27/196 (13%)

Query: 8   VKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLADEFIAHRL 67
           V+I   T+   +F L  +D ++AN+ RRIM++E+P+LA + V    NT+V+ DE +AHR+
Sbjct: 42  VQIESLTEREANFDLIHIDTSIANAFRRIMISEVPSLAPEHVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSTDIEQLEYCRDCFCEDH--CDKCSVVLTLQAIGESES--------------TT 111
           GL+PL+  D + L +      E+    D+ ++VLTL                       +
Sbjct: 102 GLVPLK-VDPDMLTWVDSTLPEEERFTDENTIVLTLNVTCTRNPDAPKDCTDPKILYRNS 160

Query: 112 NVYAKDLVI-----VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKE 166
           +VYA DL        + L  +    P   D     +L+ KLR GQE+S++     G+  +
Sbjct: 161 SVYAHDLKFEPQGRQAELFAKCPVVPADPD-----ILLAKLRPGQEISLRAHCILGVGGD 215

Query: 167 HAKWGPAAAIEFEYDP 182
           HAK+ P A   +   P
Sbjct: 216 HAKFSPVATASYRLLP 231

>Suva_16.438 Chr16 complement(753618..754625) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 88.6 bits (218), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 77/296 (26%), Positives = 131/296 (44%), Gaps = 60/296 (20%)

Query: 7   QVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLADEFIAHR 66
           +V I      + +F L  +D ++AN+ RRIM++E+P +A + V    NT+V+ DE +AHR
Sbjct: 41  EVNISSLDARDANFDLINIDTSIANAFRRIMISEVPAVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSTDIEQLEYCRDCFCEDH--CDKCSVVLTLQAI------GESEST-------- 110
           +GL+PL+  D + L +      +D    D+ +VVL+L            +ST        
Sbjct: 101 IGLVPLK-VDPDMLTWVDSSLPDDEKFTDENTVVLSLNVKCTRNLDAPKDSTDPKQLYNN 159

Query: 111 TNVYAKDLVIVSNLMGRN----IGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKE 166
            +VYA+DL       GR        P++       +L+ KLR GQE+S+K     G+  +
Sbjct: 160 AHVYARDLKF--EPQGRQSTTFANCPVL--PADPDILLAKLRPGQEISLKAHCILGVGGD 215

Query: 167 HAKWGPAAAIEFEYDPWNKL------------------------KHTDYWYEQDISKEWP 202
           HAK+ P +   +   P   +                        + +D  Y +D  K+  
Sbjct: 216 HAKFSPVSTASYRLLPQIDILQPIKGESAKRFEKCFPPGVIGIDESSDEAYVKDARKDTV 275

Query: 203 LSKNSEYEDPPNKDDAFDYKAK----ANTFYMNVETVGSIATDQVVLRGIDTLQKK 254
             +   YE+       F  K K     N F  NVE+ G++  +++  + +  L+ K
Sbjct: 276 SREVLRYEE-------FTDKVKLGRVRNHFVFNVESAGAMTPEEIFFKSVRILKNK 324

>KNAG0A07600 Chr1 complement(1192867..1193871) [1005 bp, 334 aa]
           {ON} Anc_3.428 YPR110C
          Length = 334

 Score = 88.2 bits (217), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 58/195 (29%), Positives = 99/195 (50%), Gaps = 25/195 (12%)

Query: 8   VKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLADEFIAHRL 67
           +KI   ++   +F L  +D ++AN+ RRIM++E+P++A + V +  NT+V+ DE +AHR+
Sbjct: 42  IKISSMSEREANFDLVHIDTSVANAFRRIMISEVPSVAAEYVYVMNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSTDIEQLEYCRDCFCEDH--CDKCSVVLTLQAIGESE--------------STT 111
           G+IPL+  D + L +      E+    D+ +VVLTL                       +
Sbjct: 102 GMIPLK-VDPDMLTWIDQSLSEEEKFTDENTVVLTLNVKCTRNLNAPKDCTDPKILYKNS 160

Query: 112 NVYAKDLVIVSNLMGRNIGH----PIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEH 167
           +VYA+DL       G+ +      P++       +L+ KLR  QE+S++     GI  +H
Sbjct: 161 SVYARDLRF--EPQGKQLETFADCPVVPSDP--DILLAKLRPNQEISLRVHCILGIGSDH 216

Query: 168 AKWGPAAAIEFEYDP 182
           AK+ P A   +   P
Sbjct: 217 AKFSPVATASYRLLP 231

>TBLA0F01700 Chr6 (423582..424583) [1002 bp, 333 aa] {ON} Anc_3.428
           YPR110C
          Length = 333

 Score = 88.2 bits (217), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 97/195 (49%), Gaps = 25/195 (12%)

Query: 8   VKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLADEFIAHRL 67
           +KI    + +  F L  +D ++AN+ RRIMMAE+P +A + V    NT+V+ DE +AHR+
Sbjct: 42  IKISNLDERDATFDLINIDTSIANAFRRIMMAEVPAVAAEHVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSTDIEQLEYCRDCFCEDH--CDKCSVVLTLQAIGESE--------------STT 111
           GL+PL+  D + L +      E+    D+ ++VL+L                     +  
Sbjct: 102 GLVPLK-VDPDMLTWVDQTLPEEERFTDENTIVLSLNVKCTKNDKAPKDCTDPKILYNNA 160

Query: 112 NVYAKDLVIVSNLMGRNI----GHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEH 167
           +VYA+DL       G+ +      P++       +L+ KLR GQE+S++     GI  +H
Sbjct: 161 HVYARDLKF--EPQGKQVETFANCPVVPTDP--DILLAKLRPGQEISLRAHCILGIGSDH 216

Query: 168 AKWGPAAAIEFEYDP 182
           AK+ P A   +   P
Sbjct: 217 AKFSPVATASYRLLP 231

>SAKL0F06028g Chr6 complement(453180..454184) [1005 bp, 334 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 334

 Score = 88.2 bits (217), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 72/287 (25%), Positives = 132/287 (45%), Gaps = 45/287 (15%)

Query: 8   VKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLADEFIAHRL 67
           VKI    +   +F L  +D ++AN+ RRIM++E+P++A + V    NT+V+ DE +AHR+
Sbjct: 42  VKISSLDEREANFDLIHIDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSTDIEQLEYCRDCFCEDH--CDKCSVVLTLQAIGESES--------------TT 111
           GL+PL+  D + L +  +   E+    D+ ++VLTL                       +
Sbjct: 102 GLVPLK-VDPDMLSWIDNSLTEEEKFTDENTIVLTLNVKCTRNPDAPKDCTDPKVLYRNS 160

Query: 112 NVYAKDLVIVSNLMGRNI----GHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEH 167
           N+YA+ L       G+ +      P++       +L+ KLR GQE+S++     GI  +H
Sbjct: 161 NIYARHLKF--EPQGKQLETFAKSPVV--PADPDILLAKLRPGQEISLRAHCILGIGSDH 216

Query: 168 AKWGPAAAIEFEYDPW-NKLKHTDYWYEQDISKEWPLS------KNSEYEDPPNKD---- 216
           AK+ P     +   P  N  +       +++ + +P        +   Y +   KD    
Sbjct: 217 AKFSPVCTASYRLMPQINITEPITGESAKNLVRCFPPGVIGINEQGEAYVEDARKDTVSR 276

Query: 217 -----DAFDYKAK----ANTFYMNVETVGSIATDQVVLRGIDTLQKK 254
                + F+ K K     + F  NVE+ G++  +++  + +  L+ K
Sbjct: 277 EVLRHEEFEGKVKLGRVRDHFVFNVESAGAMTPEEIFFKSVRILKNK 323

>YPR110C Chr16 complement(745828..746835) [1008 bp, 335 aa] {ON}
           RPC40RNA polymerase subunit AC40, common to RNA
           polymerase I and III
          Length = 335

 Score = 87.8 bits (216), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 77/289 (26%), Positives = 129/289 (44%), Gaps = 46/289 (15%)

Query: 7   QVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLADEFIAHR 66
           +V I        +F L  +D ++AN+ RRIM++E+P++A + V    NT+V+ DE +AHR
Sbjct: 41  EVNISSLDAREANFDLINIDTSIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSTDIEQLEYCRDCFCEDH--CDKCSVVLTLQA--------------IGESEST 110
           +GL+PL+  D + L +      +D    D+ ++VL+L                  E  + 
Sbjct: 101 IGLVPLK-VDPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNN 159

Query: 111 TNVYAKDLVIVSNLMGRNIGH----PIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKE 166
            +VYA+DL       GR        P++       +L+ KLR GQE+S+K     GI  +
Sbjct: 160 AHVYARDLKF--EPQGRQSTTFADCPVV--PADPDILLAKLRPGQEISLKAHCILGIGGD 215

Query: 167 HAKWGPAAAIEFEYDPW-NKLKHTDYWYEQDISKEWPL-------SKNSEYEDPPNKD-- 216
           HAK+ P +   +   P  N L+       +   K +P          +  Y     KD  
Sbjct: 216 HAKFSPVSTASYRLLPQINILQPIKGESARRFQKCFPPGVIGIDEGSDEAYVKDARKDTV 275

Query: 217 -------DAFDYKAK----ANTFYMNVETVGSIATDQVVLRGIDTLQKK 254
                  + F  K K     N F  NVE+ G++  +++  + +  L+ K
Sbjct: 276 SREVLRYEEFADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRILKNK 324

>Skud_16.397 Chr16 complement(710663..711670) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 86.7 bits (213), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 74/285 (25%), Positives = 124/285 (43%), Gaps = 38/285 (13%)

Query: 7   QVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLADEFIAHR 66
           +V I    +   +F L  +D ++AN+ RRIM++E+P +A + V    NT+V+ DE +AHR
Sbjct: 41  KVNISSLDEREANFDLINIDASIANAFRRIMISEVPCVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSTDIEQLEYCRDCFCEDH--CDKCSVVLTLQA--------------IGESEST 110
           +GL+PL+  D + L +      +D    D+ ++VL+L                  E  + 
Sbjct: 101 IGLVPLK-VDPDMLTWVDSSLPDDEKFTDENTIVLSLNVKCTRNPDAPKDCTDPKELYNN 159

Query: 111 TNVYAKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKW 170
            +VYA+DL                       +L+ KLR GQE+S+K     GI  +HAK+
Sbjct: 160 AHVYARDLKFEPQGRQSTTFAACSVVPADPDILLAKLRPGQEISLKAHCILGIGGDHAKF 219

Query: 171 GPAAAIEFEYDPW-NKLKHTDYWYEQDISKEWPL-------SKNSEYEDPPNKD------ 216
            P +   +   P  N L+       +   K +P        +    Y     KD      
Sbjct: 220 SPVSTASYRLLPQINILQSIKGESAKRFQKCFPPGVIGIDDTSREAYVKDARKDTVSREV 279

Query: 217 ---DAFDYKAK----ANTFYMNVETVGSIATDQVVLRGIDTLQKK 254
              + F  K K     N F  NVE+ G++  +++  + +  L+ K
Sbjct: 280 LRYEEFADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRILKNK 324

>KLTH0F12056g Chr6 (1016695..1017747) [1053 bp, 350 aa] {ON} highly
           similar to uniprot|P07703 Saccharomyces cerevisiae
           YPR110C RPC40 RNA polymerase subunit common to RNA
           polymerase I and III
          Length = 350

 Score = 86.7 bits (213), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 124/274 (45%), Gaps = 41/274 (14%)

Query: 19  DFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLADEFIAHRLGLIPLQSTDIE 78
           +F L  VD ++AN+ RRIM+AE+P++A + V    NT+V+ DE +AHR+GL PL+  D +
Sbjct: 69  NFDLVNVDASIANAFRRIMIAEVPSVAAEYVYFFNNTSVIQDEVLAHRIGLTPLK-VDPD 127

Query: 79  QLEYCRDCF--CEDHCDKCSVVLTLQAIGESES--------------TTNVYAKDLVIVS 122
            L +        E   D+ ++VLTL                        ++YA+DL    
Sbjct: 128 MLSWVDTSVPEAERFTDENTIVLTLNVRCTRNPDAPKDCTDPKILYRNAHIYARDLKFEP 187

Query: 123 NLMGRNI--GHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY 180
               R     +P++       +L+ KLR GQE+S++     GI  +HAK+ P +   +  
Sbjct: 188 QGKQRETFAKNPVVPADP--DILLAKLRPGQEISLRAHCVLGIGSDHAKFSPVSTASYRL 245

Query: 181 DPW-NKLKHTDYWYEQDISKEWP------------LSKNSEYEDPPN---KDDAFDYKAK 224
            P  N  +       Q  +K +               K++ ++       + + F+ K K
Sbjct: 246 MPHINITQPITGESAQRFAKCFSPGVIGINDNGEAFVKDARHDTVSREVLRHEEFEGKVK 305

Query: 225 ----ANTFYMNVETVGSIATDQVVLRGIDTLQKK 254
                N F  NVE+ G++  +++  + +  L+ K
Sbjct: 306 LGRVKNHFIFNVESAGAMTPEEIFFKSVRILKNK 339

>NDAI0A04770 Chr1 (1091856..1092863) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score = 85.5 bits (210), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 76/297 (25%), Positives = 136/297 (45%), Gaps = 60/297 (20%)

Query: 8   VKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLADEFIAHRL 67
           V+I   ++   +F L  +D +MAN+ RRIM++E+P++A + V   TNT+V+ DE +AHR+
Sbjct: 42  VQITSLSEREANFDLINIDTSMANAFRRIMISEVPSVAAEYVYFLTNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSTDIEQLEYCRDCFCEDH--CDKCSVVLTL-----QAIGESESTTN-------- 112
           G+IPL+  D + L +      E+    D  +VV++L     + +   +  T+        
Sbjct: 102 GMIPLK-VDPDMLSWIDTSLSEEEKFTDDNTVVMSLNIKCTRNLNAPKDCTDPKILYHNS 160

Query: 113 -VYAKDLVIVSNLMGRNIGH----PIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEH 167
            VYAKDL       G+ +      P++       +L+ KLR  QE+S++     G+  +H
Sbjct: 161 SVYAKDLKF--EPQGKQVETFAKCPVVPSDP--DILLAKLRPDQEISLRVHCILGVGGDH 216

Query: 168 AKWGPAAAIEFEYDPW-NKLK-----------------------HTDYWYEQDISKEWPL 203
           AK+ P +   +   P  N LK                        T   Y +D  K+   
Sbjct: 217 AKFSPVSTASYRLLPHINILKPITGEQAIKFQKCFLPGVIGINEETGEAYVKDARKDTVS 276

Query: 204 SKNSEYEDPPNKDDAFDYKAK----ANTFYMNVETVGSIATDQVVLRGIDTLQKKVA 256
            +   +E+       F+ K K     + F  NVE+ G++  +++  + +  L+ K +
Sbjct: 277 REVLRHEE-------FNDKVKLGRIRDHFIFNVESTGAMTPEEIFFKSVRILKNKAS 326

>Ecym_4450 Chr4 (921163..922167) [1005 bp, 334 aa] {ON} similar to
           Ashbya gossypii ADR031C
          Length = 334

 Score = 85.1 bits (209), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 72/287 (25%), Positives = 128/287 (44%), Gaps = 45/287 (15%)

Query: 8   VKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLADEFIAHRL 67
           V+I        +F L  +D ++AN+ RRIM++E+P++A + V    NT+V+ DE +AHR+
Sbjct: 42  VQISHLDDREANFDLIHIDASIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSTDIEQLEYCRDCF--CEDHCDKCSVVLTLQA--------------IGESESTT 111
           GL+PL+  D + L +        E   D+ +VV++L                  E  +  
Sbjct: 102 GLVPLK-VDPDMLTWVDKSLPEAERFTDENTVVMSLNVKCTANPDAPKGSTDPKELYNNA 160

Query: 112 NVYAKDLVIVSNLMGRNI----GHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEH 167
           ++Y++DL       G+ +     HP++       +L+ KLR GQE+S++     G+  +H
Sbjct: 161 HIYSRDLKF--EPQGKQLDSFAKHPVLPTDP--DILLAKLRPGQEISLRVHCILGVGGDH 216

Query: 168 AKWGPAAAIEFEYDPWNKLKHTDYWYE-QDISKEWPLS------KNSEYEDPPNKDDA-- 218
           AK+ P     +   P   +  T    +     K +P        K   Y     KD    
Sbjct: 217 AKFSPVCTASYRLMPHIDILETIQGEDATKFVKCFPPGVAAIDEKGEAYIKDARKDTVSR 276

Query: 219 -------FDYKAK----ANTFYMNVETVGSIATDQVVLRGIDTLQKK 254
                  F+ K K     + F  NVE+ G++  +++  + +  L+ K
Sbjct: 277 EVLRHPEFEGKVKLGRVKDHFIFNVESTGAMTPEEIFFKSVRILKNK 323

>NCAS0A11520 Chr1 complement(2279808..2280815) [1008 bp, 335 aa]
           {ON} Anc_3.428 YPR110C
          Length = 335

 Score = 84.3 bits (207), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 61/197 (30%), Positives = 100/197 (50%), Gaps = 27/197 (13%)

Query: 7   QVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLADEFIAHR 66
           +V+I    +   +F L  +D ++AN+ RRIM++E+P +A + V    NT+V+ DE +AHR
Sbjct: 41  KVEISSLNEREANFDLINIDTSIANAFRRIMISEVPAVAAEYVYFLNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSTDIEQLEYCRDCFC--EDHCDKCSVVLTLQ--------AIGESESTTNVYAK 116
           +GLIPL+  D + L +  +     E   D  ++VLTL         A  ++     +Y  
Sbjct: 101 IGLIPLK-VDPDLLTWVDNELPDEEKFNDTNTIVLTLNVKCTRNPDAPKDATDPKILYRN 159

Query: 117 DLVIVSNL----MGRNI----GHPII---QDKEGNGVLICKLRKGQELSMKCVAKKGISK 165
             V  S+L     G+ I    G P++   QD     +L+ KLR GQE+S++     G   
Sbjct: 160 SSVYASDLKFEPQGKQIETFAGTPVVPCDQD-----ILLAKLRPGQEISLRAHCILGTGG 214

Query: 166 EHAKWGPAAAIEFEYDP 182
           +HAK+ P +   +   P
Sbjct: 215 DHAKFSPVSTASYRLLP 231

>Kwal_23.3998 s23 (519065..520069) [1005 bp, 334 aa] {ON} YPR110C
           (RPC40) - RNA polymerase III (C) subunit [contig 255]
           FULL
          Length = 334

 Score = 84.0 bits (206), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 58/195 (29%), Positives = 95/195 (48%), Gaps = 25/195 (12%)

Query: 8   VKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLADEFIAHRL 67
           V+I    +   +F L  VD ++AN+ RRIM++E+P++A + V    NT+V+ DE +AHR+
Sbjct: 42  VRISSLDEREANFDLVNVDASIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSTDIEQLEYCRDCF--CEDHCDKCSVVLTLQAIGESES--------------TT 111
           GL PL+  D + L +        E   D+ ++VLTL                        
Sbjct: 102 GLTPLK-VDPDMLSWVDSSVPEAERFTDENTIVLTLNVKCTRNPDAPKDCTDPKILYRNA 160

Query: 112 NVYAKDLVIVSNLMGRNI----GHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEH 167
           ++YA+DL       G+ +     +P++       VL+ KLR GQE+S++     GI  +H
Sbjct: 161 HIYARDLKF--EPQGKQLETFAKNPVV--PADPDVLLAKLRPGQEISLRAHCILGIGSDH 216

Query: 168 AKWGPAAAIEFEYDP 182
           AK+ P     +   P
Sbjct: 217 AKFSPVCTASYRLMP 231

>NDAI0G05020 Chr7 (1217458..1220751) [3294 bp, 1097 aa] {ON}
           Anc_1.427
          Length = 1097

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 5/75 (6%)

Query: 172 PAAAIEFEYDPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDA-----FDYKAKAN 226
           P + I +++D    L +++  Y  D+SK     +NS YE P N + A       Y++K N
Sbjct: 623 PRSNIFYQFDKLVLLSNSEMVYSGDVSKVNEFLRNSGYECPVNYNIADYLIDITYESKGN 682

Query: 227 TFYMNVETVGSIATD 241
                 E  G ++T+
Sbjct: 683 LRARERERQGRVSTE 697

>KNAG0B00410 Chr2 (69475..71790) [2316 bp, 771 aa] {ON} Anc_3.544
           YGL227W
          Length = 771

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 34/78 (43%), Gaps = 11/78 (14%)

Query: 93  DKCSVVLTLQAIGESESTTNVYAKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQE 152
           DKC   L  +  G  ES   V + ++ +   ++G   G P+ +  E           GQ+
Sbjct: 600 DKCVAYLNSEIPGLLESNAEV-SFEIDLARFILGIMSGEPVARSIE----------TGQD 648

Query: 153 LSMKCVAKKGISKEHAKW 170
           LS+KC     IS+E   W
Sbjct: 649 LSLKCSTNSAISEETRTW 666

>Kwal_27.12335 s27 (1183798..1185261) [1464 bp, 487 aa] {ON} YOR320C
           - Hypothetical ORF [contig 20] FULL
          Length = 487

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 10/60 (16%)

Query: 232 VETVGSIATDQVVLRGIDTLQK--------KVASILLALNQMDQERVNFGTANNTGAIQD 283
           +E + +IA  QV+++ +DTL K        K  + LL  NQ + ER+ +   +N  A+ D
Sbjct: 147 LENLKAIAPSQVIIKSVDTLLKPGDMSPWNKSLTKLLVFNQTEYERIIY--LDNDAALND 204

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,127,119
Number of extensions: 1420895
Number of successful extensions: 3723
Number of sequences better than 10.0: 52
Number of HSP's gapped: 3792
Number of HSP's successfully gapped: 53
Length of query: 311
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 202
Effective length of database: 40,982,805
Effective search space: 8278526610
Effective search space used: 8278526610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)