Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0H025207.195ON1191196202e-84
ZYRO0D15818g7.195ON1181174441e-57
TPHA0C045207.195ON1351103297e-40
Kpol_1063.107.195ON1221162964e-35
Ecym_43817.195ON1201102618e-30
Kwal_55.20373singletonOFF1151112522e-28
Kwal_YGOB_ADL119W7.195ON1151112522e-28
KLTH0E04576g7.195ON1151102495e-28
SAKL0F07480g7.195ON1131082443e-27
CAGL0D05148g7.195ON1081122339e-26
NCAS0E018207.195ON1141112165e-23
KNAG0L012307.195ON1281121828e-18
KAFR0G029907.195ON1101161801e-17
TBLA0J015107.195ON1071051772e-17
KLLA0D16192g7.195ON1211201732e-16
ADL119W7.195ON1851121772e-16
NDAI0G019907.195ON101811363e-11
Scer_YGOB_ADL119W (ADL119W)7.195ON96971242e-09
Skud_6.1257.195ON225991162e-07
Suva_6.1147.195ON26895740.11
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0H02520
         (119 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0H02520 Chr8 complement(424797..425156) [360 bp, 119 aa] {ON...   243   2e-84
ZYRO0D15818g Chr4 (1321075..1321431) [357 bp, 118 aa] {ON} conse...   175   1e-57
TPHA0C04520 Chr3 (975080..975487) [408 bp, 135 aa] {ON} Anc_7.19...   131   7e-40
Kpol_1063.10 s1063 complement(28076..28444) [369 bp, 122 aa] {ON...   118   4e-35
Ecym_4381 Chr4 complement(802807..803169) [363 bp, 120 aa] {ON} ...   105   8e-30
Kwal_55.20373 s55 complement(377983..378330) [348 bp, 115 aa] {O...   101   2e-28
Kwal_YGOB_ADL119W s55 complement(377983..378330) [348 bp, 115 aa...   101   2e-28
KLTH0E04576g Chr5 complement(414398..414745) [348 bp, 115 aa] {O...   100   5e-28
SAKL0F07480g Chr6 (571315..571656) [342 bp, 113 aa] {ON} conserv...    99   3e-27
CAGL0D05148g Chr4 complement(492687..493013) [327 bp, 108 aa] {O...    94   9e-26
NCAS0E01820 Chr5 complement(355133..355477) [345 bp, 114 aa] {ON...    88   5e-23
KNAG0L01230 Chr12 (218769..219155) [387 bp, 128 aa] {ON} Anc_7.1...    75   8e-18
KAFR0G02990 Chr7 (619397..619729) [333 bp, 110 aa] {ON} Anc_7.19...    74   1e-17
TBLA0J01510 Chr10 complement(344073..344396) [324 bp, 107 aa] {O...    73   2e-17
KLLA0D16192g Chr4 (1364216..1364581) [366 bp, 121 aa] {ON} conse...    71   2e-16
ADL119W Chr4 (478065..478622) [558 bp, 185 aa] {ON} NOHBY409; No...    73   2e-16
NDAI0G01990 Chr7 complement(449171..449476) [306 bp, 101 aa] {ON...    57   3e-11
Scer_YGOB_ADL119W Chr6 (226260..226550) [291 bp, 96 aa] {ON} ANN...    52   2e-09
Skud_6.125 Chr6 (221029..221706) [678 bp, 225 aa] {ON}  (REAL)         49   2e-07
Suva_6.114 Chr6 (192307..193113) [807 bp, 268 aa] {ON}  (REAL)         33   0.11 

>TDEL0H02520 Chr8 complement(424797..425156) [360 bp, 119 aa] {ON}
           Anc_7.195 Scer_YGOB_ADL119W
          Length = 119

 Score =  243 bits (620), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 119/119 (100%), Positives = 119/119 (100%)

Query: 1   MSANYPVPDTRFEQTFRRALTREAEKHRAAQWRKMGVVDPVVINELQKAQPPSISKLVVC 60
           MSANYPVPDTRFEQTFRRALTREAEKHRAAQWRKMGVVDPVVINELQKAQPPSISKLVVC
Sbjct: 1   MSANYPVPDTRFEQTFRRALTREAEKHRAAQWRKMGVVDPVVINELQKAQPPSISKLVVC 60

Query: 61  KVVLRDVIFMPLVQGLLWTGVLIAMKPWLKNAVAHGRRLGSSIYRLVLGTDLVKPKRRI 119
           KVVLRDVIFMPLVQGLLWTGVLIAMKPWLKNAVAHGRRLGSSIYRLVLGTDLVKPKRRI
Sbjct: 61  KVVLRDVIFMPLVQGLLWTGVLIAMKPWLKNAVAHGRRLGSSIYRLVLGTDLVKPKRRI 119

>ZYRO0D15818g Chr4 (1321075..1321431) [357 bp, 118 aa] {ON}
           conserved hypothetical protein
          Length = 118

 Score =  175 bits (444), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 95/117 (81%)

Query: 1   MSANYPVPDTRFEQTFRRALTREAEKHRAAQWRKMGVVDPVVINELQKAQPPSISKLVVC 60
           MS  YP+PDTRFE TF+RAL REAEK R  QW+KMGV DP+VIN+LQK QP  I+  VVC
Sbjct: 1   MSGLYPIPDTRFESTFKRALNREAEKQRTLQWKKMGVEDPLVINQLQKNQPVKINSYVVC 60

Query: 61  KVVLRDVIFMPLVQGLLWTGVLIAMKPWLKNAVAHGRRLGSSIYRLVLGTDLVKPKR 117
           KVV RDVIFMPLVQGLLWT +LI MKPWL++ + +GR+ G+ IYR VLGTDL+K K+
Sbjct: 61  KVVARDVIFMPLVQGLLWTSLLITMKPWLRSVIQNGRKFGTFIYRTVLGTDLIKKKQ 117

>TPHA0C04520 Chr3 (975080..975487) [408 bp, 135 aa] {ON} Anc_7.195
           Scer_YGOB_ADL119W
          Length = 135

 Score =  131 bits (329), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 60/110 (54%), Positives = 84/110 (76%), Gaps = 1/110 (0%)

Query: 7   VPDTRFEQTFRRALTREAEKHRAAQWRKMGVVDPVVINELQKAQPPSISKLVVCKVVLRD 66
           VPD R EQ+F  AL +EAEK R A+ +K G+ D  ++ ++QK +P +++K +V KV+LRD
Sbjct: 25  VPDVRLEQSFNNALQKEAEKQRVAKLKKEGLDDSKIL-QIQKNEPATVTKYIVWKVILRD 83

Query: 67  VIFMPLVQGLLWTGVLIAMKPWLKNAVAHGRRLGSSIYRLVLGTDLVKPK 116
           +I MP +QG L+TG+L+A+KPWL+  V +GRR GS IY+LVLG DLVKPK
Sbjct: 84  MILMPFIQGALFTGLLMAVKPWLRGVVGNGRRFGSYIYKLVLGKDLVKPK 133

>Kpol_1063.10 s1063 complement(28076..28444) [369 bp, 122 aa] {ON}
           complement(28076..28444) [369 nt, 123 aa]
          Length = 122

 Score =  118 bits (296), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 83/116 (71%), Gaps = 1/116 (0%)

Query: 3   ANYPVPDTRFEQTFRRALTREAEKHRAAQWRKMGVVDPVVINELQKAQPPSISKLVVCKV 62
            N+PVPD RFE+TF RA+ +EAEK R    +K G+     I+++++ + P ++  +V KV
Sbjct: 8   TNFPVPDVRFEETFNRAINKEAEKQREYSLKKKGLTTDE-ISKIKENEAPEVTTYIVWKV 66

Query: 63  VLRDVIFMPLVQGLLWTGVLIAMKPWLKNAVAHGRRLGSSIYRLVLGTDLVKPKRR 118
           ++RD++ MP +QG++++G+LI +KPWL++ V +GRR G+ IY  VLG +L K K++
Sbjct: 67  IVRDMLIMPFIQGIMFSGLLIILKPWLRSVVGNGRRFGTFIYNTVLGKNLTKTKKQ 122

>Ecym_4381 Chr4 complement(802807..803169) [363 bp, 120 aa] {ON}
           similar to Ashbya gossypii ADL119W
          Length = 120

 Score =  105 bits (261), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 73/110 (66%), Gaps = 3/110 (2%)

Query: 7   VPDTRFEQTFRRALTREAEKHRAAQWRKMGVVDPVVINELQKAQPPSISKLVVCKVVLRD 66
           +PD RFEQTF  AL +EA K    + RK+     +V++E      P+I+  VV KV++RD
Sbjct: 8   IPDIRFEQTFMVALKKEALKQHQYKIRKLKGSQDIVVSE--DFGEPTITTFVVAKVIVRD 65

Query: 67  VIFMPLVQGLLWTGVLIAMKPWLKNAVAHGRRLGSSIYRLVLGTDLVKPK 116
           V+ +PLV G+LWTG LI MKPWLK    +GRRLG+ IY +++G + V PK
Sbjct: 66  VVLLPLVHGMLWTGFLIMMKPWLKACTQNGRRLGAGIYNVIVGRN-VYPK 114

>Kwal_55.20373 s55 complement(377983..378330) [348 bp, 115 aa] {OFF}
           [contig 149] FULL
          Length = 115

 Score =  101 bits (252), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 73/111 (65%), Gaps = 11/111 (9%)

Query: 7   VPDTRFEQTFRRALTREAEKHRAAQWRKMGVVDPVVINELQKAQPPSISKLVVCKVVLRD 66
           +PD RFEQTF+ AL REA K++  Q++     D         ++ P +S  ++CKVVLRD
Sbjct: 15  IPDLRFEQTFKNALKREALKNK--QYKAKNGTD-------TDSESP-LSASIICKVVLRD 64

Query: 67  VIFMPLVQGLLWTGVLIAMKPWLKNAVAHGRRLGSSIYRLVLGTDLVKPKR 117
           V+ +P +QG LWTGVLIAM+PWL +    G +LG  IY LVLG DLV PKR
Sbjct: 65  VLLLPFLQGALWTGVLIAMRPWLWHVKMQGLQLGRRIYNLVLGKDLV-PKR 114

>Kwal_YGOB_ADL119W s55 complement(377983..378330) [348 bp, 115 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 115

 Score =  101 bits (252), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 73/111 (65%), Gaps = 11/111 (9%)

Query: 7   VPDTRFEQTFRRALTREAEKHRAAQWRKMGVVDPVVINELQKAQPPSISKLVVCKVVLRD 66
           +PD RFEQTF+ AL REA K++  Q++     D         ++ P +S  ++CKVVLRD
Sbjct: 15  IPDLRFEQTFKNALKREALKNK--QYKAKNGTD-------TDSESP-LSASIICKVVLRD 64

Query: 67  VIFMPLVQGLLWTGVLIAMKPWLKNAVAHGRRLGSSIYRLVLGTDLVKPKR 117
           V+ +P +QG LWTGVLIAM+PWL +    G +LG  IY LVLG DLV PKR
Sbjct: 65  VLLLPFLQGALWTGVLIAMRPWLWHVKMQGLQLGRRIYNLVLGKDLV-PKR 114

>KLTH0E04576g Chr5 complement(414398..414745) [348 bp, 115 aa] {ON}
           conserved hypothetical protein
          Length = 115

 Score =  100 bits (249), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 67/110 (60%), Gaps = 10/110 (9%)

Query: 7   VPDTRFEQTFRRALTREAEKHRAAQWRKMGVVDPVVINELQKAQPPSISKLVVCKVVLRD 66
           VPD RFEQTF+RAL REA K++ A  +     D             +IS  V+CKVVLRD
Sbjct: 15  VPDLRFEQTFQRALRREASKNQKATSQGHSTTDA----------DATISASVICKVVLRD 64

Query: 67  VIFMPLVQGLLWTGVLIAMKPWLKNAVAHGRRLGSSIYRLVLGTDLVKPK 116
           V+ MP +QG+LWT  LIA+KPWL      G+ +G  IY +VLG  LV+ +
Sbjct: 65  VLLMPFLQGILWTSALIALKPWLHMVRIRGQLVGHRIYEMVLGKGLVRKR 114

>SAKL0F07480g Chr6 (571315..571656) [342 bp, 113 aa] {ON} conserved
           hypothetical protein
          Length = 113

 Score = 98.6 bits (244), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 78/108 (72%), Gaps = 11/108 (10%)

Query: 7   VPDTRFEQTFRRALTREAEKHRAAQWRKMGVVDPVVINELQKAQPPSISKLVVCKVVLRD 66
           VPDTRFEQTF+ AL +EA++ +AA   ++G      I  L    P  ++ +VV KVV+RD
Sbjct: 14  VPDTRFEQTFKNALKKEAKRMKAA---RLG------ITTLDDNAP--VTPMVVAKVVVRD 62

Query: 67  VIFMPLVQGLLWTGVLIAMKPWLKNAVAHGRRLGSSIYRLVLGTDLVK 114
           V+ MPLVQG+LWT  LIA+KPWL+NAV  GRR G S+YRLVLG DLV+
Sbjct: 63  VLLMPLVQGVLWTSFLIAIKPWLRNAVWQGRRFGMSVYRLVLGKDLVR 110

>CAGL0D05148g Chr4 complement(492687..493013) [327 bp, 108 aa] {ON}
           some similarities with KLLA0D16192g Kluyveromyces lactis
           and DEHA0C08349g Debaryomyces hansenii
          Length = 108

 Score = 94.4 bits (233), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 48/112 (42%), Positives = 65/112 (58%), Gaps = 12/112 (10%)

Query: 1   MSANYPVPDTRFEQTFRRALTREAEKHRAAQWRKMGVVDPVVINELQKAQPPSISKLVVC 60
           M+    +PDTRFEQTFRRA+ RE  K  A   +           + +K+ P   S  V+C
Sbjct: 1   MNGVIKIPDTRFEQTFRRAIDREVAKQNALSGKS---------TDDKKSGP---SAYVIC 48

Query: 61  KVVLRDVIFMPLVQGLLWTGVLIAMKPWLKNAVAHGRRLGSSIYRLVLGTDL 112
           KVV+RDV+ MP +Q +LWTG L+ +KPWL+  V  GRR G  + R + G  L
Sbjct: 49  KVVVRDVLLMPFIQSVLWTGFLLGLKPWLRMVVGFGRRTGEYLNRALYGGRL 100

>NCAS0E01820 Chr5 complement(355133..355477) [345 bp, 114 aa] {ON}
           Anc_7.195
          Length = 114

 Score = 87.8 bits (216), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 45/111 (40%), Positives = 67/111 (60%), Gaps = 9/111 (8%)

Query: 7   VPDTRFEQTFRRALTREAEKHRAAQWRKMGVVDPVVINELQKAQPPSISKLVVC-KVVLR 65
           +PD R EQTF+RA+ +E +++     +         I EL +     + K V+C KV+LR
Sbjct: 8   IPDLRVEQTFKRAVAKETKEYII---KNKATFPRSTITELTR-----VEKAVICSKVILR 59

Query: 66  DVIFMPLVQGLLWTGVLIAMKPWLKNAVAHGRRLGSSIYRLVLGTDLVKPK 116
           D++ MP +Q + WTG LI +KPWL+  V  GR++GSS   L+ G +LVK K
Sbjct: 60  DILVMPFLQSVAWTGFLIVLKPWLRTTVTFGRKMGSSAMDLITGRNLVKSK 110

>KNAG0L01230 Chr12 (218769..219155) [387 bp, 128 aa] {ON} Anc_7.195
           Scer_YGOB_ADL119W
          Length = 128

 Score = 74.7 bits (182), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 59/112 (52%), Gaps = 22/112 (19%)

Query: 7   VPDTRFEQTFRRALTREAEKHRAAQWRKMGVVDPVVINELQKAQPPSISKLVVCKVVLRD 66
           +P+ RF   F  AL  EA +H  A+                       +  +VCKVV +D
Sbjct: 36  IPEMRFNYVFNNALKAEAARHNVAE----------------------PTTWMVCKVVCKD 73

Query: 67  VIFMPLVQGLLWTGVLIAMKPWLKNAVAHGRRLGSSIYRLVLGTDLVKPKRR 118
           V+ MP +Q  LWT +LI+MK  LKNA+ + +R+ S+++  V G ++ KPK +
Sbjct: 74  VLLMPFLQSFLWTALLISMKTPLKNALNYTKRMCSALFTNVSGANMYKPKGK 125

>KAFR0G02990 Chr7 (619397..619729) [333 bp, 110 aa] {ON} Anc_7.195
           Scer_YGOB_ADL119W
          Length = 110

 Score = 73.9 bits (180), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 58/116 (50%), Gaps = 15/116 (12%)

Query: 1   MSANYPVPDTRFEQTFRRALTREAEKHRAAQWRKMGVVDPVVINELQKAQPPSISKLVVC 60
           ++ N  +PDTRF   FR+A+ +E  K                + E           L++C
Sbjct: 8   INNNLAIPDTRFGYVFRKAVQKELRKQ---------------VKETDSDNKHINKNLIIC 52

Query: 61  KVVLRDVIFMPLVQGLLWTGVLIAMKPWLKNAVAHGRRLGSSIYRLVLGTDLVKPK 116
           KV+ RDVI MP +Q +LWTG LI+ KP L+  +   +RLG  I   +L  ++ K K
Sbjct: 53  KVIARDVILMPFIQSILWTGFLISFKPCLRGFIRFCQRLGPMIKGSILEGNIGKSK 108

>TBLA0J01510 Chr10 complement(344073..344396) [324 bp, 107 aa] {ON}
           Anc_7.195 Scer_YGOB_ADL119W
          Length = 107

 Score = 72.8 bits (177), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 54/105 (51%), Gaps = 15/105 (14%)

Query: 6   PVPDTRFEQTFRRALTREAEKHRAAQWRKMGVVDPVVINELQKAQPPSISKLVVC-KVVL 64
           P+PDTRFE TFRR L +E  K+               +N     +   + KL+   KV+ 
Sbjct: 11  PIPDTRFESTFRRKLDKELNKNN--------------VNSNSIIKDERVRKLLCLGKVIC 56

Query: 65  RDVIFMPLVQGLLWTGVLIAMKPWLKNAVAHGRRLGSSIYRLVLG 109
           RDVIFMP VQG+   G  I +KPWL   + +G+ +G +   L  G
Sbjct: 57  RDVIFMPFVQGMFMCGAFILIKPWLLKLLRNGKNIGRNFVELFGG 101

>KLLA0D16192g Chr4 (1364216..1364581) [366 bp, 121 aa] {ON}
           conserved hypothetical protein
          Length = 121

 Score = 71.2 bits (173), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 64/120 (53%), Gaps = 11/120 (9%)

Query: 1   MSANYPVPDTRFEQTFRRALTREAEKHRAAQWRKMGVVDPVVINELQKAQPPSISKLVVC 60
           +S    +PD RFEQTF+++L +EA K        + V D  V++       P I+  +V 
Sbjct: 12  VSVKASLPDLRFEQTFKQSLRKEALKQNKLT---LSVADGSVVD-------PPITPYIVA 61

Query: 61  KVVLRDVIFMPLVQGLLWTGVLIAMKPWLKNAVAHGRRLGSSIYRLVLGTDLV-KPKRRI 119
           KVV RD++  P +QG+  +   I  KPWL+     GR +G SI R + G + + +P R I
Sbjct: 62  KVVARDILISPFLQGVFLSLFYIVAKPWLQYCRQAGRNIGRSIIRNLFGKNAIYRPPRNI 121

>ADL119W Chr4 (478065..478622) [558 bp, 185 aa] {ON} NOHBY409; No
           homolog in Saccharomyces cerevisiae
          Length = 185

 Score = 72.8 bits (177), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 67/112 (59%), Gaps = 10/112 (8%)

Query: 7   VPDTRFEQTFRRALTREAEKHRAAQWRKMGVVDPVVINELQKAQPPSISKLVVCKVVLRD 66
           +PD RFEQTFR AL +E+ + R  + +K G        E        IS LVV KVV+RD
Sbjct: 82  IPDVRFEQTFRAALAKESARQRQLRAQKEG--------EAAADGEAGISALVVAKVVVRD 133

Query: 67  VIFMPLVQGLLWTGVLIAMKPWLKNAVAHGRRLGSSIYRLVLGTDLVKPKRR 118
           V+ MPLVQG LWTG+LI MKP L   +  GRR   + YR ++G   V+P+ R
Sbjct: 134 VLLMPLVQGALWTGLLITMKPCLPLCMLGGRRADQAFYRALVGD--VRPRMR 183

>NDAI0G01990 Chr7 complement(449171..449476) [306 bp, 101 aa] {ON}
          Anc_7.195
          Length = 101

 Score = 57.0 bits (136), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 40/81 (49%), Gaps = 13/81 (16%)

Query: 7  VPDTRFEQTFRRALTREAEKHRAAQWRKMGVVDPVVINELQKAQPPSISKLVVCKVVLRD 66
          +PDTRF+Q F+ AL RE  K      +             Q         LV+ KV+LRD
Sbjct: 6  IPDTRFQQVFQNALERERNKLYPDTTK-------------QNTGTLVTESLVIFKVILRD 52

Query: 67 VIFMPLVQGLLWTGVLIAMKP 87
          VI +P +Q +LWT  LI  KP
Sbjct: 53 VILLPFIQSVLWTEFLIVCKP 73

>Scer_YGOB_ADL119W Chr6 (226260..226550) [291 bp, 96 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 96

 Score = 52.4 bits (124), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 46/97 (47%), Gaps = 22/97 (22%)

Query: 7   VPDTRFEQTFRRALTREAEKHRAAQWRKMGVVDPVVINELQKAQPPSISKLVVCKVVLRD 66
           +PD RFE+ F++AL RE     +   RK GV+                      KVV+RD
Sbjct: 15  IPDLRFEKVFKKALHRELAPSSSLS-RKAGVI---------------------TKVVVRD 52

Query: 67  VIFMPLVQGLLWTGVLIAMKPWLKNAVAHGRRLGSSI 103
           V+ MPL+Q  + +  L+ +K WL      GR LG  I
Sbjct: 53  VLLMPLLQSFVLSLALMGVKEWLSYIRLKGRTLGDRI 89

>Skud_6.125 Chr6 (221029..221706) [678 bp, 225 aa] {ON}  (REAL)
          Length = 225

 Score = 49.3 bits (116), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 48/99 (48%), Gaps = 26/99 (26%)

Query: 7   VPDTRFEQTFRRALTREAEKHRA--AQWRKMGVVDPVVINELQKAQPPSISKLVVCKVVL 64
           +PD RFE+ F++AL RE     +  ++W                         V+ KVV+
Sbjct: 144 IPDLRFEKVFKKALHRELAPSSSVPSKW------------------------AVITKVVV 179

Query: 65  RDVIFMPLVQGLLWTGVLIAMKPWLKNAVAHGRRLGSSI 103
           RDV+ MPL+Q  + + VL+ +K WL+     GR LG  +
Sbjct: 180 RDVLLMPLLQSFVLSLVLMGVKDWLRFIRLEGRTLGGRL 218

>Suva_6.114 Chr6 (192307..193113) [807 bp, 268 aa] {ON}  (REAL)
          Length = 268

 Score = 33.1 bits (74), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 48/95 (50%), Gaps = 22/95 (23%)

Query: 7   VPDTRFEQTFRRALTREAEKHRAAQWRKMGVVDPVVINELQKAQPPSISKLVVCKVVLRD 66
           +PD RF + F RAL R+     A++ RK+ VV                      KVV+RD
Sbjct: 187 IPDLRFGKVFERALYRDLTP-SASRSRKLAVVA---------------------KVVVRD 224

Query: 67  VIFMPLVQGLLWTGVLIAMKPWLKNAVAHGRRLGS 101
           V+ MPLVQ ++ + VLI +K WL+     G  LG+
Sbjct: 225 VLLMPLVQSIVLSVVLIGVKDWLRYIRLKGFTLGA 259

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.138    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,265,045
Number of extensions: 364421
Number of successful extensions: 939
Number of sequences better than 10.0: 20
Number of HSP's gapped: 921
Number of HSP's successfully gapped: 20
Length of query: 119
Length of database: 53,481,399
Length adjustment: 88
Effective length of query: 31
Effective length of database: 43,390,791
Effective search space: 1345114521
Effective search space used: 1345114521
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 59 (27.3 bits)