Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G046606.5ON73973936420.0
ZYRO0F00396g6.5ON73274424490.0
CAGL0A01133g6.5ON80158923700.0
NDAI0I027306.5ON83270223290.0
Kpol_1045.836.5ON74865823170.0
TPHA0J002206.5ON74072422940.0
Suva_16.356.5ON76768822840.0
NCAS0D022106.5ON77366022850.0
YPL270W (MDL2)6.5ON77366122810.0
Smik_6.4786.5ON77368522550.0
Skud_16.76.5ON77364322460.0
TBLA0A071906.5ON79466422450.0
SAKL0E00748g6.5ON77465622170.0
Kwal_56.223296.5ON77662321930.0
KLTH0C11616g6.5ON74059021580.0
KLLA0D00748g6.5ON78961021100.0
KNAG0E028006.5ON74166720690.0
ACR022W6.5ON75459520410.0
Ecym_30076.5ON76960720410.0
KAFR0B064806.5ON75174219320.0
TPHA0B046201.67ON72063113860.0
Kpol_2000.791.67ON70768613780.0
Ecym_10721.67ON68364313681e-180
NDAI0A005601.67ON71459413661e-179
TDEL0C063501.67ON69363713511e-177
AFR683C1.67ON67758913421e-176
KLLA0C01991g1.67ON70665613441e-176
SAKL0C02244g1.67ON71261113391e-175
NCAS0B087001.67ON71560213321e-174
Skud_12.2531.67ON69264813181e-172
YLR188W (MDL1)1.67ON69559113131e-171
ZYRO0F17050g1.67ON71460413021e-169
KLTH0F02024g1.67ON73463013021e-169
Suva_10.2841.67ON69366812981e-169
Smik_12.2481.67ON69662512941e-168
Kwal_33.133081.67ON70664712771e-166
TBLA0A053001.67ON70759612741e-165
CAGL0E00385g1.67ON60858011981e-155
Kwal_26.94805.20ON7196695509e-60
KLTH0B09482g5.20ON6944165445e-59
SAKL0H00968g5.20ON7004035288e-57
Suva_13.4915.20ON6936765242e-56
Skud_13.4755.20ON6913875225e-56
Smik_13.5185.20ON6873895191e-55
YMR301C (ATM1)5.20ON6903875172e-55
NCAS0D024305.20ON7024175155e-55
KNAG0E013205.20ON6953755121e-54
KLLA0A10131g5.20ON7203855103e-54
Ecym_56495.20ON6963875059e-54
KAFR0I025805.20ON7093865051e-53
Kpol_513.235.20ON7084115023e-53
TDEL0G004305.20ON6964044971e-52
TDEL0F003401.527ON12575245016e-52
AGL335W5.20ON6913854891e-51
NDAI0I024405.20ON7304614874e-51
TBLA0C070005.20ON7254104874e-51
ZYRO0D07106g5.20ON7094084848e-51
CAGL0M13739g5.20ON7275264848e-51
YKL209C (STE6)1.527ON12905304901e-50
TPHA0L022705.20ON7113884794e-50
KNAG0G001901.527ON12755074723e-48
Kpol_1018.1851.527ON12765094704e-48
TBLA0B100701.527ON12965024652e-47
Smik_11.141.527ON13166054643e-47
NDAI0D015401.527ON12935024591e-46
Skud_11.111.527ON12955274572e-46
AFR432W1.527ON12845024563e-46
SAKL0A10208g1.527ON13104934554e-46
Suva_11.111.527ON12905224536e-46
NCAS0G035101.527ON12885144449e-45
KAFR0E002301.527ON12704984449e-45
TPHA0O001601.527ON12535034351e-43
ZYRO0G02244g1.527ON12735234332e-43
Ecym_36121.527ON13155404271e-42
KLTH0B01100g1.527ON12984194217e-42
TDEL0E056104.52ON15355424163e-41
KLLA0B14256g1.527ON12712344121e-40
CAGL0K00363g1.527ON12275224092e-40
Kwal_33.155611.527ON12974103914e-38
Ecym_42658.303ON15055113898e-38
SAKL0H16016g8.303ON14994753673e-35
CAGL0E03355g4.52ON15355683621e-34
TPHA0C009608.303ON15234753612e-34
CAGL0E03982g4.6ON16595073602e-34
YHL035C (VMR1)4.6ON15925883575e-34
Smik_12.484.52ON15575273576e-34
NDAI0B006405.10ON14915533568e-34
SAKL0H00704g5.10ON14395473532e-33
KNAG0E011204.6ON17175063532e-33
KNAG0J027304.52ON15375333504e-33
ZYRO0G07612g4.6ON16955533495e-33
Kwal_56.22747na 1ON15385633496e-33
CAGL0G00242g5.10ON14772543496e-33
KNAG0K001705.10ON14422853488e-33
TBLA0G007104.6ON16915083452e-32
KAFR0C065105.10ON14572823433e-32
NCAS0B034708.303ON15124713433e-32
KLTH0C09240gna 1ON15465363424e-32
NCAS0J00160singletonON16545273408e-32
Suva_2.2978.303ON15165133371e-31
NCAS0E041605.10ON15065633371e-31
Skud_7.6145.10ON14772693362e-31
Smik_16.275.10ON14772813353e-31
Skud_12.524.52ON15615643344e-31
Suva_7.5775.10ON14782783327e-31
NCAS0C059304.6ON16575283327e-31
KAFR0I013004.52ON15365443318e-31
KLTH0G12716g8.303ON15003763311e-30
KLLA0E00529g4.6ON16505513301e-30
Skud_4.3958.303ON15164983292e-30
Suva_10.594.52ON15615613292e-30
ZYRO0D06160g8.303ON15255813282e-30
KAFR0B056308.303ON15154703282e-30
KNAG0I009908.303ON15353643282e-30
NDAI0J011508.303ON15173753263e-30
YGR281W (YOR1)5.10ON14772693263e-30
Suva_10.60singletonON9905603254e-30
YLL048C (YBT1)4.6ON16614953264e-30
ZYRO0G22176g4.52ON15705383264e-30
Suva_10.234.6ON16614913264e-30
Smik_4.3808.303ON15165083254e-30
YDR135C (YCF1)8.303ON15154693211e-29
KLLA0D04059g4.52ON15685253211e-29
TDEL0G003305.10ON14652413202e-29
Kpol_1060.75.10ON14603343174e-29
KLLA0F20075g8.303ON15164583174e-29
TPHA0K023104.6ON16494893175e-29
Smik_8.64.6ON15855113165e-29
AGR047W8.303ON14924823157e-29
TDEL0F043008.303ON15143673158e-29
Kwal_34.157704.6ON14364873158e-29
SAKL0H26026g4.6ON16534843149e-29
Skud_12.224.6ON16614913103e-28
Smik_12.114.6ON16614923086e-28
CAGL0C03289g4.6ON16485033086e-28
Kpol_311.34.6ON16575113077e-28
KLTH0H16038g4.6ON16494883069e-28
Suva_8.164.6ON15996793061e-27
NDAI0H001904.6ON16824883061e-27
Kwal_56.238448.303ON14943643051e-27
TBLA0C06400singletonON13775443041e-27
Ecym_84184.6ON16785373014e-27
TPHA0A056205.10ON14773043005e-27
Kpol_1033.288.303ON15314882971e-26
SAKL0H23958g4.52ON15583192971e-26
YLL015W (BPT1)4.52ON15595372971e-26
TDEL0G018504.6ON16424922971e-26
CAGL0L06402g8.303ON15352462962e-26
Skud_8.94.6ON15875182943e-26
KAFR0L001904.6ON16534952891e-25
TBLA0A038008.303ON15465412872e-25
Kpol_1041.45singletonOFF15965362853e-25
Kpol_YGOB_1041.454.52ON15685382853e-25
KLTH0B00396gsingletonON15072292835e-25
TPHA0F004104.52ON15705992836e-25
Zrou_YGOB_Anc_5.105.10ON9922842817e-25
KLTH0B09724g5.10ON14862782773e-24
TPHA0F001804.6ON16464782764e-24
TBLA0A06840singletonON10582572754e-24
AGL346W5.10ON14002342745e-24
KLLA0C14234g5.10ON14545352755e-24
YKR104WsingletonON3062812607e-24
Smik_11.367na 2ON15955342702e-23
Skud_18.2singletonON15805502675e-23
ACL072C4.6ON16274942666e-23
TBLA0C071005.10ON14855612631e-22
Kwal_26.95325.10ON14715572603e-22
YKR103W (NFT1)na 2ON12182272022e-15
Ecym_56605.10ON15362481942e-14
YPL147W (PXA1)8.661ON8702611905e-14
Smik_6.3448.661ON8702611861e-13
Suva_16.1638.661ON8702111852e-13
Skud_16.1358.661ON8702611816e-13
Kpol_175.1singletonON13772801791e-12
KAFR0A037908.661ON8762591744e-12
SAKL0H21010gsingletonON14472381655e-11
ACR128C8.661ON8271911638e-11
NDAI0H035701.366ON7552031621e-10
NDAI0E012408.661ON8972041621e-10
TBLA0C012201.366ON7512271611e-10
Kwal_26.87308.661ON8312111602e-10
ZYRO0G01144g1.366ON7522651574e-10
ZYRO0E04092g1.427ON10622411574e-10
KNAG0C019601.366ON7522311549e-10
KAFR0C045401.366ON7522431549e-10
KNAG0A029808.661ON8711971541e-09
CAGL0K10472g1.366ON7522041531e-09
SAKL0D10208g1.366ON7522301521e-09
KLTH0D10890g8.661ON8302001522e-09
Kpol_1043.431.366ON7522291522e-09
TBLA0D043501.427ON11192901522e-09
KLLA0F11484g8.661ON8452231512e-09
TDEL0A036405.500ON15092201513e-09
Kpol_1012.108.661ON8551471503e-09
NCAS0A085701.427ON10602501513e-09
Suva_6.841.366ON7522041494e-09
KNAG0K009503.133ON12842631504e-09
TDEL0A060708.661ON8722571494e-09
Ecym_24108.661ON8281911485e-09
SAKL0H06908g8.661ON8361871486e-09
YDR406W (PDR15)5.500ON15292471486e-09
Smik_4.6785.500ON15332431486e-09
TPHA0A023101.366ON7522041477e-09
ZYRO0D11880g5.500ON14982231477e-09
ZYRO0F07018g8.661ON8612611478e-09
TDEL0B057601.427ON10362421478e-09
YOL075C3.133ON12942471478e-09
ZYRO0D11836gna 3ON14622201479e-09
Kpol_1049.234.6ON110731321e-08
YDR011W (SNQ2)3.220ON15012401461e-08
Smik_7.3131.366ON7522041451e-08
TBLA0C017808.661ON8881901451e-08
TBLA0D01820singletonON15512011461e-08
KNAG0B038705.500ON15132181451e-08
ZYRO0D11858gna 4ON15032281451e-08
TPHA0D011708.661ON9152001451e-08
YFR009W (GCN20)1.366ON7522041441e-08
NCAS0B053003.133ON12732051451e-08
NCAS0B015308.661ON8682001441e-08
ZYRO0B05588g3.133ON12702301452e-08
TBLA0D017805.500ON15952011442e-08
YER036C (ARB1)3.534ON6102411432e-08
Suva_2.5835.500ON15372411442e-08
ZYRO0B14762gsingletonON15152381432e-08
Kwal_0.3271.427ON10192351432e-08
Ecym_8014na 5ON15172361433e-08
KAFR0C012003.133ON12732161423e-08
Smik_4.2443.220ON15012401423e-08
Suva_5.1343.534ON6101871404e-08
NCAS0E004803.534ON6102411404e-08
Ecym_11943.534ON6091871404e-08
KLLA0A10857g1.366ON7522221404e-08
Smik_5.1593.534ON6101871404e-08
ZYRO0E08800g3.534ON6102421404e-08
AGL142CsingletonON14972181414e-08
Skud_5.1453.534ON6101871405e-08
KAFR0C052205.500ON14992521405e-08
Skud_6.951.366ON7522111396e-08
KAFR0E03460na 3ON15462191396e-08
ZYRO0A04114g3.220ON15182441397e-08
TPHA0D04700singletonON15102171389e-08
Ecym_27141.366ON7482671379e-08
AEL032W1.366ON7532341379e-08
KLLA0D04554g1.427ON10222361389e-08
NCAS0A120605.500ON15432361381e-07
KLTH0H13442g1.366ON7522401371e-07
KAFR0E03450na 4ON15532191371e-07
Kwal_47.191163.534ON6072341361e-07
YOR328W (PDR10)na 6ON15642341371e-07
Suva_15.913.133ON13022141371e-07
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G04660
         (739 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5...  1407   0.0  
ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON...   947   0.0  
CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} simila...   917   0.0  
NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {O...   901   0.0  
Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON} (1930...   897   0.0  
TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON...   888   0.0  
Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W (...   884   0.0  
NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5      884   0.0  
YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}  MDL2Mitocho...   883   0.0  
Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON...   873   0.0  
Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)   869   0.0  
TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa] ...   869   0.0  
SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON...   858   0.0  
Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON...   849   0.0  
KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} simila...   835   0.0  
KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON...   817   0.0  
KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5...   801   0.0  
ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic ho...   790   0.0  
Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON} s...   790   0.0  
KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa] ...   748   0.0  
TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa] ...   538   0.0  
Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa] ...   535   0.0  
Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar t...   531   e-180
NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {O...   530   e-179
TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa] ...   525   e-177
AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}...   521   e-176
KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} simila...   522   e-176
SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} simila...   520   e-175
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...   517   e-174
Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188...   512   e-172
YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}  MDL1Mitoc...   510   e-171
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...   506   e-169
KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} simila...   506   e-169
Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188...   504   e-169
Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188...   503   e-168
Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188...   496   e-166
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...   495   e-165
CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar ...   466   e-155
Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa] ...   216   9e-60
KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {...   214   5e-59
SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly...   207   8e-57
Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {...   206   2e-56
Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {...   205   5e-56
Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {...   204   1e-55
YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON} ...   203   2e-55
NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20     202   5e-55
KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.2...   201   1e-54
KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {...   201   3e-54
Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {O...   199   9e-54
KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {O...   199   1e-53
Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}...   197   3e-53
TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20 ...   196   1e-52
TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON...   197   6e-52
AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homo...   192   1e-51
NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {O...   192   4e-51
TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa] ...   192   4e-51
ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} simila...   191   8e-51
CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa...   191   8e-51
YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}  ...   193   1e-50
TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {...   189   4e-50
KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON...   186   3e-48
Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON} (46...   185   4e-48
TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_...   183   2e-47
Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON...   183   3e-47
NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1....   181   1e-46
Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON...   180   2e-46
AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic...   180   3e-46
SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} simil...   179   4e-46
Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON...   179   6e-46
NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1....   175   9e-45
KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON...   175   9e-45
TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {O...   172   1e-43
ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} simil...   171   2e-43
Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} simila...   169   1e-42
KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {O...   166   7e-42
TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_...   164   3e-41
KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON} sim...   163   1e-40
CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {...   162   2e-40
Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL...   155   4e-38
Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar ...   154   8e-38
SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} sim...   145   3e-35
CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] ...   144   1e-34
TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8....   143   2e-34
CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} simil...   143   2e-34
YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}  V...   142   5e-34
Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015...   142   6e-34
NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10    141   8e-34
SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar...   140   2e-33
KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4....   140   2e-33
KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] ...   139   4e-33
ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] ...   139   5e-33
Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL01...   139   6e-33
CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {O...   139   6e-33
KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {O...   138   8e-33
TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4....   137   2e-32
KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_...   136   3e-32
NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {...   136   3e-32
KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] ...   136   4e-32
NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {O...   135   8e-32
Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {O...   134   1e-31
NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10    134   1e-31
Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR28...   134   2e-31
Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON...   133   3e-31
Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015...   133   4e-31
Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR28...   132   7e-31
NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_...   132   7e-31
KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {...   132   8e-31
KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} hig...   132   1e-30
KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {O...   131   1e-30
Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {O...   131   2e-30
Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015...   131   2e-30
ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highl...   130   2e-30
KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa]...   130   2e-30
KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8....   130   2e-30
NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] ...   130   3e-30
YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Pla...   130   3e-30
Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W...   129   4e-30
YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}  ...   130   4e-30
ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} sim...   130   4e-30
Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON...   130   4e-30
Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {O...   129   4e-30
YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON} ...   128   1e-29
KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] ...   128   1e-29
TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON...   127   2e-29
Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {O...   126   4e-29
KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa...   126   4e-29
TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4...   126   5e-29
Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON} Y...   126   5e-29
AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic h...   125   7e-29
TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {...   125   8e-29
Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {O...   125   8e-29
SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} sim...   125   9e-29
Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON...   124   3e-28
Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON...   123   6e-28
CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} simil...   123   6e-28
Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..104...   122   7e-28
KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} sim...   122   9e-28
Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON} ...   122   1e-27
NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON...   122   1e-27
Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] ...   122   1e-27
TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa]...   121   1e-27
Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar ...   120   4e-27
TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_...   120   5e-27
Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {...   119   1e-26
SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa...   119   1e-26
YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC ...   119   1e-26
TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4....   119   1e-26
CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} high...   118   2e-26
Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON} Y...   117   3e-26
KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {O...   115   1e-25
TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {...   115   2e-25
Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]...   114   3e-25
Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 156...   114   3e-25
KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {O...   113   5e-25
TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.5...   113   6e-25
Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 a...   112   7e-25
KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] ...   111   3e-24
TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON...   110   4e-24
TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_...   110   4e-24
AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic hom...   110   5e-24
KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} sim...   110   5e-24
YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative tr...   104   7e-24
Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR10...   108   2e-23
Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (R...   107   5e-23
ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON} ...   107   6e-23
TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON}           105   1e-22
Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa]...   104   3e-22
YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}  NFT1Puta...    82   2e-15
Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {...    79   2e-14
YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subun...    78   5e-14
Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON...    76   1e-13
Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147...    76   2e-13
Skud_16.135 Chr16 (244860..247472) [2613 bp, 870 aa] {ON} YPL147...    74   6e-13
Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON} comp...    74   1e-12
KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {O...    72   4e-12
SAKL0H21010g Chr8 (1835185..1839528) [4344 bp, 1447 aa] {ON} sim...    68   5e-11
ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON} S...    67   8e-11
NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {O...    67   1e-10
NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661     67   1e-10
TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {O...    67   1e-10
Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {O...    66   2e-10
ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly s...    65   4e-10
ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} simil...    65   4e-10
KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {O...    64   9e-10
KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {O...    64   9e-10
KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.6...    64   1e-09
CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} hig...    64   1e-09
SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {...    63   1e-09
KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {...    63   2e-09
Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {O...    63   2e-09
TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]...    63   2e-09
KLLA0F11484g Chr6 (1052991..1055528) [2538 bp, 845 aa] {ON} simi...    63   2e-09
TDEL0A03640 Chr1 (646252..650781) [4530 bp, 1509 aa] {ON} Anc_5....    63   3e-09
Kpol_1012.10 s1012 complement(20013..20741,21318..21326,21750..2...    62   3e-09
NCAS0A08570 Chr1 (1693304..1696486) [3183 bp, 1060 aa] {ON} Anc_...    63   3e-09
Suva_6.84 Chr6 complement(145289..147547) [2259 bp, 752 aa] {ON}...    62   4e-09
KNAG0K00950 Chr11 complement(186381..190235) [3855 bp, 1284 aa] ...    62   4e-09
TDEL0A06070 Chr1 complement(1064071..1066689) [2619 bp, 872 aa] ...    62   4e-09
Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar t...    62   5e-09
SAKL0H06908g Chr8 (605838..608348) [2511 bp, 836 aa] {ON} simila...    62   6e-09
YDR406W Chr4 (1279210..1283799) [4590 bp, 1529 aa] {ON}  PDR15Pl...    62   6e-09
Smik_4.678 Chr4 (1200036..1204637) [4602 bp, 1533 aa] {ON} YDR40...    62   6e-09
TPHA0A02310 Chr1 (483447..485705) [2259 bp, 752 aa] {ON} Anc_1.3...    61   7e-09
ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} sim...    61   7e-09
ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {...    61   8e-09
TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON} Anc_...    61   8e-09
YOL075C Chr15 complement(189658..193542) [3885 bp, 1294 aa] {ON}...    61   8e-09
ZYRO0D11836g Chr4 (993707..998095) [4389 bp, 1462 aa] {ON} simil...    61   9e-09
Kpol_1049.23 s1049 complement(67726..68058) [333 bp, 110 aa] {ON...    55   1e-08
YDR011W Chr4 (465919..470424) [4506 bp, 1501 aa] {ON}  SNQ2Plasm...    61   1e-08
Smik_7.313 Chr7 (524077..526335) [2259 bp, 752 aa] {ON} YFR009W ...    60   1e-08
TBLA0C01780 Chr3 complement(421045..423711) [2667 bp, 888 aa] {O...    60   1e-08
TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON}              61   1e-08
KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {...    60   1e-08
ZYRO0D11858g Chr4 (998646..1003157) [4512 bp, 1503 aa] {ON} high...    60   1e-08
TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {O...    60   1e-08
YFR009W Chr6 (162488..164746) [2259 bp, 752 aa] {ON}  GCN20Posit...    60   1e-08
NCAS0B05300 Chr2 (980856..984677) [3822 bp, 1273 aa] {ON} Anc_3....    60   1e-08
NCAS0B01530 Chr2 complement(249743..252349) [2607 bp, 868 aa] {O...    60   1e-08
ZYRO0B05588g Chr2 (440556..444368) [3813 bp, 1270 aa] {ON} simil...    60   2e-08
TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {...    60   2e-08
YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}  ...    60   2e-08
Suva_2.583 Chr2 (1030711..1035324) [4614 bp, 1537 aa] {ON} YDR40...    60   2e-08
ZYRO0B14762g Chr2 (1201028..1205575) [4548 bp, 1515 aa] {ON} sim...    60   2e-08
Kwal_0.327 s0 complement(154643..157702) [3060 bp, 1019 aa] {ON}...    60   2e-08
Ecym_8014 Chr8 (37756..42309) [4554 bp, 1517 aa] {ON} similar to...    60   3e-08
KAFR0C01200 Chr3 (240350..244171) [3822 bp, 1273 aa] {ON} Anc_3....    59   3e-08
Smik_4.244 Chr4 (445916..450421) [4506 bp, 1501 aa] {ON} YDR011W...    59   3e-08
Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON...    59   4e-08
NCAS0E00480 Chr5 (81549..83381) [1833 bp, 610 aa] {ON}                 59   4e-08
Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar t...    59   4e-08
KLLA0A10857g Chr1 complement(941784..944042) [2259 bp, 752 aa] {...    59   4e-08
Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON...    59   4e-08
ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {...    59   4e-08
AGL142C Chr7 complement(434247..438740) [4494 bp, 1497 aa] {ON} ...    59   4e-08
Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON...    59   5e-08
KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_...    59   5e-08
Skud_6.95 Chr6 complement(175462..177720) [2259 bp, 752 aa] {ON}...    58   6e-08
KAFR0E03460 Chr5 complement(695361..700001) [4641 bp, 1546 aa] {...    58   6e-08
ZYRO0A04114g Chr1 complement(328582..333138) [4557 bp, 1518 aa] ...    58   7e-08
TPHA0D04700 Chr4 (1026978..1031510) [4533 bp, 1510 aa] {ON}            58   9e-08
Ecym_2714 Chr2 (1380718..1382964) [2247 bp, 748 aa] {ON} similar...    57   9e-08
AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic ho...    57   9e-08
KLLA0D04554g Chr4 complement(385733..388801) [3069 bp, 1022 aa] ...    58   9e-08
NCAS0A12060 Chr1 (2388467..2393098) [4632 bp, 1543 aa] {ON} Anc_...    58   1e-07
KLTH0H13442g Chr8 complement(1175860..1178118) [2259 bp, 752 aa]...    57   1e-07
KAFR0E03450 Chr5 complement(689571..694232) [4662 bp, 1553 aa] {...    57   1e-07
Kwal_47.19116 s47 complement(1101559..1103382) [1824 bp, 607 aa]...    57   1e-07
YOR328W Chr15 (931803..936497) [4695 bp, 1564 aa] {ON}  PDR10ATP...    57   1e-07
Suva_15.91 Chr15 complement(162469..166377) [3909 bp, 1302 aa] {...    57   1e-07
Smik_15.333 Chr15 (575791..580323) [4533 bp, 1510 aa] {ON} YOR15...    57   1e-07
Ecym_3604 Chr3 complement(1143009..1147433) [4425 bp, 1474 aa] {...    57   1e-07
SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly...    57   1e-07
CAGL0M02387g Chr13 (280372..282942) [2571 bp, 856 aa] {ON} simil...    57   2e-07
NCAS0D00580 Chr4 (96350..98611) [2262 bp, 753 aa] {ON} Anc_1.366       57   2e-07
Smik_15.84 Chr15 complement(153969..157856) [3888 bp, 1295 aa] {...    57   2e-07
Kwal_34.16240 s34 (257762..260020) [2259 bp, 752 aa] {ON} YFR009...    57   2e-07
CAGL0C02343g Chr3 (236112..236391,236790..238672) [2163 bp, 720 ...    57   2e-07
NDAI0I03020 Chr9 complement(713821..715650) [1830 bp, 609 aa] {O...    56   2e-07
KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.42...    56   2e-07
ZYRO0D17710g Chr4 complement(1466189..1470649) [4461 bp, 1486 aa...    56   3e-07
AFR232C Chr6 complement(859612..861435) [1824 bp, 607 aa] {ON} S...    56   3e-07
CAGL0I08019g Chr9 complement(783133..786990) [3858 bp, 1285 aa] ...    56   3e-07
KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON}            56   3e-07
KLTH0H12760g Chr8 complement(1083450..1086512) [3063 bp, 1020 aa...    56   4e-07
KNAG0C04500 Chr3 complement(882896..887563) [4668 bp, 1555 aa] {...    56   4e-07
KAFR0E03480 Chr5 complement(701160..705818) [4659 bp, 1552 aa] {...    56   4e-07
YNR070W Chr14 (765375..769376) [4002 bp, 1333 aa] {ON}  PDR18Put...    55   5e-07
KAFR0E03440 Chr5 complement(684043..688692) [4650 bp, 1549 aa] {...    55   5e-07
NCAS0F00790 Chr6 complement(158502..162704) [4203 bp, 1400 aa] {...    55   5e-07
TDEL0D06020 Chr4 complement(1087102..1088934) [1833 bp, 610 aa] ...    55   6e-07
Kpol_1035.32 s1035 (76084..76926) [843 bp, 280 aa] {ON} (76084.....    54   6e-07
Kpol_1053.48 s1053 complement(92949..93236,93239..96817) [3867 b...    55   6e-07
SAKL0C08074g Chr3 complement(747926..751699) [3774 bp, 1257 aa] ...    55   7e-07
TPHA0A05890 Chr1 complement(1334117..1335949) [1833 bp, 610 aa] ...    55   7e-07
TPHA0O01000 Chr15 (185595..188630) [3036 bp, 1011 aa] {ON} Anc_1...    54   9e-07
SAKL0D09394g Chr4 complement(780019..783102) [3084 bp, 1027 aa] ...    54   9e-07
KNAG0L00680 Chr12 complement(105318..109460) [4143 bp, 1380 aa] ...    54   1e-06
TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {O...    54   1e-06
Kwal_27.9666 s27 complement(9636..14060) [4425 bp, 1474 aa] {ON}...    54   1e-06
AER190W Chr5 (994534..997569) [3036 bp, 1011 aa] {ON} Syntenic h...    54   1e-06
CAGL0L07744g Chr12 (851958..855125) [3168 bp, 1055 aa] {ON} simi...    54   1e-06
TPHA0A00840 Chr1 complement(163812..167750) [3939 bp, 1312 aa] {...    54   1e-06
NCAS0F00410 Chr6 (70678..75273) [4596 bp, 1531 aa] {ON}                54   1e-06
Suva_8.204 Chr8 (368920..373455) [4536 bp, 1511 aa] {ON} YOR153W...    54   1e-06
Skud_15.495 Chr15 (871539..876233) [4695 bp, 1564 aa] {ON} YOR32...    54   2e-06
CAGL0M01760g Chr13 (203616..208115) [4500 bp, 1499 aa] {ON} high...    54   2e-06
KLLA0A01452g Chr1 (130078..131901) [1824 bp, 607 aa] {ON} highly...    53   2e-06
Ecym_2737 Chr2 (1425670..1428726) [3057 bp, 1018 aa] {ON} simila...    54   2e-06
NDAI0C01220 Chr3 (246762..251291) [4530 bp, 1509 aa] {ON} Anc_5....    54   2e-06
Kwal_23.5161 s23 (1040608..1045077) [4470 bp, 1489 aa] {ON} YDR0...    54   2e-06
YOR153W Chr15 (619840..624375) [4536 bp, 1511 aa] {ON}  PDR5Plas...    53   2e-06
Skud_14.404 Chr14 (733442..737716) [4275 bp, 1424 aa] {ON} YNR07...    53   2e-06
Skud_15.78 Chr15 complement(148836..152720) [3885 bp, 1294 aa] {...    53   2e-06
KLTH0G01452g Chr7 (105741..107564) [1824 bp, 607 aa] {ON} highly...    53   2e-06
Ecym_3232 Chr3 complement(431386..433830) [2445 bp, 814 aa] {ON}...    53   3e-06
Smik_3.97 Chr3 complement(133624..136773) [3150 bp, 1049 aa] {ON...    53   3e-06
Skud_15.317 Chr15 (568579..573117) [4539 bp, 1512 aa] {ON} YOR15...    53   3e-06
NDAI0G05020 Chr7 (1217458..1220751) [3294 bp, 1097 aa] {ON} Anc_...    53   3e-06
KAFR0J02700 Chr10 complement(515978..517804) [1827 bp, 608 aa] {...    52   4e-06
NDAI0A04200 Chr1 complement(948224..952879) [4656 bp, 1551 aa] {...    52   4e-06
Suva_8.379 Chr8 (672487..677184) [4698 bp, 1565 aa] {ON} YPL058C...    52   4e-06
Kwal_27.12711 s27 (1342807..1346547) [3741 bp, 1246 aa] {ON} YOL...    52   4e-06
SAKL0C06996g Chr3 complement(649424..654061) [4638 bp, 1545 aa] ...    52   5e-06
KAFR0F01460 Chr6 (284981..288154) [3174 bp, 1057 aa] {ON} Anc_1....    52   5e-06
KLLA0F21692g Chr6 complement(2014152..2018729) [4578 bp, 1525 aa...    52   6e-06
Smik_14.399 Chr14 (709641..713906) [4266 bp, 1421 aa] {ON} YNR07...    52   6e-06
TBLA0A02440 Chr1 complement(582029..586894) [4866 bp, 1621 aa] {...    52   7e-06
Smik_15.185 Chr15 (316883..321064) [4182 bp, 1393 aa] {ON} YNR07...    52   8e-06
KLTH0E15796g Chr5 (1400194..1403937) [3744 bp, 1247 aa] {ON} sim...    51   9e-06
YCR011C Chr3 complement(133724..136873) [3150 bp, 1049 aa] {ON} ...    51   9e-06
NDAI0B02870 Chr2 complement(726822..730625) [3804 bp, 1267 aa] {...    51   9e-06
TBLA0F01040 Chr6 (252002..255817) [3816 bp, 1271 aa] {ON} Anc_3....    51   1e-05
Smik_15.508 Chr15 (881347..886047) [4701 bp, 1566 aa] {ON} YOR32...    51   1e-05
YIL013C Chr9 complement(328207..332442) [4236 bp, 1411 aa] {ON} ...    51   1e-05
ABR126W Chr2 (628624..633162) [4539 bp, 1512 aa] {ON} Non-synten...    50   1e-05
NDAI0H01280 Chr8 complement(308593..312771) [4179 bp, 1392 aa] {...    50   2e-05
Smik_9.181 Chr9 complement(302896..307125) [4230 bp, 1409 aa] {O...    50   2e-05
Suva_3.37 Chr3 complement(47453..50614) [3162 bp, 1053 aa] {ON} ...    50   2e-05
KNAG0G01040 Chr7 (221426..225631) [4206 bp, 1401 aa] {ON}  YIL013C     50   2e-05
YFL028C Chr6 complement(79344..80213) [870 bp, 289 aa] {ON}  CAF...    49   2e-05
SAKL0C11704g Chr3 (1050447..1054979) [4533 bp, 1510 aa] {ON} sim...    50   2e-05
NCAS0H02420 Chr8 (477754..482316) [4563 bp, 1520 aa] {ON} Anc_5....    50   2e-05
Kpol_1050.26 s1050 complement(62452..64284) [1833 bp, 610 aa] {O...    50   2e-05
KLTH0G19448g Chr7 (1676895..1681355) [4461 bp, 1486 aa] {ON} sim...    50   3e-05
Kpol_1050.16 s1050 complement(38346..41489) [3144 bp, 1047 aa] {...    50   3e-05
TDEL0D02370 Chr4 (460691..462952) [2262 bp, 753 aa] {ON} Anc_1.3...    49   3e-05
KNAG0A02100 Chr1 complement(177773..182290) [4518 bp, 1505 aa] {...    49   3e-05
Skud_6.42 Chr6 complement(82602..83471) [870 bp, 289 aa] {ON} YF...    48   4e-05
Kwal_23.4045 s23 complement(543590..545875) [2286 bp, 761 aa] {O...    49   4e-05
CAGL0F02717g Chr6 (261361..265989) [4629 bp, 1542 aa] {ON}             49   4e-05
Kwal_33.15623 s33 (1193685..1195373) [1689 bp, 562 aa] {ON} YFR0...    49   5e-05
Skud_15.174 Chr15 (310212..314393) [4182 bp, 1393 aa] {ON} YALI0...    49   5e-05
SAKL0B01518g Chr2 complement(148745..149542) [798 bp, 265 aa] {O...    47   7e-05
Suva_9.192 Chr9 complement(316679..320920) [4242 bp, 1413 aa] {O...    49   7e-05
CAGL0F01419g Chr6 complement(142623..146819) [4197 bp, 1398 aa] ...    48   8e-05
SAKL0G08008g Chr7 complement(673391..678040) [4650 bp, 1549 aa] ...    48   9e-05
Suva_7.3 Chr7 complement(6379..10671) [4293 bp, 1430 aa] {ON} YN...    48   9e-05
TBLA0H03470 Chr8 (847762..852312) [4551 bp, 1516 aa] {ON} Anc_8....    48   1e-04
KLLA0C04477g Chr3 complement(409543..413304) [3762 bp, 1253 aa] ...    48   1e-04
NDAI0G03160 Chr7 complement(744284..745141) [858 bp, 285 aa] {ON...    47   1e-04
TDEL0C00680 Chr3 complement(110674..111519) [846 bp, 281 aa] {ON...    47   1e-04
NCAS0C03820 Chr3 complement(774039..774923) [885 bp, 294 aa] {ON...    47   1e-04
KLLA0D03476g Chr4 (296287..300969) [4683 bp, 1560 aa] {ON} simil...    47   1e-04
NDAI0G01840 Chr7 complement(404289..408797) [4509 bp, 1502 aa] {...    47   1e-04
Smik_6.50 Chr6 complement(94583..95452) [870 bp, 289 aa] {ON} YF...    46   1e-04
TBLA0A08720 Chr1 complement(2139184..2140668) [1485 bp, 494 aa] ...    47   1e-04
KAFR0C02740 Chr3 complement(537867..539465) [1599 bp, 532 aa] {O...    47   1e-04
KNAG0B00460 Chr2 (76565..78547) [1983 bp, 660 aa] {ON} Anc_3.534...    47   2e-04
Skud_3.76 Chr3 complement(116029..119199) [3171 bp, 1056 aa] {ON...    47   2e-04
Suva_6.30 Chr6 complement(52879..53748) [870 bp, 289 aa] {ON} YF...    46   2e-04
AER091W Chr5 (809767..812172) [2406 bp, 801 aa] {ON} Syntenic ho...    47   2e-04
YDR061W Chr4 (574164..575783) [1620 bp, 539 aa] {ON} Protein wit...    46   2e-04
KNAG0F01740 Chr6 (326444..329950) [3507 bp, 1168 aa] {ON} Anc_6....    47   3e-04
NCAS0I00670 Chr9 (111140..115240) [4101 bp, 1366 aa] {ON}              47   3e-04
Suva_15.188 Chr15 (324904..329088) [4185 bp, 1394 aa] {ON} YOR01...    47   3e-04
CAGL0I04862g Chr9 complement(438338..442861) [4524 bp, 1507 aa] ...    46   3e-04
KAFR0A01180 Chr1 (225692..230218) [4527 bp, 1508 aa] {ON} Anc_8....    46   3e-04
KLTH0D15246g Chr4 (1257193..1259589) [2397 bp, 798 aa] {ON} simi...    46   4e-04
TBLA0G02050 Chr7 complement(537114..540098) [2985 bp, 994 aa] {O...    46   5e-04
Suva_10.346 Chr10 (604006..607140) [3135 bp, 1044 aa] {ON} YLR24...    46   5e-04
KLLA0B02563g Chr2 complement(222951..225377) [2427 bp, 808 aa] {...    45   5e-04
TPHA0L01500 Chr12 (311715..316274) [4560 bp, 1519 aa] {ON} Anc_8...    46   5e-04
NCAS0C02250 Chr3 complement(418244..422770) [4527 bp, 1508 aa] {...    45   5e-04
Kwal_14.1242 s14 (250275..251084) [810 bp, 269 aa] {ON} YFL028C ...    44   5e-04
Ecym_1500 Chr1 (1027467..1028318) [852 bp, 283 aa] {ON} similar ...    44   6e-04
KNAG0I01340 Chr9 complement(258887..262024) [3138 bp, 1045 aa] {...    45   6e-04
NCAS0B04350 Chr2 complement(786960..788561) [1602 bp, 533 aa] {O...    45   6e-04
SAKL0H10670g Chr8 complement(918091..922620) [4530 bp, 1509 aa] ...    45   7e-04
SAKL0C05654g Chr3 complement(532258..536787) [4530 bp, 1509 aa] ...    45   7e-04
Kpol_1002.29 s1002 (89520..93068) [3549 bp, 1182 aa] {ON} (89520...    45   7e-04
Skud_9.159 Chr9 complement(298165..302388) [4224 bp, 1407 aa] {O...    45   8e-04
YNL014W Chr14 (606319..609453) [3135 bp, 1044 aa] {ON}  HEF3Tran...    45   9e-04
KLLA0F08833g Chr6 (822039..822860) [822 bp, 273 aa] {ON} similar...    44   9e-04
TDEL0E00840 Chr5 complement(172712..175192) [2481 bp, 826 aa] {O...    45   0.001
YOR011W Chr15 (349679..353863) [4185 bp, 1394 aa] {ON}  AUS1Plas...    45   0.001
Suva_16.256 Chr16 complement(448846..453387) [4542 bp, 1513 aa] ...    44   0.001
Kwal_56.24221 s56 complement(908983..912147) [3165 bp, 1054 aa] ...    44   0.001
Suva_14.333 Chr14 (585838..588972) [3135 bp, 1044 aa] {ON} YNL01...    44   0.001
Skud_16.225 Chr16 complement(410106..414641) [4536 bp, 1511 aa] ...    44   0.001
KAFR0C03470 Chr3 (707203..708039) [837 bp, 278 aa] {ON} Anc_8.42...    43   0.001
TDEL0B01210 Chr2 complement(219068..223606) [4539 bp, 1512 aa] {...    44   0.001
NDAI0E02950 Chr5 complement(620841..625379) [4539 bp, 1512 aa] {...    44   0.001
Kpol_487.13 s487 complement(50878..54012) [3135 bp, 1044 aa] {ON...    44   0.001
Skud_14.314 Chr14 (573040..576174) [3135 bp, 1044 aa] {ON} YNL01...    44   0.002
CAGL0K12474g Chr11 (1218012..1218896) [885 bp, 294 aa] {ON} simi...    43   0.002
TPHA0H01820 Chr8 complement(415382..418765) [3384 bp, 1127 aa] {...    44   0.002
Kwal_YGOB_56.24219 s56 complement(908618..909109,909112..912147)...    44   0.002
CAGL0M07293g Chr13 complement(733072..737619) [4548 bp, 1515 aa]...    44   0.002
TPHA0D00450 Chr4 complement(76541..77377) [837 bp, 278 aa] {ON} ...    43   0.002
TBLA0A05970 Chr1 (1471379..1474975) [3597 bp, 1198 aa] {ON} Anc_...    44   0.002
TPHA0H00120 Chr8 complement(11464..13092) [1629 bp, 542 aa] {ON}...    44   0.002
SAKL0G16280g Chr7 (1408229..1410607) [2379 bp, 792 aa] {ON} simi...    44   0.002
ZYRO0F03234g Chr6 complement(273742..274569) [828 bp, 275 aa] {O...    43   0.002
TBLA0D02530 Chr4 complement(629614..630444) [831 bp, 276 aa] {ON...    43   0.002
Skud_12.330 Chr12 (583354..586488) [3135 bp, 1044 aa] {ON} YLR24...    44   0.002
NCAS0D03950 Chr4 (737216..740788) [3573 bp, 1190 aa] {ON} Anc_6....    44   0.002
KLTH0H03300g Chr8 (295271..298801) [3531 bp, 1176 aa] {ON} simil...    44   0.002
CAGL0D03674g Chr4 (370066..373626) [3561 bp, 1186 aa] {ON} highl...    44   0.002
TDEL0F01870 Chr6 (348408..351950) [3543 bp, 1180 aa] {ON} Anc_6....    44   0.002
Kwal_26.6702 s26 complement(29426..31279) [1854 bp, 617 aa] {ON}...    43   0.002
NCAS0A02680 Chr1 (510902..513559) [2658 bp, 885 aa] {ON} Anc_4.287     43   0.002
Skud_16.52 Chr16 (95317..98853) [3537 bp, 1178 aa] {ON} YPL226W ...    43   0.003
Smik_6.431 Chr6 complement(699005..702574) [3570 bp, 1189 aa] {O...    43   0.003
YPL226W Chr16 (121767..125357) [3591 bp, 1196 aa] {ON}  NEW1ATP ...    43   0.003
NCAS0A08760 Chr1 complement(1729600..1732737) [3138 bp, 1045 aa]...    43   0.003
KAFR0I02110 Chr9 (433759..436896) [3138 bp, 1045 aa] {ON} Anc_1....    43   0.003
SAKL0H19294g Chr8 complement(1703651..1705213) [1563 bp, 520 aa]...    43   0.003
YLR249W Chr12 (636780..639914) [3135 bp, 1044 aa] {ON}  YEF3Gamm...    43   0.003
NDAI0G05180 Chr7 complement(1254531..1257665) [3135 bp, 1044 aa]...    43   0.003
Smik_12.322 Chr12 (581596..584730) [3135 bp, 1044 aa] {ON} YLR24...    43   0.004
TDEL0B04340 Chr2 complement(764357..766018) [1662 bp, 553 aa] {O...    42   0.004
KAFR0G03410 Chr7 (702624..705056) [2433 bp, 810 aa] {ON} Anc_4.2...    43   0.004
SAKL0A03586g Chr1 (328346..331885) [3540 bp, 1179 aa] {ON} simil...    43   0.004
TDEL0B06150 Chr2 complement(1083103..1086237) [3135 bp, 1044 aa]...    42   0.004
Smik_14.315 Chr14 (564639..567773) [3135 bp, 1044 aa] {ON} YNL01...    42   0.004
AFL131W Chr6 (186656..190225) [3570 bp, 1189 aa] {ON} Syntenic h...    42   0.004
ZYRO0F08888g Chr6 (716318..720880) [4563 bp, 1520 aa] {ON} highl...    42   0.004
KNAG0D04550 Chr4 (824870..827338) [2469 bp, 822 aa] {ON} Anc_4.2...    42   0.005
NDAI0I00960 Chr9 complement(226758..230396) [3639 bp, 1212 aa] {...    42   0.005
Kpol_1055.54 s1055 complement(131851..134565) [2715 bp, 904 aa] ...    42   0.005
Suva_16.80 Chr16 (131166..134702) [3537 bp, 1178 aa] {ON} YPL226...    42   0.005
ZYRO0E07634g Chr5 complement(593495..597025) [3531 bp, 1176 aa] ...    42   0.005
KAFR0A07090 Chr1 complement(1427525..1431157) [3633 bp, 1210 aa]...    42   0.005
CAGL0D00352g Chr4 complement(42946..45531) [2586 bp, 861 aa] {ON...    42   0.005
ZYRO0B13266g Chr2 (1074171..1076639) [2469 bp, 822 aa] {ON} simi...    42   0.006
TPHA0O00680 Chr15 (128579..131713) [3135 bp, 1044 aa] {ON} Anc_1...    42   0.006
TBLA0D04410 Chr4 complement(1093035..1096169) [3135 bp, 1044 aa]...    42   0.006
KLTH0G18326g Chr7 complement(1579374..1580183) [810 bp, 269 aa] ...    41   0.007
KLLA0F12210g Chr6 (1125630..1128764) [3135 bp, 1044 aa] {ON} hig...    42   0.007
KNAG0E03270 Chr5 complement(655376..656218) [843 bp, 280 aa] {ON...    41   0.007
NDAI0A03750 Chr1 complement(849511..851118) [1608 bp, 535 aa] {O...    42   0.007
CAGL0B03487g Chr2 complement(345399..348536) [3138 bp, 1045 aa] ...    42   0.007
TPHA0B01940 Chr2 (434881..437436) [2556 bp, 851 aa] {ON} Anc_4.2...    42   0.007
SAKL0D08316g Chr4 (695101..698235) [3135 bp, 1044 aa] {ON} highl...    42   0.008
NCAS0A06310 Chr1 complement(1243683..1246823) [3141 bp, 1046 aa]...    42   0.008
Smik_16.179 Chr16 complement(321239..325774) [4536 bp, 1511 aa] ...    42   0.008
KLLA0B09702g Chr2 complement(842245..846801) [4557 bp, 1518 aa] ...    42   0.008
KLLA0C16115g Chr3 (1405766..1409317) [3552 bp, 1183 aa] {ON} sim...    42   0.008
YPL058C Chr16 complement(445842..450377) [4536 bp, 1511 aa] {ON}...    42   0.008
ZYRO0F08866g Chr6 (709888..714450) [4563 bp, 1520 aa] {ON} highl...    42   0.008
Ecym_1312 Chr1 complement(630006..633140) [3135 bp, 1044 aa] {ON...    41   0.009
ZYRO0E05148g Chr5 complement(387268..390405) [3138 bp, 1045 aa] ...    41   0.010
AAL028W Chr1 (291808..294942) [3135 bp, 1044 aa] {ON} Syntenic h...    41   0.011
Kwal_0.167 s0 (88989..92123) [3135 bp, 1044 aa] {ON} YNL014W (HE...    41   0.011
KLTH0H11902g Chr8 (1017096..1020230) [3135 bp, 1044 aa] {ON} hig...    41   0.011
Ecym_2164 Chr2 (314802..318317) [3516 bp, 1171 aa] {ON} similar ...    41   0.011
KAFR0H03200 Chr8 complement(610545..613694) [3150 bp, 1049 aa] {...    41   0.012
NDAI0D04610 Chr4 (1084921..1087599) [2679 bp, 892 aa] {ON} Anc_4...    41   0.013
Skud_11.38 Chr11 complement(72504..75071) [2568 bp, 855 aa] {ON}...    41   0.014
NDAI0G00810 Chr7 (169366..172515) [3150 bp, 1049 aa] {ON} Anc_1....    41   0.016
Kpol_1048.72 s1048 complement(202581..205715) [3135 bp, 1044 aa]...    40   0.017
Suva_11.36 Chr11 complement(70977..73538) [2562 bp, 853 aa] {ON}...    40   0.018
Smik_11.42 Chr11 complement(71610..74165) [2556 bp, 851 aa] {ON}...    40   0.019
YKL188C Chr11 complement(86225..88786) [2562 bp, 853 aa] {ON}  P...    40   0.025
Kpol_1002.105 s1002 complement(266533..268176) [1644 bp, 547 aa]...    39   0.033
Suva_2.220 Chr2 (374470..376092) [1623 bp, 540 aa] {ON} YDR061W ...    39   0.037
KNAG0D02010 Chr4 complement(335815..337413) [1599 bp, 532 aa] {O...    39   0.037
CAGL0G08041g Chr7 complement(758811..760634) [1824 bp, 607 aa] {...    39   0.041
Smik_4.299 Chr4 (540966..542588) [1623 bp, 540 aa] {ON} YDR061W ...    39   0.047
YDR091C Chr4 complement(626708..628534) [1827 bp, 608 aa] {ON}  ...    39   0.050
Skud_4.316 Chr4 (550218..551840) [1623 bp, 540 aa] {ON} YDR061W ...    39   0.051
CAGL0G05093g Chr7 complement(483230..484864) [1635 bp, 544 aa] {...    39   0.056
Skud_4.351 Chr4 complement(602770..604596) [1827 bp, 608 aa] {ON...    39   0.056
ZYRO0G09130g Chr7 (732487..734034) [1548 bp, 515 aa] {ON} simila...    38   0.080
NCAS0E01650 Chr5 complement(319448..323914) [4467 bp, 1488 aa] {...    39   0.085
Smik_4.334 Chr4 complement(592554..594380) [1827 bp, 608 aa] {ON...    38   0.10 
AGR125W Chr7 (987077..988900) [1824 bp, 607 aa] {ON} Syntenic ho...    38   0.11 
KLLA0C17556g Chr3 complement(1544404..1546227) [1824 bp, 607 aa]...    38   0.12 
KLTH0H07942g Chr8 complement(696683..698269) [1587 bp, 528 aa] {...    37   0.12 
Kwal_56.23429 s56 complement(532382..533998) [1617 bp, 539 aa] {...    37   0.15 
TDEL0A01370 Chr1 (248469..250292) [1824 bp, 607 aa] {ON} Anc_8.2...    37   0.17 
Kwal_YGOB_56.23429 s56 complement(532059..532313,532316..533998)...    37   0.20 
Smik_5.344 Chr5 complement(529147..535632) [6486 bp, 2161 aa] {O...    36   0.35 
Ecym_5557 Chr5 (1126965..1128539) [1575 bp, 524 aa] {ON} similar...    36   0.36 
NCAS0B02520 Chr2 (422176..422730) [555 bp, 184 aa] {ON} Anc_8.47...    35   0.41 
NCAS0C04970 Chr3 complement(1015038..1016066) [1029 bp, 342 aa] ...    35   0.64 
ZYRO0B11616g Chr2 complement(910480..912303) [1824 bp, 607 aa] {...    35   0.65 
Skud_5.311 Chr5 complement(514651..521130) [6480 bp, 2159 aa] {O...    35   0.67 
SAKL0H17996g Chr8 (1607260..1609323) [2064 bp, 687 aa] {ON} high...    35   0.68 
KNAG0H02970 Chr8 complement(548970..550802) [1833 bp, 610 aa] {O...    35   0.82 
KLTH0G14520g Chr7 (1276585..1278411) [1827 bp, 608 aa] {ON} high...    35   0.88 
Ecym_5560 Chr5 complement(1134384..1136207) [1824 bp, 607 aa] {O...    35   0.94 
KLLA0D02156g Chr4 complement(184520..186085) [1566 bp, 521 aa] {...    34   1.3  
Suva_2.252 Chr2 complement(426492..428318) [1827 bp, 608 aa] {ON...    34   1.6  
KLTH0E13354g Chr5 complement(1189037..1190428) [1392 bp, 463 aa]...    33   2.0  
KAFR0A02430 Chr1 (508632..510455) [1824 bp, 607 aa] {ON} Anc_8.2...    33   2.1  
ADR196W Chr4 (1043225..1044346) [1122 bp, 373 aa] {ON} Syntenic ...    33   2.3  
NCAS0B04030 Chr2 (730062..731888) [1827 bp, 608 aa] {ON} Anc_8.2...    33   2.5  
TBLA0F03760 Chr6 complement(924333..926159) [1827 bp, 608 aa] {O...    33   2.7  
KLLA0E11595g Chr5 complement(1018972..1024518) [5547 bp, 1848 aa...    33   3.2  
YBR227C Chr2 complement(673572..675134) [1563 bp, 520 aa] {ON}  ...    33   4.2  
TPHA0A01980 Chr1 (400671..402494) [1824 bp, 607 aa] {ON} Anc_8.2...    32   4.8  
AFR152C Chr6 complement(710014..710826) [813 bp, 270 aa] {ON} Sy...    32   5.1  
Smik_2.369 Chr2 complement(659801..661306) [1506 bp, 501 aa] {ON...    32   6.4  
Ecym_1222 Chr1 complement(458018..462082) [4065 bp, 1354 aa] {ON...    32   6.5  
Skud_2.358 Chr2 complement(642328..643905) [1578 bp, 525 aa] {ON...    32   6.8  
Kwal_14.2052 s14 complement(589149..590720) [1572 bp, 523 aa] {O...    32   8.9  

>TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5
           YPL270W
          Length = 739

 Score = 1407 bits (3642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 702/739 (94%), Positives = 702/739 (94%)

Query: 1   MGLIIGRTGSLLMGPSPSIARSVILRRFTPLVRRLPIVQPSVRSVISKRCQLSPLSQIQF 60
           MGLIIGRTGSLLMGPSPSIARSVILRRFTPLVRRLPIVQPSVRSVISKRCQLSPLSQIQF
Sbjct: 1   MGLIIGRTGSLLMGPSPSIARSVILRRFTPLVRRLPIVQPSVRSVISKRCQLSPLSQIQF 60

Query: 61  QTTRPLTRSFTSSVRLLQAKSPKEAEQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCG 120
           QTTRPLTRSFTSSVRLLQAKSPKEAEQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCG
Sbjct: 61  QTTRPLTRSFTSSVRLLQAKSPKEAEQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCG 120

Query: 121 IGMTIPKVIGMILDVLKTGLETNEGKDGPISMADVPPIFMGYSIYEFLGGFAALMVFGIV 180
           IGMTIPKVIGMILDVLKTGLETNEGKDGPISMADVPPIFMGYSIYEFLGGFAALMVFGIV
Sbjct: 121 IGMTIPKVIGMILDVLKTGLETNEGKDGPISMADVPPIFMGYSIYEFLGGFAALMVFGIV 180

Query: 181 ANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMT 240
           ANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMT
Sbjct: 181 ANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMT 240

Query: 241 QKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEAT 300
           QKVSDGFKALIC         SISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEAT
Sbjct: 241 QKVSDGFKALICGGVGVGMMVSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEAT 300

Query: 301 GQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGD 360
           GQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGD
Sbjct: 301 GQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGD 360

Query: 361 ISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFE 420
           ISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFE
Sbjct: 361 ISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFE 420

Query: 421 LTDRVPSIKPTTGKKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPS 480
           LTDRVPSIKPTTGKKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPS
Sbjct: 421 LTDRVPSIKPTTGKKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPS 480

Query: 481 GRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNIT 540
           GRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNIT
Sbjct: 481 GRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNIT 540

Query: 541 YGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKK 600
           YGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKK
Sbjct: 541 YGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKK 600

Query: 601 PTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGS 660
           PTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGS
Sbjct: 601 PTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGS 660

Query: 661 VVETGKFKELFADPXXXXXXXXXXXXXXXXXXXXXXXXXXXXQPEDEANQKNAPEEAHDD 720
           VVETGKFKELFADP                            QPEDEANQKNAPEEAHDD
Sbjct: 661 VVETGKFKELFADPSSELSKLLNEKSSRSENSSSSYSPNASEQPEDEANQKNAPEEAHDD 720

Query: 721 SVEEILKDVTAEGKPIKIS 739
           SVEEILKDVTAEGKPIKIS
Sbjct: 721 SVEEILKDVTAEGKPIKIS 739

>ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 732

 Score =  947 bits (2449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/744 (65%), Positives = 579/744 (77%), Gaps = 32/744 (4%)

Query: 12  LMGPSPSIARSVILRRFTPL--VRRLPIVQP-----SVRSVISKRCQLSPLSQIQFQTTR 64
           L+ P P I R +   +  PL  +R L IV+P     S+R  +    QLSP SQ   +  R
Sbjct: 4   LLRPVPRILRPLSKSQLRPLSYIRPLNIVRPQISLISIRIGVRWNSQLSP-SQ---EENR 59

Query: 65  PLTRSFTSSVRLLQAKSPKEAEQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMT 124
           P         ++L+    KE    S  KD VRL  LAK DW+LL  AI LLT+SC IGM+
Sbjct: 60  P-----KPVKQILEPIQKKE----SSYKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMS 110

Query: 125 IPKVIGMILDVLKTGLETNEGKD-GPISMADVPPIFMGYSIYEFLGGFAALMVFGIVANY 183
           IPKVIG++LDVL+ G+E   GKD   ++M D+ PI  G +IY+FLG FA L++ G  AN+
Sbjct: 111 IPKVIGLVLDVLRKGIE---GKDLQNVNMDDLGPIAFGLTIYQFLGVFAGLLLVGTAANF 167

Query: 184 GRIVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKV 243
            RIV+LRILSERVVARLR+ V+ KT+HQDSEF+D HKVGDLISRLGSDAYVVSRSMTQKV
Sbjct: 168 ARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKV 227

Query: 244 SDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQL 303
           SDGFKALIC         SISP+LSG+LL F PP+L+SAS+FG+KIR TS DLQEATGQL
Sbjct: 228 SDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQL 287

Query: 304 TRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISF 363
           TRV+EEQLSGV+TVQSFVAEQ+E+HRY+ AIR I+NVG++AA+INA+FFT+T+ LGD+SF
Sbjct: 288 TRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSF 347

Query: 364 LVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTD 423
           +VVL YGSYLVLQG LTIGDLTAFMLYTEYTGSSVFGLT+FYSELMQGVGAA+RLF+LTD
Sbjct: 348 IVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTD 407

Query: 424 RVPSIKPTTGKKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRG 483
            + SI PT G+K++PGKG+I FK+V+FSYPTRP N IF+D++IK+P GSNVC+VGPSGRG
Sbjct: 408 HISSISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRG 467

Query: 484 KSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGL 543
           KSTIALLLLR+YNP++GQI +DGQDISK+N K+LRRHIGLVQQEP+LMSGT+RDNITYGL
Sbjct: 468 KSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGL 527

Query: 544 TETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTI 603
            E  +KEEIR VAKQCFCHNFI KFP GYDT+IG QGALLSGGQ+QRIAIARALIKKP I
Sbjct: 528 AEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNI 587

Query: 604 LVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVE 663
           LVLDEATSALDVESEGAINYTFGQLMKS S+TIVSIAHRLSTI+RSEN+IVLG DGSV+E
Sbjct: 588 LVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIE 647

Query: 664 TGKFKELFADPXXXXXXXXXXXXXXXXXXXXXXXXXXXXQPEDEANQ------KNAPE-- 715
            GKFKELFA+P                              +    Q      +  PE  
Sbjct: 648 AGKFKELFANPNSELCKLLTEKSSRSDGNDSLPPPPPNATQDKVVEQIAEKILERFPEAG 707

Query: 716 EAHDDSVEEILKDVTAEGKPIKIS 739
           ++ D +V+EI KDV++EGKPIKI+
Sbjct: 708 QSPDATVKEIFKDVSSEGKPIKIT 731

>CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 801

 Score =  917 bits (2370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/589 (73%), Positives = 507/589 (86%)

Query: 86  EQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGLETNEG 145
           E  S  +D+VRL++L + DWKLL+ A+ LLT+SC IGMTIPKVIG+ILD LK  L  N  
Sbjct: 112 ENHSEFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSV 171

Query: 146 KDGPISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRANVI 205
              P+S+  +PPI  G S YEFLGGFA  ++ GI ANYGRI+LLR+LSER+VARLRA VI
Sbjct: 172 DGQPVSIDKLPPIVFGLSFYEFLGGFALALLVGIAANYGRIILLRVLSERLVARLRATVI 231

Query: 206 KKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISP 265
           KKTIHQD+EFFD HKVGDLISRLGSDAYVVSRSMTQKVSDGFKALIC         ++SP
Sbjct: 232 KKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMLALSP 291

Query: 266 QLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQK 325
           QLS LLL+FTPPV+ SAS+FG++I  TS +LQEATG LT+V+EEQLSG++TVQSFVAEQ+
Sbjct: 292 QLSCLLLVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQR 351

Query: 326 EIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLT 385
           EI+RY+ AIRDIFN+GK+AA INA+FF++TS++GD+SFL VL +GSYLVLQ  LTIGDLT
Sbjct: 352 EINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLT 411

Query: 386 AFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGKGEIVF 445
           AFM+YTEYTG+S+FGL++FYSE+MQG GAA+RLFELTDRVPSI  T G K+ PG GEI F
Sbjct: 412 AFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGEIEF 471

Query: 446 KDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFID 505
           K+V+F+YPTRP N+IF++++ KI AGSNVC+VGPSGRGKST+ALLL ++Y PSSG+I ID
Sbjct: 472 KNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILID 531

Query: 506 GQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFI 565
           GQ+I+ LN KSLRRHIGLVQQEP+LMSGT+RDNI YGLTE P+K+EIR VAKQCFCHNFI
Sbjct: 532 GQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFI 591

Query: 566 VKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTF 625
            +F   YDTVIGP G LLSGGQKQRIAIARALIKKP IL+LDEATSALDVESEGAINYTF
Sbjct: 592 TRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTF 651

Query: 626 GQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADP 674
           GQLMK K +TIVSIAHRLSTIRRSEN+IVLG+DGSVVE GKFKEL+ DP
Sbjct: 652 GQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDP 700

>NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {ON}
           Anc_6.5
          Length = 832

 Score =  901 bits (2329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/702 (63%), Positives = 535/702 (76%), Gaps = 29/702 (4%)

Query: 62  TTRPLTRSFTSSVRLLQAKSPKEAEQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGI 121
           T  P T S  S+    +    +  + +S  KDV RL +L K D+KLL++++TLLT+SC I
Sbjct: 131 TIPPHTESTESTKASTEPNEIEPDQGESNFKDVFRLFLLVKKDYKLLIVSLTLLTISCTI 190

Query: 122 GMTIPKVIGMILDVLKTGLETNEGKDGPISMADVPPIFMGYSIYEFLGGFAALMVFGIVA 181
           GM IPK+IG+ILD LK+   T +G   P      P I  G ++YEFLGGF+  +  G  A
Sbjct: 191 GMMIPKIIGLILDALKSVATTPDGGSSP-----PPTIMFGLTLYEFLGGFSVALFIGCAA 245

Query: 182 NYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQ 241
           NYGR++LLRILSER+VARLR+ V+K T+HQDSEFFD HKVGDLISRLG+D+Y+VSRS+TQ
Sbjct: 246 NYGRLILLRILSERLVARLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQ 305

Query: 242 KVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATG 301
           K+SDG K+LIC          +S  LS +L+ F  PV+ SASIFG++IR  S +LQ+ATG
Sbjct: 306 KISDGVKSLICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATG 365

Query: 302 QLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDI 361
           QLTRVSEEQL+GVRTVQSFVAEQ+EI R++H+IR+IF+VGKRAA+INA+FFT+TS +GD+
Sbjct: 366 QLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDL 425

Query: 362 SFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFEL 421
           SFL VL YGSYLVL G LTIGDLTAFMLYTEYTG+++FGL++FYSE+MQG GAA+RLFEL
Sbjct: 426 SFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFEL 485

Query: 422 TDRVPSIKPTTGKKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSG 481
           TDRVP+I+PT GK + PGKGEI FK+V+F+YPTRP N IF+ ++ KI  GSNVC+VGPSG
Sbjct: 486 TDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSG 545

Query: 482 RGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITY 541
           +GKSTIALLLL +YNP+SGQI IDGQDI+KLN KSLRR I +VQQEPVLMSGT+RDNITY
Sbjct: 546 KGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITY 605

Query: 542 GLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKP 601
           GLTE P+KEEIR VAKQCFCHNFIVKFP+ YDT IGP G LLSGGQKQRIAIARALIKKP
Sbjct: 606 GLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKP 665

Query: 602 TILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSV 661
            IL+LDEATSALDVESEGAINYTFGQLMKSKS+TIVSIAHRLSTIRRSENIIVLGNDGSV
Sbjct: 666 NILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSV 725

Query: 662 VETGKFKELFADPXXXXXXXXXXXXXXXXXXXXXXXXXXXXQ----------------PE 705
           VE GKFKELFADP                                              E
Sbjct: 726 VEMGKFKELFADPTSELSKLLNEKSSRKKVVTKTVPPVSSTSVSSANGSSIHHEGTILEE 785

Query: 706 DEANQKNAPE--------EAHDDSVEEILKDVTAEGKPIKIS 739
           D A + +  E        +  +DS+E +L DV+AE KPIK+S
Sbjct: 786 DHAQEDHESEAPPTIITTQQLEDSIESVLNDVSAESKPIKLS 827

>Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON}
           (193072..195318) [2247 nt, 749 aa]
          Length = 748

 Score =  897 bits (2317), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/658 (65%), Positives = 524/658 (79%), Gaps = 12/658 (1%)

Query: 85  AEQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGLETNE 144
           +  K  L D+ RL  LAK DWKLL+ AI+LL+VSC IGM++PK+IG++LD LK  +   +
Sbjct: 93  SNDKFELSDLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSNPD 152

Query: 145 GKDGPISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRANV 204
                 ++ DVP I  G ++YEF+      ++ G  ANYGR++LLR+LSERVVARLRANV
Sbjct: 153 -----FTVDDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANV 207

Query: 205 IKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSIS 264
           IKKT+HQD+EFFD +KVGDLISRL SDAYVVSRS+TQKVSDGFKA++C         SIS
Sbjct: 208 IKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISIS 267

Query: 265 PQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQ 324
           PQLS  LL  TPPV+ SAS FGR IR+ S DLQEATG LT+V+EEQ SG++TVQSFVAEQ
Sbjct: 268 PQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQ 327

Query: 325 KEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDL 384
           KEI RY+HAIR IFNVGK++A+INA+FF+ T+ LGD+SFLVVLAYGSYLVL G L+IGDL
Sbjct: 328 KEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDL 387

Query: 385 TAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGKGEIV 444
           TA+M+YTEYTGSS+FGL++FYSE+MQG GAA+RLFELTDR+PSI PT GKKFVP KGEI 
Sbjct: 388 TAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVPNKGEIE 447

Query: 445 FKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFI 504
           FK+V+FSYPTR  N IF+++  KI AGSNVC+VGPSGRGKSTIA LLLR+YNP++GQIF+
Sbjct: 448 FKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFV 507

Query: 505 DGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNF 564
           DGQDISK++ KSLRRH+ +VQQEPVLMSGT+RDNITYGL E P+++E+R + K+CFCHNF
Sbjct: 508 DGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNF 567

Query: 565 IVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYT 624
           I KFP+ YDT++GP G LLSGGQKQRIAIARALIKKPTIL+LDEATSALDVESEGAINYT
Sbjct: 568 ITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYT 627

Query: 625 FGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADPXXXXXXXXXX 684
           FG+LMKSKS+TI+SIAHRLSTIRRSEN+IVLGNDGSV E GKFKEL+ADP          
Sbjct: 628 FGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADP-GSELSKLLH 686

Query: 685 XXXXXXXXXXXXXXXXXXQPEDEANQKNA-PE-----EAHDDSVEEILKDVTAEGKPI 736
                              PE+  N +N+ PE     E  ++ ++E + DV A+ KPI
Sbjct: 687 EKATRSERQQNTAEDQEIDPEETINIENSTPESDITQELLENPIKEAIMDVAADNKPI 744

>TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON}
           Anc_6.5 YPL270W
          Length = 740

 Score =  888 bits (2294), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/724 (62%), Positives = 544/724 (75%), Gaps = 26/724 (3%)

Query: 12  LMGPSPSIARSVILRRFTPLVRRLPIVQPSVRSVISKRCQLSPLSQIQFQTTRPLTRSFT 71
           L+GP   I R   ++ +  L R+L     S R++  K       ++++   T    R  +
Sbjct: 10  LLGPWTKIQRPSTMQGWM-LTRKL-----SFRAITIKP------NEVKIACTITTKRWSS 57

Query: 72  SSVRLLQAKSPKEAEQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGM 131
           S     Q + PK    ++   D+ RLL LAK DWKLL IA+ LLTVSC IGM++PKVIGM
Sbjct: 58  SKTTAPQVRVPK---SRNDGNDIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGM 114

Query: 132 ILDVLKTGLETNE-----GKDGPISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRI 186
           +LD+LK  +  +E       D  I  +++PPI  G S+YEFLG   A ++ G  AN+GR+
Sbjct: 115 VLDLLKNAISKSEDAELGSADLSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGRV 174

Query: 187 VLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDG 246
           VLLR+LSERVVARLR+ VIKKTIHQD+EFFD +KVGDLISRLGSDAYVVSRSMTQKVSDG
Sbjct: 175 VLLRVLSERVVARLRSQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDG 234

Query: 247 FKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRV 306
           FKAL+C         SISP+LS  LL FTPPV+ S+  FGR IRD S  LQEATGQLTRV
Sbjct: 235 FKALLCGGVGVGMMVSISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRV 294

Query: 307 SEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVV 366
           SEEQ SGV+TVQ+FVAEQ+EI RY++ I+D++NVGK +A+INA+ FT TSSLGD+SFL+V
Sbjct: 295 SEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLV 354

Query: 367 LAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVP 426
           LAYGSYLVL GGL+IGDLTA+M+YTE TGS+VFGL+SFYSE+MQGVGAA+RLFELTDR+P
Sbjct: 355 LAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIP 414

Query: 427 SIKPTTGKKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKST 486
            I PTTGKK++PGKGEI FK+V+F+YPTRPG+ IF+ ++ KI  GSNVC+VGPSGRGKST
Sbjct: 415 MISPTTGKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKST 474

Query: 487 IALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTET 546
           IA LLL++Y P++G I +DGQDISKLN KSLRRHIG+VQQEP+LMSG++RDNITYGLT  
Sbjct: 475 IASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYE 534

Query: 547 PSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVL 606
            + EEIR V KQCFCHNFI KFP  Y T++GP G LLSGGQKQRIAIARAL+KKP +L+L
Sbjct: 535 ATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLIL 594

Query: 607 DEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGK 666
           DEATSALDVESE AINYTFG+LMK K VTI+SIAHRLSTIRRSE +IVLGNDGSVVE GK
Sbjct: 595 DEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGK 654

Query: 667 FKELFADPXXXXXXXXXXXXXXXXXXXXXXXXXXXXQPEDEANQKNAPEEAHDDSV--EE 724
           FK LF +P                             PE E+ QKNA  E+  D V  EE
Sbjct: 655 FKTLFGNPLSELSQLLNEKSTINERNPNEKPAET---PEQES-QKNAANESIVDVVLEEE 710

Query: 725 ILKD 728
           IL++
Sbjct: 711 ILQN 714

>Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W
           (REAL)
          Length = 767

 Score =  884 bits (2284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/688 (66%), Positives = 526/688 (76%), Gaps = 35/688 (5%)

Query: 78  QAKSPKEAEQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLK 137
           Q   P    +    KD++RL MLAK DWKLL+ AI LLT+SC IGM+IPKVIG++LD LK
Sbjct: 86  QPAKPAYQSKSDDYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLK 145

Query: 138 TGLETNEGKDGPISMADVP-PIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERV 196
           T    + G D      D+  PIF    +YEFL  F   ++ G VAN+GR +LLRILSERV
Sbjct: 146 T----SSGSD----FFDLKIPIF-SLPLYEFLSFFTVALLIGCVANFGRFILLRILSERV 196

Query: 197 VARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXX 256
           VARLRA+VIKKT+HQD+EFFD HKVGDLISRLGSDAYVVSRSMTQKVSDG KALIC    
Sbjct: 197 VARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVG 256

Query: 257 XXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRT 316
                S+SPQLS LLL FTPPVLFSAS+FG++IR+TS DLQEATGQLTRV+EEQLSG++T
Sbjct: 257 VGMMCSLSPQLSVLLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKT 316

Query: 317 VQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQ 376
           VQSFVAE  E+ RY+ AIRDIF VGK AA+ NA+FFT TS LGD+SFL VLAYGSYLVLQ
Sbjct: 317 VQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQ 376

Query: 377 GGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKF 436
             L+IGDLTAFMLYTEYTG++VFGL++FYSE+MQG GAA+RLFELTDR PSI PT G K+
Sbjct: 377 SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKY 436

Query: 437 VPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYN 496
            P +G I FKDV+FSYPTRP   IF+ ++ KI  GS+VC+VGPSGRGKSTIALLLLR+YN
Sbjct: 437 KPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN 496

Query: 497 PSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVA 556
           P++G I ID QDI+K+N KSLRRHIG+VQQEPVLMSGT+RDNITYGLT TP+KEEIR VA
Sbjct: 497 PTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA 556

Query: 557 KQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVE 616
           KQCFCHNFI KFP+ YDTVIGP G LLSGGQKQRIAIARALIKKPT+L+LDEATSALDVE
Sbjct: 557 KQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE 616

Query: 617 SEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADPXX 676
           SEGAINYTFGQLMKSKS+TIVSIAHRLSTIRRSEN+IVLG+DGSVVE GKFKEL+++P  
Sbjct: 617 SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTS 676

Query: 677 XXXXXXXXXXX--XXXXXXXXXXXXXXXQPEDEANQ----------------KNAPEEAH 718
                                       +P ++ N                  N P E+ 
Sbjct: 677 ALSQLLNERTAPVPSEQQQQVEKDNEKEEPNEDENHDQRNEGDDGSNHDNDSNNKPLESK 736

Query: 719 D-------DSVEEILKDVTAEGKPIKIS 739
           D       +SVE +LKD   E  PIK+S
Sbjct: 737 DKKSDDIEESVEHVLKDAAKEANPIKLS 764

>NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5
          Length = 773

 Score =  884 bits (2285), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/660 (67%), Positives = 533/660 (80%), Gaps = 16/660 (2%)

Query: 86  EQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGLET-NE 144
           E KS   DV+RL +L K DWKLL++A+TLLT+SC IGM IPKVIG+ILD LK    T +E
Sbjct: 119 EPKSNFSDVIRLFLLVKTDWKLLLVALTLLTISCVIGMMIPKVIGIILDSLKVQTATQSE 178

Query: 145 GKDGPISMADVPPIFM-GYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRAN 203
           G++ P      PPI M G +IYEFLGGF+  ++ G +AN+GR++LLRILSER+VARLR+ 
Sbjct: 179 GEEAP------PPIMMFGLTIYEFLGGFSIALLAGCMANFGRLILLRILSERLVARLRST 232

Query: 204 VIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSI 263
           VIK+TIHQD++F+D HK GDLISRLG+DAY+VSRS+TQK+SDGFK+LIC         S+
Sbjct: 233 VIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSL 292

Query: 264 SPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAE 323
           S  LS +L +   PV+ SASIFG++IR  S +LQ+ATGQLTRVSEEQL+GV+TVQSFVAE
Sbjct: 293 SLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAE 352

Query: 324 QKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGD 383
           Q+EI R++ AIR+IF+VGKR+A+INA+FFT+TS +GD+SFL VL YGSYLVL G LTIGD
Sbjct: 353 QREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGD 412

Query: 384 LTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGKGEI 443
           LTAFMLYTEYTG+S+FGL++FYSE+MQG GAA+RLFELTD VP I+PT GK ++PGKGEI
Sbjct: 413 LTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEI 472

Query: 444 VFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIF 503
            FK+V+FSYPTRP N IF++++ KI  GSNVC+VGPSG+GKSTIALLLL +YNP+SGQI 
Sbjct: 473 EFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQIL 532

Query: 504 IDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHN 563
           IDGQDI+K+N KSLRR +G+VQQEPVLMSG++RDNITYGLT TP+KEEIR VAKQCFCHN
Sbjct: 533 IDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHN 592

Query: 564 FIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINY 623
           FI KFPH YDT IGP G LLSGGQKQRIAIARALIKKP IL+LDEATSALDVESEGAINY
Sbjct: 593 FITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINY 652

Query: 624 TFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADPXXXXXXXXX 683
           TFGQLMK+KS+TIVSIAHRLSTIRRSEN+IVLGNDGSV+E GKFKELF+DP         
Sbjct: 653 TFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDPSSELSKLLN 712

Query: 684 XXXXXXXXXXXXXXXXXXXQPEDEANQKNAPEEAHDDSVEE----ILKDVTAEGKPIKIS 739
                               PE +A+    P E  D ++E+    +L DVT+E KPIK+S
Sbjct: 713 EKSSRKKTKSDPISSA----PEVDADATGEPVEPIDPAIEDALHSVLNDVTSESKPIKMS 768

>YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}
           MDL2Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, required for respiratory
           growth at high temperature; similar to human TAP1 and
           TAP2 implicated in bare lymphocyte syndrome and
           Wegener-like granulomatosis
          Length = 773

 Score =  883 bits (2281), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/661 (68%), Positives = 526/661 (79%), Gaps = 37/661 (5%)

Query: 16  SPSIARSVILRRFTPLVRRLPIVQPSVRSVISKRCQLSP-LSQIQFQTTRPLTRSFTSSV 74
           SP++ +S+IL+ F                    RC  S  + +    +  P+++    S 
Sbjct: 52  SPAVGKSLILQSF--------------------RCNSSKTVPETSLPSASPISKG---SA 88

Query: 75  RLLQAKSPKEAEQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILD 134
           R   AK   E  +    KD++RL MLAK DWKLL+ AI LLT+SC IGM+IPKVIG++LD
Sbjct: 89  RSAHAK---EQSKTDDYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLD 145

Query: 135 VLKTGLETNEGKDGPISMADVP-PIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILS 193
            LKT    + G D      D+  PIF    +YEFL  F   ++ G  AN+GR +LLRILS
Sbjct: 146 TLKT----SSGSD----FFDLKIPIF-SLPLYEFLSFFTVALLIGCAANFGRFILLRILS 196

Query: 194 ERVVARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICX 253
           ERVVARLRANVIKKT+HQD+EFFD HKVGDLISRLGSDAYVVSRSMTQKVSDG KALIC 
Sbjct: 197 ERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICG 256

Query: 254 XXXXXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSG 313
                   S+SPQLS LLL FTPPVLFSAS+FG++IR+TS DLQEATGQLTRV+EEQLSG
Sbjct: 257 VVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSG 316

Query: 314 VRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYL 373
           ++TVQSFVAE  E+ RY+ AIRDIF VGK AA+ NA+FFT TS LGD+SFL VLAYGSYL
Sbjct: 317 IKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYL 376

Query: 374 VLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTG 433
           VLQ  L+IGDLTAFMLYTEYTG++VFGL++FYSE+MQG GAA+RLFELTDR PSI PT G
Sbjct: 377 VLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVG 436

Query: 434 KKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLR 493
            K+ P +G I FKDV+FSYPTRP   IF++++ KI  GS+VC+VGPSGRGKSTIALLLLR
Sbjct: 437 HKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLR 496

Query: 494 FYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIR 553
           +YNP++G I ID QDISKLN KSLRRHIG+VQQEPVLMSGT+RDNITYGLT TP+KEEIR
Sbjct: 497 YYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR 556

Query: 554 MVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSAL 613
            VAKQCFCHNFI KFP+ YDTVIGP G LLSGGQKQRIAIARALIKKPTIL+LDEATSAL
Sbjct: 557 SVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSAL 616

Query: 614 DVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFAD 673
           DVESEGAINYTFGQLMKSKS+TIVSIAHRLSTIRRSEN+IVLG+DGSVVE GKFKEL+A+
Sbjct: 617 DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYAN 676

Query: 674 P 674
           P
Sbjct: 677 P 677

>Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON}
           YPL270W (REAL)
          Length = 773

 Score =  873 bits (2255), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/685 (65%), Positives = 521/685 (76%), Gaps = 38/685 (5%)

Query: 84  EAEQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGLETN 143
           E  +    KD++RL MLAK DWKLL+ AI LLT+SC IGM+IPKVIG++LD LKT    +
Sbjct: 95  EQSKTDDYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLKT----S 150

Query: 144 EGKDGPISMADVP-PIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRA 202
            G D      D+  PIF    +YEFL  F   ++ G  AN+GR +LLRILSERVVARLRA
Sbjct: 151 SGSD----FFDLKIPIF-SLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRA 205

Query: 203 NVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXS 262
           +VIKKT+HQD+EFFD HKVGDLISRLGSDAYVVSRSMTQKVSDG KALIC         S
Sbjct: 206 HVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCS 265

Query: 263 ISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVA 322
           +SPQLS LLL FTPPVLFSAS+FG++IR+TS DLQEATGQLTRV+EEQLSG++TVQSFVA
Sbjct: 266 LSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVA 325

Query: 323 EQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIG 382
           E  E+ RY+ AIRDIF VGK AA+ NA+FFT TS LGD+SFL VLAYGSYLVLQ  L+IG
Sbjct: 326 EGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIG 385

Query: 383 DLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGKGE 442
           DLTAFMLYTEYTG++VFGL++FYSE+MQG GAA+RLFELTDR PSI PT G K+ P +G 
Sbjct: 386 DLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGV 445

Query: 443 IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI 502
           I FKDV+FSYPTRP   IF+ ++ KI  GS+VC+VGPSGRGKSTIALLLLR+YNP++G I
Sbjct: 446 IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI 505

Query: 503 FIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCH 562
            ID QDI+KLN KSLRR IG+VQQEPVLMSGT+RDNITYGLT TP+KEEIR VAKQCFCH
Sbjct: 506 MIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCH 565

Query: 563 NFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAIN 622
           NFI KFP+ YDTVIGP G LLSGGQKQRIAIARALIKKPTIL+LDEATSALDVESEGAIN
Sbjct: 566 NFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAIN 625

Query: 623 YTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADPXXXXXXXX 682
           YTFGQLMKSKS+TIVSIAHRLSTIRRSEN+IVLG+DGSVVE GKFKEL+A+         
Sbjct: 626 YTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLL 685

Query: 683 XXXXX-------XXXXXXXXXXXXXXXQPEDEANQ---------------------KNAP 714
                                      +  D+ N+                     K+  
Sbjct: 686 NERAAPGPSDQQLQIEKVEEKEDTNEGEKHDQQNKQDDDNSHNNHDNDSNNQSLEVKDKN 745

Query: 715 EEAHDDSVEEILKDVTAEGKPIKIS 739
            E  ++SVE +LKD   E  PIK++
Sbjct: 746 SENIEESVEHLLKDAAKEANPIKLT 770

>Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)
          Length = 773

 Score =  869 bits (2246), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/643 (69%), Positives = 518/643 (80%), Gaps = 11/643 (1%)

Query: 35  LPIVQPSVRSVISKRCQLSPLSQIQFQTTRPLTRSFTSSVRLLQAKSPKEAEQKS---GL 91
           +PI +  +RS    +  L   S+     T P+    +SS     +  P    Q+S     
Sbjct: 43  IPINRLCIRSPTVGKSLLLQFSRYNSSKTEPVALLSSSSSASKDSVKPARPPQRSKTDDY 102

Query: 92  KDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGLETNEGKDGPIS 151
           KD++RL MLAK DWKLL+ AI LLT+SC IGM+IPKVIG++LD LKT    + G D    
Sbjct: 103 KDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLKT----SSGSD---F 155

Query: 152 MADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRANVIKKTIHQ 211
                PIF    +YEFL  F   ++ G  AN+GR +LLRILSERVVARLRA+VIKKT+HQ
Sbjct: 156 FELKIPIF-SLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQ 214

Query: 212 DSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLL 271
           D+EFFD HKVGDLISRLGSDAYVVSRSMTQKVSDG KALIC         S+SPQLS LL
Sbjct: 215 DAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILL 274

Query: 272 LLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYS 331
           L FTPPVLFSAS+FG++IR+TS DLQEATGQLTRV+EEQLSG++TVQSFVAE  E+ RY+
Sbjct: 275 LFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYN 334

Query: 332 HAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYT 391
            AIRDIF VGK AA+ NA+FFT TS LGD+SFL VLAYGSYLVLQ  L+IGDLTAFMLYT
Sbjct: 335 VAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYT 394

Query: 392 EYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGKGEIVFKDVTFS 451
           EYTG++VFGL++FYSE+MQG GAA+RLFELTDR PSI PT G K+ P +G + FKDV+FS
Sbjct: 395 EYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRGVVEFKDVSFS 454

Query: 452 YPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISK 511
           YPTRP   IF++++ KI  GS+VC+VGPSGRGKSTIALLLLR+YNPS+G I ID QDI+K
Sbjct: 455 YPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITK 514

Query: 512 LNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHG 571
           +N KSLRRHIG+VQQEPVLMSGT+RDNITYGLT TP+KEEIR VAKQCFCHNFI KFP+ 
Sbjct: 515 MNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNT 574

Query: 572 YDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKS 631
           YDTVIG +G LLSGGQKQRIAIARALIKKPTIL+LDEATSALDVESEGAINYTFG LMKS
Sbjct: 575 YDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKS 634

Query: 632 KSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADP 674
           KS+TI+SIAHRLSTIRRSEN+IVLG+DGSVVE GKFK+L+A+P
Sbjct: 635 KSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANP 677

>TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa]
           {ON} Anc_6.5 YPL270W
          Length = 794

 Score =  869 bits (2245), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/664 (65%), Positives = 532/664 (80%), Gaps = 10/664 (1%)

Query: 81  SPKEAEQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGL 140
           SP+  ++K G  ++ RL+++   DWKLL++AITLLT+SC IGM IPKVIG++LD LK   
Sbjct: 135 SPRAEDEKKGRSELARLVLMTLRDWKLLLLAITLLTISCSIGMAIPKVIGLVLDALK--- 191

Query: 141 ETNEGKDGPISM--ADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVA 198
             N   D P S+  +D+PPI  G ++Y FLG FA  +V G + NYGR +LLR+LSERVVA
Sbjct: 192 --NVMTDSPSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVA 249

Query: 199 RLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXX 258
           RLR++VIKKT+HQD+EFFD++KVGDLISRLGSDAYVVSRS+TQKVSDGFKA++C      
Sbjct: 250 RLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCGGAGIG 309

Query: 259 XXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQ 318
              SISPQLS  L++F P V+ SASIFG+KIRD ST LQEATGQLTRVSEEQL+GV+TVQ
Sbjct: 310 MMISISPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQ 369

Query: 319 SFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGG 378
           SFVAEQKEI RY++AIRDI+N+GK +A +N++F T+TS +GD+SFLVVLAYGSYLVL G 
Sbjct: 370 SFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGS 429

Query: 379 LTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVP 438
           LTIGDLTAFMLYT+YT +S+FGL++FYSE+MQGVGAA RLF+LTDR+P+I+PT G+KF+P
Sbjct: 430 LTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIP 489

Query: 439 GKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPS 498
           G G I F+++ F+YPTRP N +F++++ KI  G++VC+VGPSGRGKSTIALLLLR+YNPS
Sbjct: 490 GDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPS 549

Query: 499 SGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQ 558
           SGQI ID QDI KLN KSLR+++G+VQQEPVLMSG++RDNITYGL    + +EIR V+KQ
Sbjct: 550 SGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQ 609

Query: 559 CFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESE 618
           CFCHNFI KFP  Y+T+IGP G LLSGGQKQRIAIARALIKKP IL+LDEATSALDVESE
Sbjct: 610 CFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESE 669

Query: 619 GAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADPXXXX 678
           GAINYTFG+LMKSKSVTIVSIAHRLSTIRRSE IIVLGNDGSVVETGKFKEL+ADP    
Sbjct: 670 GAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSEL 729

Query: 679 XXXXXXXXXXXXXXXXXXXXXXXXQPED--EANQKNA-PEEAHDDSVEEILKDVTAEGKP 735
                                   +  D  E N   A P   H++ V ++LK+V+ +  P
Sbjct: 730 SKLLNEKQSRANKKEAPLPPQSDGENGDDFEGNGTPASPPSLHNNLVTDVLKEVSDDSSP 789

Query: 736 IKIS 739
           +KI+
Sbjct: 790 LKIA 793

>SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 774

 Score =  858 bits (2217), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/656 (64%), Positives = 519/656 (79%), Gaps = 14/656 (2%)

Query: 25  LRRFTPLVRRLPIVQPSVRSVISKRC-QLSPLSQIQFQTTRPLTRSFTSSVRLLQAKSPK 83
           LR FT   +R  +  PS   +  ++C   SP+S   F+ +   T   +++         +
Sbjct: 53  LRLFT--TKRTLLGYPSQNKLCDQQCFTKSPIS-YNFKRSYSTTEEKSTATTTSTPTPEQ 109

Query: 84  EAEQKS-------GLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVL 136
           + EQ+S       G K++ RL  LA+ DWKLL++AI+LLT+SC IGM +PKVIGM+LDV 
Sbjct: 110 KKEQESTSGNSGAGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVA 169

Query: 137 KTGLETNEGKDGPISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERV 196
           K  + ++E    P  + D+PP+  G  +Y+FL  FA  +V    AN+GR+VLLRIL E++
Sbjct: 170 KNAITSDEK---PKDLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKL 226

Query: 197 VARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXX 256
           VARLR+NVIKKTIHQD+EFFDR+KVGDLISRL SDAYVVSRSMTQ +SDGFKA+IC    
Sbjct: 227 VARLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVG 286

Query: 257 XXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRT 316
                 IS  L+  L LF PP+L  A+I+GRKIR  S DLQ++TG LT+V+EEQLSGV+T
Sbjct: 287 IGMMFHISSTLATALFLFAPPLLVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKT 346

Query: 317 VQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQ 376
           VQSFVAEQKEI RY+HAIR +F+VGKR A  NA FF++TS LGD SFL+VLAYGS+LVLQ
Sbjct: 347 VQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQ 406

Query: 377 GGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKF 436
           G L+IGDLTAFMLYTEY+GS+VFGL++FYSELM+G GAA+RLFELTD  PSI  T G  +
Sbjct: 407 GSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPY 466

Query: 437 VPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYN 496
           VPGKGEI F++V+FSYPTR  N IF +++  I +GSNVCVVGPSGRGKSTIA LLL++YN
Sbjct: 467 VPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYN 526

Query: 497 PSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVA 556
           P+SG+I IDGQDISK++ KSLRRH+G+VQQEP+LMSG++RDNITYG+  TP+ +EIR V+
Sbjct: 527 PTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVS 586

Query: 557 KQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVE 616
           K+CFCHNFI KF  GY+TVIGP+GALLSGGQKQRIAIARALIKKP IL+LDEATSALDVE
Sbjct: 587 KKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVE 646

Query: 617 SEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFA 672
           SEGAINYT GQLMKS+ +TI+SIAHRLSTIRRSEN+IVLG+DGSVVE GKFKEL+A
Sbjct: 647 SEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYA 702

>Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON}
           YPL270W (MDL2) - ATP-binding cassette (ABC) transporter
           family member [contig 186] FULL
          Length = 776

 Score =  849 bits (2193), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/623 (67%), Positives = 499/623 (80%), Gaps = 15/623 (2%)

Query: 63  TRPLTRSFTSSVRLLQAKSPKEAE-QKSG-----------LKDVVRLLMLAKPDWKLLVI 110
           T  LTR ++      QAK+P + E QKSG            K+V+RL  LA  DWKLL  
Sbjct: 99  TLQLTRLYSQKTVESQAKTPADKESQKSGTMEDEESPNMGYKEVIRLFKLATHDWKLLTF 158

Query: 111 AITLLTVSCGIGMTIPKVIGMILDVLKTGLETNEGKDGPISMADVPPIFMGYSIYEFLGG 170
           AI LL +S  IGM+IPKVIGM+LD +K    T     GP+ + D+PPI    S+YEFLG 
Sbjct: 159 AIGLLAISSVIGMSIPKVIGMVLDAIKN---TYSSATGPVGLDDLPPIVNDLSMYEFLGI 215

Query: 171 FAALMVFGIVANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVGDLISRLGS 230
           FA  +V G VAN+GRIVLLR+L E++VARLR+NVI+K IHQD+EFFDR+KVGDLISRL S
Sbjct: 216 FAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSS 275

Query: 231 DAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIR 290
           DAYVVSRSMTQ VSDGFKA+IC         +IS  L+  LL+F PP+L  A I+G++IR
Sbjct: 276 DAYVVSRSMTQNVSDGFKAIICGGVGIGMMVNISISLTSALLMFAPPLLIGALIYGKRIR 335

Query: 291 DTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQ 350
             S DLQE+TG LTRVSEEQLSGV+T+QSFVAE KE+ RY+ AIR +F  GK+ A  NA 
Sbjct: 336 MISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNAT 395

Query: 351 FFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQ 410
           FF++T+ LGD+SFL+VLAYGS+LVLQGGLT+GDLTAFMLYTEYTGS+VFGL++FYSELM+
Sbjct: 396 FFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMK 455

Query: 411 GVGAATRLFELTDRVPSIKPTTGKKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPA 470
           G GAA+RLFE+TD  PSIKPT GK +VPG G+I FKDV+FSYPTRPGN IF  ++  I  
Sbjct: 456 GAGAASRLFEMTDHAPSIKPTAGKPYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEP 515

Query: 471 GSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVL 530
           GSNVC+VGPSGRGKSTI  LLLR+YNPSSGQI ID QDIS+L+ KSLRRH+G+VQQEP+L
Sbjct: 516 GSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPML 575

Query: 531 MSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQR 590
           MSG+++ N+TYGL    S +EIR VAK+CFCH F+ KFP+GYDT+IGP+GA LSGGQKQR
Sbjct: 576 MSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQR 635

Query: 591 IAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSE 650
           IAIARAL+KKP IL+LDEATSALDVESEGAINYT G+LMKSK +TI+SIAHRLSTIRRSE
Sbjct: 636 IAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSE 695

Query: 651 NIIVLGNDGSVVETGKFKELFAD 673
           N+IVLGNDGSVVE GKFK+L+AD
Sbjct: 696 NVIVLGNDGSVVEVGKFKDLYAD 718

>KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270W MDL2
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane
          Length = 740

 Score =  835 bits (2158), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/590 (67%), Positives = 493/590 (83%), Gaps = 3/590 (0%)

Query: 84  EAEQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGLETN 143
           E + K+  ++++RL+ LA+ DWKLL +AI LLT+S  +GMTIPKVIG++LD +K     +
Sbjct: 99  EEKSKTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKN---AS 155

Query: 144 EGKDGPISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRAN 203
            G  GP+++ D+PPI  G  +++FL  FA ++VFG +AN+GRIVLLR+L E++VARLR+N
Sbjct: 156 GGFSGPMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSN 215

Query: 204 VIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSI 263
           VIKK IHQD+EFFDR+KVGDLISRL SDAYVVSRSMTQ VSDGFKA+IC         +I
Sbjct: 216 VIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAIICGGVGIGMMINI 275

Query: 264 SPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAE 323
           S  L+  L LF PP+L  A I+G+KIR  S +LQE+TG LT+VSEEQLSGV+T+Q+FVAE
Sbjct: 276 SASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAE 335

Query: 324 QKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGD 383
            KE+HRY++AIR +F+ GK+ A  NA FF++T  LGD+SFL+VLAYGS+LVLQGGL++GD
Sbjct: 336 GKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGD 395

Query: 384 LTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGKGEI 443
           LTAFMLYTEYTGS+VFGL++FYSELM+G GAA+RLFE+TD    IKP++GK +VP  GEI
Sbjct: 396 LTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPSWGEI 455

Query: 444 VFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIF 503
            F+DV+FSYPTRPGN IF  ++  I  GSNVCVVGPSGRGKSTIA LLLR+Y+P+SG+I 
Sbjct: 456 KFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIM 515

Query: 504 IDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHN 563
           IDGQ+ISKL+ KSLRRH+G+VQQEP+LMSG++R N+TYG+    + +EIR VAK+CFCH 
Sbjct: 516 IDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHG 575

Query: 564 FIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINY 623
           FI KFP GY+TVIGP+GA LSGGQKQRIAIARALIKKP IL+LDEATSALDVESEGAINY
Sbjct: 576 FITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINY 635

Query: 624 TFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFAD 673
           T G+LM+S+ +TI+SIAHRLSTIRRSEN+IVLGNDGSVVE GKFKEL+A+
Sbjct: 636 TLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYAN 685

>KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 789

 Score =  817 bits (2110), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/610 (64%), Positives = 489/610 (80%), Gaps = 14/610 (2%)

Query: 78  QAKSPKEAEQK------SGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGM 131
           + K+P +   K       GL DV RL  LA+ DWK+LV+A++LLTVSC IGM +PKVIG+
Sbjct: 93  EDKTPDKKTNKPSSTVSGGLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGL 152

Query: 132 ILDVLKTGLETNEG--------KDGPISMADVPPIFMGYSIYEFLGGFAALMVFGIVANY 183
           +LD  K  L  +              +++ D+PPI     +Y+F   F   ++ G +AN+
Sbjct: 153 VLDATKNALSGSNTNNGNGGLEDSKSLTLDDLPPIVGDIQLYDFFLLFGGALLIGTMANF 212

Query: 184 GRIVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKV 243
           GR+VLL+IL ER+VARLR+NVIKKT+H D EF+DR+KVGDL+SRLG+DAY+VSRSMTQ +
Sbjct: 213 GRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNI 272

Query: 244 SDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQL 303
           SDGFKALIC          IS  L+ +L LF PP+L  A+I+G KIR  S +LQ+A+G L
Sbjct: 273 SDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNL 332

Query: 304 TRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISF 363
           T+V+EEQLSG++TVQSFVAE KE+HRY++A+R +FNVGK+ A+ NA FF++T+ LGD SF
Sbjct: 333 TKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSF 392

Query: 364 LVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTD 423
           L+VLAYGS+LVLQG LTIGDLTAFMLYTEYTGS+VFGL++FYSELM+G GAATRLFEL D
Sbjct: 393 LLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLD 452

Query: 424 RVPSIKPTTGKKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRG 483
             P+IK TTGK F P  G++ F+ V+FSYPTR  N IF+D++  I  GSNVC+VGPSGRG
Sbjct: 453 YKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRG 512

Query: 484 KSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGL 543
           KSTIA LLLR+YNP+SG+I +DGQDI+KL+ KSLRR +G+VQQEP+LMSGT+R+NITYG+
Sbjct: 513 KSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGV 572

Query: 544 TETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTI 603
           +  PS EEIR VAK+CFCH FI KFP+GY+T+IGP+GALLSGGQKQRIAIARAL+ KP I
Sbjct: 573 SRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKI 632

Query: 604 LVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVE 663
           L+LDEATSALDVESEGAINYT G+LMKSK +TI+SIAHRLSTIRRSEN+IVLG DGSVVE
Sbjct: 633 LILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVE 692

Query: 664 TGKFKELFAD 673
            GKFK+L+A+
Sbjct: 693 MGKFKDLYAN 702

>KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5
           YPL270W
          Length = 741

 Score =  801 bits (2069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/667 (61%), Positives = 500/667 (74%), Gaps = 26/667 (3%)

Query: 86  EQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLK--TGLETN 143
           E +   KD+ RL +L K DWKLL+ A+TLLTVSCGIGM IPKVIG +LD LK   G E +
Sbjct: 83  EDEGTYKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLDSLKDIQGKEFS 142

Query: 144 EGKDGPISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRAN 203
           E     + + D+       S+  F  G + L++ G  ANY R++LLRILSE +VA+LRAN
Sbjct: 143 E-----LMIWDM-------SLKHFFYGLSGLLLLGCGANYVRVILLRILSENLVAKLRAN 190

Query: 204 VIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSI 263
           VIK  IHQD++FFD +KVGDLISR+G+DA++VSRS+TQK+SDG KA+           SI
Sbjct: 191 VIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMLSI 250

Query: 264 SPQLS-GLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVA 322
           S  LS  +L+L   P+L SA +FG++IRD S  LQE T  LTRVSEEQ +G++T+QSFVA
Sbjct: 251 SIPLSCSILILMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVA 310

Query: 323 EQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIG 382
           EQ E+H+++ +IR IF VGK AA+INA+FFT  S +GD+SFLVVL+YGS+LV Q  L++G
Sbjct: 311 EQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVG 370

Query: 383 DLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGKG- 441
           DLTAFMLYTEYTG+++F L+ F+SE+MQG GAA+R+FELTD  P I PT G KF+P KG 
Sbjct: 371 DLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGG 430

Query: 442 EIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQ 501
           EI FK+V+F+YPTRP   IFR+++ KI  GSNVC+VGPSG+GKSTIA LLL +YNPS GQ
Sbjct: 431 EIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQ 490

Query: 502 IFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFC 561
           I IDGQDIS L+ KSLRRHIG+VQQEP+LMSGT+RDNITYGLT TP+KEEIR VAKQCFC
Sbjct: 491 ILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 550

Query: 562 HNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAI 621
           HNFI +FP  YDT IGP G LLSGGQKQRIAIARALIKKPT+L+LDEATSALDVESEGAI
Sbjct: 551 HNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI 610

Query: 622 NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADPXXXXXXX 681
           NYTFGQLMKSKS+TIVSIAHRLSTIRRSEN+IVLGNDGSVVE GKFKELFA+P       
Sbjct: 611 NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANPASELSKL 670

Query: 682 XXXXXXXXXXXXXXXXXXXXXQPED------EANQKNA----PEEAHDDSVEEILKDVTA 731
                                  E+      EA   ++      E   +++ E+LKD++ 
Sbjct: 671 LREKSSGNNAAPEIQPQEISQTIEEDPSFSGEATPASSVTGFKAETEAETINEVLKDIST 730

Query: 732 EGKPIKI 738
           EGKP+KI
Sbjct: 731 EGKPLKI 737

>ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL270W (MDL2)
          Length = 754

 Score =  790 bits (2041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/595 (64%), Positives = 477/595 (80%), Gaps = 2/595 (0%)

Query: 81  SPKEAEQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGL 140
           S  +  + +G  +V RLL L KPDWKLL+ A+ LLT+SC IGM +PKVIG++LD  K  +
Sbjct: 93  SRAQPAKPAGWHEVFRLLRLVKPDWKLLLAALGLLTISCSIGMAVPKVIGLVLDATKDAV 152

Query: 141 ETNEGKD--GPISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVA 198
              E  +   P+S+ D+P I   +++ + L  FA  ++ G  AN+GR+ LL++L ER+VA
Sbjct: 153 AQAEKNETGAPMSLLDMPSIIGNFTLVDVLAAFAGALLVGSAANFGRMFLLKMLGERLVA 212

Query: 199 RLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXX 258
           RLRA VIKKT+H D+EFFDR+KVGDLISRLGSDAY+VSRSMT  +SDG KA +C      
Sbjct: 213 RLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVG 272

Query: 259 XXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQ 318
               IS  L+  +++F PP+L +A+I+G++IR  S +LQ++TG LTRVSEEQ +G++T++
Sbjct: 273 MMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIK 332

Query: 319 SFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGG 378
           SFVAE KE+ RY+ A+R +FNV KR    +A FF+ T+ LGD+SFL+VLAYGS+LVLQG 
Sbjct: 333 SFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGE 392

Query: 379 LTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVP 438
           L++G LTAFMLYTEYTGSSVFGL++FYSELM+G GAA+RLFELTD   S+  T G+ FVP
Sbjct: 393 LSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVP 452

Query: 439 GKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPS 498
             G I FKDV+FSYPTRP + IF+ + + I  GSNVC+VGPSGRGKSTIA LLLRFY+ +
Sbjct: 453 RDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDAN 512

Query: 499 SGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQ 558
           SG I IDGQDISK++ KSLR+H+G+VQQEPVLMSGT+RDNITYGL+ TPS +EIR VAK+
Sbjct: 513 SGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKK 572

Query: 559 CFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESE 618
           CFCHNFI KFP GYDTVIGP+GALLSGGQ+QRIAIARALIKKP IL+LDEATSALDVESE
Sbjct: 573 CFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESE 632

Query: 619 GAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFAD 673
           GAINYT G+LM+SK +TIVSIAHRLSTIRRSENI+VLGNDGSV+E GKF +L+ D
Sbjct: 633 GAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRD 687

>Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON}
           similar to Ashbya gossypii ACR022W
          Length = 769

 Score =  790 bits (2041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/607 (63%), Positives = 473/607 (77%), Gaps = 17/607 (2%)

Query: 84  EAEQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGLET- 142
           + E   G ++V+RL  LAK DWKLL +AI LL+VSC IGM +PKVIG++LD  K  L++ 
Sbjct: 90  QKETSVGWREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSS 149

Query: 143 -----------NEGKD----GPISMAD-VPPIFMGYSIYEFLGGFAALMVFGIVANYGRI 186
                      NE K+    GPI+  D +PPI    SI +F+G FA  +V G  AN+GR+
Sbjct: 150 YEKGSQDLEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRV 209

Query: 187 VLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDG 246
           VLL+I+ ER+V+RLR+ VIK+T+H D EFFDR+KVGDLISR GSDAYVVSRSMTQ VSDG
Sbjct: 210 VLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDG 269

Query: 247 FKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRV 306
           FKA+IC          IS  L+ ++LLF PP+L  A I+G+KI   S  LQ+++G LTRV
Sbjct: 270 FKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRV 329

Query: 307 SEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVV 366
           +EEQL+G+RT++SFVAE+KEI RY+ AIR +F VGKR A+ NA FF++T+ LGD+SF++V
Sbjct: 330 AEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREAFTNATFFSSTTILGDMSFVIV 389

Query: 367 LAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVP 426
           L YG+ LVLQG L+IGDLTAFMLYTEYTGSSVFGL++FYSELM+G GAA+RLFEL D   
Sbjct: 390 LLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKN 449

Query: 427 SIKPTTGKKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKST 486
           S++        P +G+I F+DV+FSYPTRP N IF+ M   I  GSNVC+VGPSG+GKST
Sbjct: 450 SVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKST 509

Query: 487 IALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTET 546
           I  LLLRFY+P+ G I ID  DISK   KSLRRH+G+VQQEP LMSGT+RDNITYGL+ T
Sbjct: 510 ITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYT 569

Query: 547 PSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVL 606
           P+ +EIR+V+KQCFCH FI KFP GYDTVIGP+GA LSGGQ+QRIAIARALIKKP IL+L
Sbjct: 570 PTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILIL 629

Query: 607 DEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGK 666
           DEATSALDVESEGAINYT G LM+SK +TI+SIAHRLSTIRRSENIIV+GNDGSVVE GK
Sbjct: 630 DEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGK 689

Query: 667 FKELFAD 673
           F +L+ +
Sbjct: 690 FDKLYRN 696

>KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa]
           {ON} Anc_6.5 YPL270W
          Length = 751

 Score =  748 bits (1932), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/742 (54%), Positives = 506/742 (68%), Gaps = 43/742 (5%)

Query: 27  RFTPLVRRLPIVQPS---VRSVISKRCQLSPLSQIQFQTTRPLTRSFTSSVRLLQAKSPK 83
           R  P +R L   +PS     S    RC   P        T P    F    R L+  S  
Sbjct: 22  RIIPSIRLLSYSRPSPFPSNSPRPTRCLTVPSRTNFIPRTLP---QFLVPHRTLKTAS-- 76

Query: 84  EAEQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGLETN 143
             +  S  +D+ RL +L K D KLLV+AI LLT+SC IGM IPK+IG ILD L+   E N
Sbjct: 77  -TDNGSSWRDLKRLTVLIKKDIKLLVLAIVLLTISCSIGMAIPKIIGTILDTLRNNYE-N 134

Query: 144 EGKDGPISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRAN 203
                 I + ++P       +  FL G    ++FG  AN+GR+V+LRI+SER+V+RLR+ 
Sbjct: 135 LTSLSQIKILNIP-------LSTFLMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQ 187

Query: 204 VIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSI 263
           V+K  IH+D EFFD  KVGDL+SR+G+DA+VVSRS+T KV+DG ++            ++
Sbjct: 188 VVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSGFIGIFGIGLMLTL 247

Query: 264 SPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAE 323
           S +L+G L    PP+++  S+FG++IR  S  LQ+ TG LTRV+EEQ +G+RTVQ FVAE
Sbjct: 248 SRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAE 307

Query: 324 QKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGD 383
           + EI R+++ +R+IF VGK +A+IN +FFT+ S +GD+ FL+VL YGSYLV+ G ++IGD
Sbjct: 308 RNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGD 367

Query: 384 LTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGK-KFVP---- 438
           LTAFMLYTEYTG+++FGL+SFYSELMQGVGAA+R+FE+ D+ P IK TTG+ KF P    
Sbjct: 368 LTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEV 427

Query: 439 GKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPS 498
           G  EI FK+V+F YPTRP N IF++++ K+PAGSNVC+VGPSGRGKSTIA LLL  YN  
Sbjct: 428 GGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAV 487

Query: 499 SGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQ 558
           SGQI IDGQDI+ LN KSLRR IG+VQQEP+LMSGT+RDNITYGLTE PSKEEIR+VAKQ
Sbjct: 488 SGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQ 547

Query: 559 CFCHNFIVKFPHGYD--TVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVE 616
           CFCHNFI KFP  YD     G  G  LSGGQKQRIAIARALIKKP IL+LDEATSALDVE
Sbjct: 548 CFCHNFITKFPDTYDTTIGSGSSGTSLSGGQKQRIAIARALIKKPNILILDEATSALDVE 607

Query: 617 SEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADPXX 676
           SEGAINYTFGQ+MKSKS+TIVSIAHRLSTIRR E++IVLGNDGSVVE GKFKEL+ +P  
Sbjct: 608 SEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNPTS 667

Query: 677 XXXXXXXXXXXXXXXXXXXXX----XXXXXQPEDEANQKNAPEEAH---DDSVEEI---- 725
                                          PE++    NA EE     DDS E++    
Sbjct: 668 ELSKLLNEKSSTKEATPQPVNPPPFIDLQTNPEEKKEADNASEENGAKLDDSKEDVSVPD 727

Query: 726 --------LKDVTAEGKPIKIS 739
                   LK+   EG PIKI+
Sbjct: 728 NMTSSDDSLKEAVNEGGPIKIT 749

>TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa]
           {ON} Anc_1.67 YLR188W
          Length = 720

 Score =  538 bits (1386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/631 (43%), Positives = 406/631 (64%), Gaps = 12/631 (1%)

Query: 55  LSQIQFQTTRPLTRSFTSSVRLLQAKSPK---EAEQKSGLKDVVRLLMLAKPDWKLLVIA 111
           L Q +F +T   ++   + +   Q K  K   E    +G KDV RL  LAKP+   +V+A
Sbjct: 54  LQQTRFNSTNESSKGINTKLTETQQKLEKLSSEESTNTGFKDVKRLFTLAKPETAYIVLA 113

Query: 112 ITLLTVSCGIGMTIPKVIGMILDVLKTGLETNEGKDGPISMADVPP-----IFMGYSIYE 166
           + L+ +S  + M +P VIG +LD+       + G        D           G++  +
Sbjct: 114 LVLILISSTVSMVVPSVIGKLLDLSSNTSNDDTGDAKSKEKVDNKEDRDNNTIYGFTHTQ 173

Query: 167 FLGGFAALMVFGIVANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVGDLIS 226
           F  G   + V G +AN GRIV+L++  E++VARLR   +K  + QD+ F D ++VGDLIS
Sbjct: 174 FFAGLGIVFVIGAIANTGRIVILKVTGEKLVARLRTRTMKAALDQDATFLDSNRVGDLIS 233

Query: 227 RLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIFG 286
           RL SDA +V++S+T  VSDG +A++           IS +L+ +++L  PP+   A ++G
Sbjct: 234 RLSSDASIVAKSVTMNVSDGTRAILQGFVGFSMMSYISFKLTSVMVLLIPPLGIMALVYG 293

Query: 287 RKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAY 346
           +KIR+ S  LQ A G LT+V+EEQL+  +T+Q++  E+KEI RY+  +RD+F+VG + A 
Sbjct: 294 KKIRNLSRQLQTAVGGLTKVAEEQLNATKTIQAYGGEKKEIRRYASEVRDVFDVGLKEAI 353

Query: 347 INAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYS 406
            +  FF +T  +G+ + L +L  G+ ++  G LT+GDL++FM+Y  YTGSS+FGL+SFYS
Sbjct: 354 TSGIFFGSTGLVGNAALLSLLLVGTNMISSGSLTVGDLSSFMMYAVYTGSSLFGLSSFYS 413

Query: 407 ELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGKGE-IVFKDVTFSYPTRPGNVIFRDMD 465
           ELM+G GAA R+FEL DR P IKPT GK  V  KG+ I+F+DV+F YPTRP + +F  + 
Sbjct: 414 ELMKGAGAAARVFELDDRKPLIKPTIGKDPVTLKGKAIIFQDVSFHYPTRPNHRVFNKIS 473

Query: 466 IKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQ 525
            KI  G ++C VGPSG GKST++ LLLR+Y+ + G I I   +I  L+++  R+ +G+VQ
Sbjct: 474 FKIEPGEHICFVGPSGSGKSTVSQLLLRYYDATEGNILIGEDNIKSLSLRKYRKLLGVVQ 533

Query: 526 QEPVLMSGTLRDNITYGLTE--TPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALL 583
           QEP+L +GT+ DNI Y + +     K ++ +  K+  C  F+  FP G +T++GP+G  L
Sbjct: 534 QEPMLFNGTIIDNILYNVPDEIASQKNKVDLAIKKSNCTKFLANFPDGLNTIVGPRGTQL 593

Query: 584 SGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRL 643
           SGGQKQRIAIAR+ +  P+IL+LDEATSALD +SE  I  T  +  +++ +T +SIAHRL
Sbjct: 594 SGGQKQRIAIARSFLLDPSILLLDEATSALDTQSEDIIAMTLKK-REAEGLTTISIAHRL 652

Query: 644 STIRRSENIIVLGNDGSVVETGKFKELFADP 674
           STI+ S  ++VL  +GSVVETGKF EL A+P
Sbjct: 653 STIKYSSRVVVLNKNGSVVETGKFTELIANP 683

>Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa]
           {ON} complement(175048..177171) [2124 nt, 708 aa]
          Length = 707

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/686 (42%), Positives = 426/686 (62%), Gaps = 23/686 (3%)

Query: 8   TGSLLMGPSPSIARSVILRRFTPLVRRLPIVQPSVRSVISKRCQ--LSPLSQIQFQTTRP 65
           TG+ ++  SP + RS+ +R F P   RL I  P    +    C   LS  +Q+++ +   
Sbjct: 5   TGARILVSSP-LKRSMNIR-FLPKASRLIIGNPIKVKLQINNCYGGLSAFNQVRWTSNIS 62

Query: 66  LTRSFTSSVRL----------LQAKSPKEAEQKSGLKDVVRLLMLAKPDWKLLVIAITLL 115
              S  ++V            +Q  +P E+  +SG KDV RL  LA+P+   + IA+ L+
Sbjct: 63  DASSTVNAVAAQERELKIPPKIQKLTPDES-GRSGFKDVKRLFELARPETFYISIALLLI 121

Query: 116 TVSCGIGMTIPKVIGMILDVLKTGLETNEGKDGPISM----ADVPPIFMGYSIYEFLGGF 171
            +S  + M +P VIG +LD+ K      E   G         D      G +  +F    
Sbjct: 122 FISSAVSMVVPSVIGKLLDIAKPPSADEENGKGVSEKLKEKEDEDKKIYGLTALQFYTAL 181

Query: 172 AALMVFGIVANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSD 231
             +   G +AN GRI++L++  ER+VARLR   +K  + Q++ F D +KVGDLISRL +D
Sbjct: 182 GVVFTVGALANTGRIIILKVTGERLVARLRTRTMKAALEQEAAFLDSNKVGDLISRLSTD 241

Query: 232 AYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRD 291
           A +V++S+TQ VSDG +A++           IS QL+ ++LL  PP+   A I+GRKIR+
Sbjct: 242 ASIVAKSVTQNVSDGTRAILQGFVGFGMMSYISWQLTSVMLLLIPPLGAMAIIYGRKIRN 301

Query: 292 TSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQF 351
            S  LQ + G LT+V+EEQL+  RT+Q++  E+KEIHRY+  +R++F++G + A  +  F
Sbjct: 302 LSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKKEIHRYATEVRNVFDIGYKEAVTSGLF 361

Query: 352 FTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQG 411
           F +T  +G+ + L +L  G+ ++  G LT+G+L++FM+Y  YTGSS+FGL++FYSELM+G
Sbjct: 362 FGSTGLVGNTALLSLLVVGTNMISSGALTVGELSSFMMYAVYTGSSLFGLSTFYSELMKG 421

Query: 412 VGAATRLFELTDRVPSIKPTTGKKFVPGKGEIV-FKDVTFSYPTRPGNVIFRDMDIKIPA 470
            GAA R+FEL+DR P+IKPT GK  +   G+ V FK+V+F YPTRP   IF+D  IKI  
Sbjct: 422 AGAAARVFELSDRKPAIKPTIGKDPITLFGKTVEFKNVSFWYPTRPKQQIFQDFSIKIEP 481

Query: 471 GSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVL 530
           G +VC VGPSG GKST++ LLLR+Y+ + G I + G+DI   +++  RR +G+VQQEP+L
Sbjct: 482 GEHVCFVGPSGSGKSTVSSLLLRYYDVAKGSILVGGEDIKNFSLRKYRRLLGVVQQEPML 541

Query: 531 MSGTLRDNITYGLTETPSKE--EIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQK 588
            +GT+ +NI Y + E  + E   I    +   C  F+  FP G +T++GP+G  LSGGQK
Sbjct: 542 FNGTILENILYSVPEEIANEPGRIERAIESANCSKFLNNFPDGLNTLVGPRGTQLSGGQK 601

Query: 589 QRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRR 648
           QRIA+AR  +  P+IL+LDEATSALD +SE  I     Q    K  T +SIAHRLSTI+ 
Sbjct: 602 QRIALARTFLLDPSILILDEATSALDSQSEDIIAQNL-QARNEKGQTTISIAHRLSTIKH 660

Query: 649 SENIIVLGNDGSVVETGKFKELFADP 674
           S  ++VLG +G VVETG F+EL ++P
Sbjct: 661 SSRVVVLGKNGCVVETGTFQELISNP 686

>Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar to
           Ashbya gossypii AFR683C
          Length = 683

 Score =  531 bits (1368), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 288/643 (44%), Positives = 402/643 (62%), Gaps = 28/643 (4%)

Query: 52  LSP----LSQIQFQTTRPLTRSFTSSVRLLQAKSPKEAEQK-------------SGLKDV 94
           LSP    LSQ+  ++   + R + +S+ + +   P EA  +              G K+V
Sbjct: 25  LSPIRGRLSQVVLKSEIHVQRRWQNSINV-RGVPPSEASNRLQVLRLSGADSKEYGFKNV 83

Query: 95  VRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGLETNEGKDGPISMAD 154
            RL  LA+P+ K L  A+ L+ +S  + MTIP VIG +LD+ K   E   G DG     +
Sbjct: 84  RRLFQLARPEAKSLAFALLLIVISGAVSMTIPSVIGKLLDISK---EKEAGGDGD---EE 137

Query: 155 VPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRANVIKKTIHQDSE 214
                 G +  +F      + V G  AN GRIV+L++  E++VARLR   +K  + QD+ 
Sbjct: 138 QETRIYGLTEKQFYTALGGVFVIGACANVGRIVILKVTGEKLVARLRTKTMKAALQQDAA 197

Query: 215 FFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLF 274
           F D ++VGDLISRL SDA +VS+S+TQ  SDG +A+I           IS QL+G++LL 
Sbjct: 198 FLDYNRVGDLISRLSSDASIVSKSITQNTSDGARAVIQGMVGFGMMGYISAQLTGVMLLL 257

Query: 275 TPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAI 334
            PP++  A ++GR+IR+ + +LQ   G LT+V+EEQL+  RT+QS+  E+KEI RY+  +
Sbjct: 258 APPLVLMAMVYGRRIRNLTRELQTRVGGLTKVAEEQLNATRTIQSYCGERKEIRRYAEEV 317

Query: 335 RDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYT 394
           R +F VG R A  +  FF  T  +G+++ L +L  G+ ++  G +T+G+L++FM+Y  YT
Sbjct: 318 RSVFRVGLREAVTSGAFFGTTGLMGNMALLALLLTGTSMIRSGAITVGELSSFMMYAVYT 377

Query: 395 GSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVP-GKGEIVFKDVTFSYP 453
           GSS+FGL+SFYSELM+G GAA+R+FEL DRVP I PT GK  +     EI FK+V FSYP
Sbjct: 378 GSSLFGLSSFYSELMKGAGAASRVFELNDRVPLIHPTKGKDPISLAAKEIEFKNVKFSYP 437

Query: 454 TRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLN 513
           +R  + +F ++++KI  G +VCVVGPSG GKSTI+ LLLRFY+  SG I I GQ+I   N
Sbjct: 438 SRSNHTVFTELNLKIIPGEHVCVVGPSGGGKSTISSLLLRFYDVDSGVITIGGQNIKDFN 497

Query: 514 IKSLRRHIGLVQQEPVLMSGTLRDNITYGLTE--TPSKEEIRMVAKQCFCHNFIVKFPHG 571
           ++  RR +G+VQQEP+L +G+++DNI Y L       K  +    +   C  FI  FP G
Sbjct: 498 LRKYRRSLGIVQQEPLLFNGSIKDNICYALPPHIISDKHRVNRALEAANCTRFISNFPDG 557

Query: 572 YDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKS 631
            DT++GP+G  LSGGQKQRIAIARA I  P+IL+LDEATSALD +SE  I        +S
Sbjct: 558 LDTMVGPRGTQLSGGQKQRIAIARAFILDPSILILDEATSALDSQSEDIIAQALRARSES 617

Query: 632 KSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADP 674
             +TI SIAHR+STI  S  +IVL  +G V ETG F +L   P
Sbjct: 618 GKITI-SIAHRISTIEHSNRVIVLSRNGGVSETGAFCDLINQP 659

>NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {ON}
           Anc_1.67
          Length = 714

 Score =  530 bits (1366), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 268/594 (45%), Positives = 399/594 (67%), Gaps = 10/594 (1%)

Query: 87  QKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGLETNEGK 146
           + SG KD+ RL  LA+P+ + + +A+  + +S  + MT+P +IG +LD  K G + NE +
Sbjct: 90  KSSGFKDIQRLFSLARPELRYIALALLFILISSSVSMTVPSIIGKLLDAAKKGQKENEEE 149

Query: 147 DGPISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRANVIK 206
           D    + D+   F G +  +F      L + G +AN GRI++L++  ER+VARLR   +K
Sbjct: 150 DSKTIVPDI--TFFGLTRTQFYTALGVLFLVGAIANTGRIIILKVTGERLVARLRTRTMK 207

Query: 207 KTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQ 266
             + QD+ F D ++VGDLISRL SDA +VS+++TQ VSDG +A+I           +S +
Sbjct: 208 AALDQDATFLDANRVGDLISRLSSDAAIVSKAVTQNVSDGTRAIIQGFVGFGMMGYLSWK 267

Query: 267 LSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKE 326
           L+G+++L  PP+   A ++GRKIR+ S  LQE+ G L++V+EEQL+  +T+Q++V E+ E
Sbjct: 268 LTGVMMLMVPPLGIMALVYGRKIRNLSKQLQESVGGLSKVAEEQLNATKTIQAYVGERLE 327

Query: 327 IHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTA 386
           IHRY+  +R++F +G + A  +  FF +T  +G+I+ + +L  G+ ++  G LT+G+L++
Sbjct: 328 IHRYATEVRNVFRIGLKEAVTSGLFFGSTGLVGNIAMISLLLVGTNMIQSGTLTVGELSS 387

Query: 387 FMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTG--KKFVPGKGEIV 444
           FM+Y  YTGSS+FGL+SFYSELM+G GAA+R+FEL DR P IK T G   K + GK  I 
Sbjct: 388 FMMYAVYTGSSLFGLSSFYSELMKGAGAASRVFELNDRKPLIKSTVGIDPKTLFGK-SIK 446

Query: 445 FKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFI 504
           F++V+F+YP+RP + IF +++++I  G +VC+VG SG GKSTIA LLLR+Y+ ++G I I
Sbjct: 447 FENVSFTYPSRPNHKIFDNLNLEINPGEHVCIVGFSGSGKSTIASLLLRYYDVNNGSIRI 506

Query: 505 DGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYG----LTETPSKEEIRMVAKQCF 560
              DI   +++  RR IG VQQEP L +G++ DNI Y     LT     E +++  KQ  
Sbjct: 507 GDNDIRNFSLRKYRRLIGTVQQEPSLFNGSILDNIIYAIPPELTSEKQHERVQLAIKQAN 566

Query: 561 CHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGA 620
           C+ F+ KFP G  T++GP+GA LSGGQKQRIA+ARA +  PT+L+LDE+TSALD  SE  
Sbjct: 567 CNIFLGKFPDGLQTLVGPRGAQLSGGQKQRIALARAFLLDPTLLILDESTSALDSLSEEL 626

Query: 621 INYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADP 674
           +  T  Q   ++ +T +SIAHRLSTI+ S  +IV+G  GSVVE+G F  L  +P
Sbjct: 627 VAKTL-QARSARGLTTISIAHRLSTIKHSSRVIVIGKYGSVVESGPFDRLIDNP 679

>TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa]
           {ON} Anc_1.67 YLR188W
          Length = 693

 Score =  525 bits (1351), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 279/637 (43%), Positives = 408/637 (64%), Gaps = 16/637 (2%)

Query: 46  ISKRCQLSPLSQIQFQTTR--PLTRSFTSSVRLL-QAKSPKEAEQKSGLKDVVRLLMLAK 102
           ++ + QL+   Q+++ +T+  P+  +  +SV  + +AK        SG KD+ RL  LAK
Sbjct: 42  VAPKIQLTVERQVRWNSTQRAPVNVNSNASVTAVKEAKLSPSDLNGSGFKDIKRLFRLAK 101

Query: 103 PDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGLETNEGKDGPISMADVPPIFMGY 162
           P+   + +A+ L+ +S  + MTIP ++G +LD+ K     +       +  D  P   G 
Sbjct: 102 PETLQIALALVLILISSAVSMTIPTIVGKLLDIAK-----DRKDADDTTEDDEGPKIFGM 156

Query: 163 SIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVG 222
           +  +F     A+ + G  AN GRIV+L+I  ER+VARLR   +K  + QD+ F D ++VG
Sbjct: 157 TTKQFCTALLAVFLVGAAANAGRIVILKITGERLVARLRTRTMKAALDQDATFLDTNRVG 216

Query: 223 DLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSA 282
           DLIS L SDA +V++S+TQ VSDG +A+I           IS QL+ +++L  PP+   A
Sbjct: 217 DLISCLSSDASIVAKSVTQNVSDGTRAVIQGFVGFGMMGYISWQLTSVMILMIPPLGIMA 276

Query: 283 SIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGK 342
            ++GRKIR+ S  LQ + G LT+VSEEQL  V+T+QS+V E+KEIHRY+  +R++FN+G 
Sbjct: 277 VVYGRKIRNLSRQLQTSVGGLTKVSEEQLGAVKTIQSYVGEKKEIHRYATEVRNVFNIGL 336

Query: 343 RAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLT 402
           + A  +  FF +T  +G+IS L +L  G+ ++  G +T+GDL++FM+Y  YTGSS+FGL+
Sbjct: 337 KEALTSGVFFGSTGLVGNISLLALLMVGTNMIQNGLITVGDLSSFMMYAVYTGSSMFGLS 396

Query: 403 SFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVP-GKGEIVFKDVTFSYPTRPGNVIF 461
           SFYSELM+G GAA R+FEL DR P I PT G+  V      I F++V+F+YPTR    IF
Sbjct: 397 SFYSELMKGAGAAARVFELKDRKPLIPPTIGQDPVTLANKTIRFENVSFTYPTRLNQKIF 456

Query: 462 RDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHI 521
             +DI +  G +VC+VGPSG GKST+A LLLR+Y+ + G+I I   +I+  N++  RR +
Sbjct: 457 DGLDITVEPGEHVCIVGPSGSGKSTVASLLLRYYDTNEGRIMIGDHNINSFNVRKYRRLL 516

Query: 522 GLVQQEPVLMSGTLRDNITYGLTETPSKEE----IRMVAKQCFCHNFIVKFPHGYDTVIG 577
           G+VQQEP L +GT+ DNI Y  T  P + +    I     Q  C  F+  FP G  T++G
Sbjct: 517 GIVQQEPQLFNGTILDNILY--TVPPERADNDDLISTAIGQANCSKFLANFPDGLQTLVG 574

Query: 578 PQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIV 637
           P+GA LSGGQKQRIA+ARA +  P++L+LDEATSALD +SE  +  T  ++   + +T +
Sbjct: 575 PRGAQLSGGQKQRIALARAFLLDPSLLILDEATSALDSQSEEIVAQTL-RVRVQRGLTTI 633

Query: 638 SIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADP 674
           SIAHRLSTI+    ++VLG  G VVE+G F+EL  +P
Sbjct: 634 SIAHRLSTIKNCTRVVVLGKCGQVVESGPFEELLRNP 670

>AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR188W
           (MDL1)
          Length = 677

 Score =  521 bits (1342), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 271/589 (46%), Positives = 382/589 (64%), Gaps = 11/589 (1%)

Query: 89  SGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGLETNEGKDG 148
           SG KDV RL  LA+P+ K LV A+ L+ +S  + MTIP VIG +LDV +  +E   G + 
Sbjct: 80  SGAKDVRRLFQLARPELKSLVCALVLIVISGAVSMTIPSVIGKLLDVAREDVEQESGDEE 139

Query: 149 PISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRANVIKKT 208
              +  +P         +F    + +   G +AN GRIV+L+   ER+VARLR   +K  
Sbjct: 140 EAVLYGLPE-------KQFYLALSGIFAVGALANMGRIVVLKTTGERLVARLRTRTMKAA 192

Query: 209 IHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLS 268
           + Q+  F D ++VGDLISRL SDA +VS+S+TQ  SDG +A+I           IS QL+
Sbjct: 193 LEQEGAFLDSNRVGDLISRLSSDASIVSKSITQNTSDGARAVIQGAVGFGMMSYISWQLT 252

Query: 269 GLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIH 328
            ++ L  PP++  A+ +GR++R+ S +LQ   G LT+V+EEQL+  RTVQ++  E++EI 
Sbjct: 253 AVMTLLAPPLVLMAAFYGRRVRNLSRELQTKVGGLTKVAEEQLNATRTVQAYCGERREIR 312

Query: 329 RYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFM 388
           RY+  +R++F+VG + A I+  FF AT  +G+ + L +L  G+ ++  GG+++G+L++FM
Sbjct: 313 RYATEVRNVFDVGLKEALISGSFFGATGFVGNATLLALLLTGTSMIKGGGISVGELSSFM 372

Query: 389 LYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGKGE-IVFKD 447
           +Y  YTGSS+F L+SFYSELM+G GAA R+FEL DR P I PT GK  V   G+ I F  
Sbjct: 373 MYAVYTGSSLFNLSSFYSELMKGAGAAVRVFELNDRKPLIHPTIGKDPVSLTGKTIAFNS 432

Query: 448 VTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQ 507
           V F+YPTRP + +F  MD+ I  G +VC+VGPSG GKST+A LLLRFY+P SG I I G+
Sbjct: 433 VNFAYPTRPHHQVFAGMDLSICPGEHVCIVGPSGGGKSTVASLLLRFYDPISGSITIGGE 492

Query: 508 DISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRM--VAKQCFCHNFI 565
           DI   N+   RR +G+VQQEPVL + ++ +NITY L    +K+  R+    +   C  F+
Sbjct: 493 DIRLFNLSKYRRMMGIVQQEPVLFNASILENITYALPLHLTKDPARIDRALRLSNCSAFV 552

Query: 566 VKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTF 625
             FP G  T +GP+G  LSGGQKQR+A+ARA ++ P IL+LDEATSALD +SE  +  T 
Sbjct: 553 GSFPEGLQTAVGPRGTQLSGGQKQRVALARAFLQDPAILILDEATSALDSKSEDIVASTL 612

Query: 626 GQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADP 674
            Q  +   +TI SIAHR STI+ S  +IVL   G V+ETG +++L  DP
Sbjct: 613 LQRCQEAKITI-SIAHRKSTIQHSTRVIVLDKLGHVLETGTYQQLIGDP 660

>KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 706

 Score =  522 bits (1344), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 284/656 (43%), Positives = 417/656 (63%), Gaps = 21/656 (3%)

Query: 22  SVILRRFTPLVRRLPIVQPSVRSVISKRCQLSPLSQIQFQTTRPLTRSFTSSVRLLQAKS 81
           S ILR    L +R P++    RS    RC ++   Q   +  +P   S T++V+ L+  S
Sbjct: 23  STILRYPINLGKRSPLISFQSRSF--ARCSIA--LQAAKKQGKP---SLTATVKGLRL-S 74

Query: 82  PKEAEQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGLE 141
           P ++ + SG +D+ RL +LAKP+ + + IA+ L+ +S  + M +P VIG +LD+ +   E
Sbjct: 75  PHDS-KASGWQDIKRLFLLAKPETRSMFIALILIILSSAVSMAVPTVIGKLLDIAREEHE 133

Query: 142 TNEGKDGPISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLR 201
             E         +   +  G +  +F      + V G +AN GRIV+L++  ER+VARLR
Sbjct: 134 QPE--------TEKETMIFGLTSTQFYTALGGVFVVGALANVGRIVILKVTGERLVARLR 185

Query: 202 ANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXX 261
              +K  + QD+ F D ++VGDLISRL SDA +VS+S+TQ +SDG +A+I          
Sbjct: 186 TRTMKAALEQDATFLDHNRVGDLISRLSSDAGIVSKSVTQNLSDGTRAVIQGFVGFGMMS 245

Query: 262 SISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFV 321
            IS +L+ +++L  PP+   A ++G++IR+ S  LQ + G+LT+VSEEQLS  +T+Q++ 
Sbjct: 246 FISWKLTCVMMLLAPPLGVMALVYGKRIRNLSRQLQTSVGELTKVSEEQLSATKTIQAYC 305

Query: 322 AEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTI 381
            E+KEIHRY+  +R +F+VG + A  +  FF  T  +G+++ L +L  G+ ++  G +T+
Sbjct: 306 GEKKEIHRYADEVRKVFHVGLKEALTSGAFFGVTGFVGNVALLALLLTGTSMIKTGLMTV 365

Query: 382 GDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGKG 441
           GDL++FM+Y  YTGSS+FGL+SFYSELM+G GAA R+FEL DR P I PT GK  V  + 
Sbjct: 366 GDLSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTIGKDPVTLEN 425

Query: 442 E-IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSG 500
           + I F  V FSYPTRP + IF D++  +  G +VC+VGPSG GKST+A LLLR+Y+  SG
Sbjct: 426 KSIHFNHVKFSYPTRPQHHIFEDLNFTVRPGEHVCIVGPSGGGKSTVASLLLRYYDIGSG 485

Query: 501 QIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRM--VAKQ 558
           +I +   +I   N++  RR +G+VQQEP+L SGT+ DNITY + +    +E R+     Q
Sbjct: 486 EIKLGNDNIRDFNLRKYRRLLGVVQQEPMLFSGTILDNITYAVPQELVNDETRISRAIGQ 545

Query: 559 CFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESE 618
             C  F+  FP G  T +GP+G  LSGGQKQRIA+ARA +  P+IL+LDEATSALD +SE
Sbjct: 546 ANCTKFLANFPDGLQTTVGPRGTQLSGGQKQRIALARAFLLDPSILILDEATSALDSQSE 605

Query: 619 GAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADP 674
             +  +  Q   ++  T +SIAHR+STI+ S  +IVL   G+V ETG F +L A P
Sbjct: 606 EVVAQSLQQ-RSARGKTTISIAHRVSTIQHSSRVIVLNRHGTVAETGSFDKLIAIP 660

>SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 712

 Score =  520 bits (1339), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 274/611 (44%), Positives = 398/611 (65%), Gaps = 24/611 (3%)

Query: 81  SPKEAEQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTG- 139
           SP ++ + SG KD+ RL +LAKP+   +++A+  + +S  + MTIP VIG +LD  K G 
Sbjct: 93  SPHDS-KASGFKDIKRLFLLAKPETNSMILALVFILISGAVSMTIPSVIGKLLDAAKEGH 151

Query: 140 ----------LETNEGKDGPISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLL 189
                     + +++  D     +D   +  G +  +F      + V G  AN GRIVLL
Sbjct: 152 LAGVSASGEGVGSSDSSDNQEDSSD--RLIYGLTFPQFYTALGTIFVVGAFANMGRIVLL 209

Query: 190 RILSERVVARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKA 249
           ++  E++VARLR   +K  + QD+ F D ++VGDLISRL SDA +VS+S+TQ +SDG +A
Sbjct: 210 KVTGEKLVARLRTRTMKAALQQDATFLDNNRVGDLISRLSSDASIVSKSVTQNLSDGARA 269

Query: 250 LICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEE 309
           +I           IS +L+ ++ L  PP+   A ++G+KIR+ S  LQ + G LT+V+EE
Sbjct: 270 VIQGAVGFGMMSFISWKLTCVMTLMAPPLAVMAMVYGKKIRNLSRQLQTSVGGLTKVAEE 329

Query: 310 QLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAY 369
           QLS  RTVQ++  E++EI RY+  +R++FN+G + A  +  FF  T  +G+++ L +L  
Sbjct: 330 QLSAARTVQAYGGEKQEIRRYAGEVRNVFNIGLKEALTSGVFFGVTGFVGNVALLALLLT 389

Query: 370 GSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIK 429
           G+ ++  G +T+GDL++FM+Y  YTGSS+FGL+SFYSELM+G GAA R+FEL DR P I 
Sbjct: 390 GTSMIRSGAITVGDLSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIH 449

Query: 430 PTTGKKFVPGKGEIV-FKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIA 488
           PT G   V  +G+ + F++V F+YPTR  N IF  + + I  G +VC+VGPSG GKSTIA
Sbjct: 450 PTKGVDPVTLQGKTIEFRNVAFAYPTRRENRIFDGLSLDIQPGEHVCIVGPSGGGKSTIA 509

Query: 489 LLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPS 548
            LLLR+Y+  +G+I I GQDI + N++  RR +G+VQQEP+L +GT+ DNITY +    +
Sbjct: 510 SLLLRYYDVDAGRIAIGGQDIRRFNLRKYRRLLGVVQQEPLLFNGTILDNITYAVPGELA 569

Query: 549 KEEIRM--VAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVL 606
            ++ R+     Q  C  F+  FP G +T++GP+GA +SGGQKQRIA+ARA +  P +L+L
Sbjct: 570 GDDSRVSRAIGQANCTKFLANFPDGLETLVGPRGAQMSGGQKQRIALARAFLLDPAVLIL 629

Query: 607 DEATSALDVESEGAINYTFGQLMKSKS---VTIVSIAHRLSTIRRSENIIVLGNDGSVVE 663
           DEATSALD +SE  +     Q ++S+S    T VSIAHRLSTI+ S  +IVL   G V E
Sbjct: 630 DEATSALDSQSEEVV----AQSLRSRSRRGKTTVSIAHRLSTIQHSSRVIVLDRHGGVGE 685

Query: 664 TGKFKELFADP 674
           TG F+EL +DP
Sbjct: 686 TGSFRELISDP 696

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score =  517 bits (1332), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 271/602 (45%), Positives = 396/602 (65%), Gaps = 21/602 (3%)

Query: 80  KSPKEAEQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTG 139
           K   E  + +G+KD+ RL  LAKP+ K +++A+  + +S  + MTIP +IG +LD+ K  
Sbjct: 82  KLSNEVSKSNGMKDIKRLFKLAKPEAKYILLALLFIVISSSVSMTIPTIIGKLLDLAKAD 141

Query: 140 LETN-----EGKDGPISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSE 194
            +         K+  +      P F     Y  LGG   L + G +AN  RIV+L++  E
Sbjct: 142 NDDEDGDNNAKKEKLMIFGLTKPQF-----YTALGG---LFLAGAIANASRIVILKVTGE 193

Query: 195 RVVARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXX 254
           R+VARLR   +K  ++QD+ F D ++VGDLISRL SDA +V++++TQ VSDG +A+I   
Sbjct: 194 RLVARLRTRTMKAALYQDASFLDTNRVGDLISRLSSDASIVAKAVTQNVSDGSRAVIQGF 253

Query: 255 XXXXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGV 314
                   IS +L+ ++++  PP+   A ++GRKIR  S  LQ + G LT+V+EEQL+  
Sbjct: 254 VGFGMMSFISWKLTCVMMIMVPPLGVMALVYGRKIRTLSRQLQASVGGLTKVAEEQLNAT 313

Query: 315 RTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLV 374
           RT+Q++  E  EIHRY+  +R +F+VG + A  +  FF +T  +G+I+ + +L  G+ ++
Sbjct: 314 RTIQAYGGEALEIHRYATEVRKVFDVGLKEAVTSGLFFGSTGLVGNIAMISLLLVGTSMI 373

Query: 375 LQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTG- 433
             G LT+GDL++FM+Y  YTGSS+FGL+ FYSELM+G GAATR+FEL DR P IKPT G 
Sbjct: 374 QYGTLTVGDLSSFMMYAVYTGSSLFGLSGFYSELMKGAGAATRVFELNDRKPLIKPTIGY 433

Query: 434 -KKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLL 492
             K + GK  I F++V+F+YPTRP + I  ++ I I  G +VC+VGPSG GKST++ LLL
Sbjct: 434 DPKSLLGK-SIEFQNVSFAYPTRPTHSILNNLSISIQPGEHVCIVGPSGSGKSTVSSLLL 492

Query: 493 RFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGL----TETPS 548
           R+Y+ S+G I IDGQ+I + N++  RR +G+VQQEP+L +GT+ DNI Y +    T T +
Sbjct: 493 RYYDVSTGSIKIDGQNIKEFNLRKYRRLLGVVQQEPMLFNGTILDNILYAVLSKETLTAN 552

Query: 549 KEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDE 608
             +++   +Q  C  F+  FP G +T++GP+G  LSGGQKQRIA+ARA +  P +L+LDE
Sbjct: 553 SPDVKRALEQANCTKFLKNFPEGVNTLVGPRGTQLSGGQKQRIALARAFLLHPALLILDE 612

Query: 609 ATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFK 668
           ATSALD +SE  +     + ++   +T +SIAHRLSTI+ S  +IVL   GSVVETG F+
Sbjct: 613 ATSALDSQSEEIVAKNLSERVE-LGLTTISIAHRLSTIKHSTRVIVLDKSGSVVETGPFE 671

Query: 669 EL 670
           EL
Sbjct: 672 EL 673

>Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188W
           (REAL)
          Length = 692

 Score =  512 bits (1318), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 284/648 (43%), Positives = 416/648 (64%), Gaps = 27/648 (4%)

Query: 37  IVQPSVR--SVISKRCQLSPLSQ-IQFQTTRPLTRSFTS-SVRLLQAKSPKEAEQKSGLK 92
           IV P VR  S+IS +  L  LSQ I+ Q++    ++ T  +++L  A S     + SG K
Sbjct: 35  IVCPKVRLNSIISHKKAL--LSQSIRLQSSIAEGKASTKPTLKLSDANS-----KSSGFK 87

Query: 93  DVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDV---LKTGLETNEGKDGP 149
           D+ RL +L++P+ K + +A+ L+ +S  + M +P VIG +LDV        +  + +D  
Sbjct: 88  DIKRLFVLSRPESKYIGLALLLILISSSVSMAVPSVIGKLLDVASESDDEEDEEKARDSK 147

Query: 150 ISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRANVIKKTI 209
           +          G +  +F      + V G VAN  RI++L+I  ER+VARLR   +K  +
Sbjct: 148 L---------YGLTKKQFFTALGLVFVIGAVANASRIIILKITGERLVARLRTRTMKAAL 198

Query: 210 HQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSG 269
            QD+ F D ++VGDLISRL SDA +V++S+TQ VSDG +A+I           +S +L+ 
Sbjct: 199 DQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLTC 258

Query: 270 LLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHR 329
           +++L  PP+   A ++G+KIR+ S  LQ + G LT+V+EEQL+  RT+Q++  E+ E+HR
Sbjct: 259 VMMLLAPPLGAMALVYGKKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVHR 318

Query: 330 YSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFML 389
           Y+  +R++F++G + A  +  FF +T  +G+ + L +L  G+ ++  G +TIG+L++FM+
Sbjct: 319 YAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTNMIQSGVMTIGELSSFMM 378

Query: 390 YTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVP-GKGEIVFKDV 448
           Y  YTGSS+FGL+SFYSELM+G GAA R+FEL DR P I PT GK  +      +VFK+V
Sbjct: 379 YAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTIGKDPISLAHKPVVFKNV 438

Query: 449 TFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQD 508
           +F+YPTRP + IF+D++I I  G +VC VGPSG GKSTIA LLLR+Y+ +SG I  D +D
Sbjct: 439 SFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFDDED 498

Query: 509 ISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVA--KQCFCHNFIV 566
           +   N++  RR IG VQQEP+L +GT+ DNI Y +    ++ E R+    +Q  C  F+ 
Sbjct: 499 VRNFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPSEIAEREDRVARAIEQANCTKFLA 558

Query: 567 KFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFG 626
            FP G  T++G +GA LSGGQKQRIA+ARA +  P +L+LDEATSALD +SE  +     
Sbjct: 559 NFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPALLILDEATSALDSQSEEIVAKNL- 617

Query: 627 QLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADP 674
           Q    + +T +SIAHRLSTI+ S  IIVLG  GSVVETG F++L A P
Sbjct: 618 QKRVERGLTTISIAHRLSTIKHSTRIIVLGKHGSVVETGSFRDLIAIP 665

>YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}
           MDL1Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, mediates export of peptides
           generated upon proteolysis of mitochondrial proteins,
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 695

 Score =  510 bits (1313), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 266/591 (45%), Positives = 392/591 (66%), Gaps = 11/591 (1%)

Query: 87  QKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGLETNEGK 146
           + SG KD+ RL +L+KP+ K + +A+ L+ +S  + M +P VIG +LD+       ++G+
Sbjct: 82  KSSGFKDIKRLFVLSKPESKYIGLALLLILISSSVSMAVPSVIGKLLDLA----SESDGE 137

Query: 147 DGPISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRANVIK 206
           D   S ++      G++  +F     A+ + G VAN  RI++L++  ER+VARLR   +K
Sbjct: 138 DEEGSKSNK---LYGFTKKQFFTALGAVFIIGAVANASRIIILKVTGERLVARLRTRTMK 194

Query: 207 KTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQ 266
             + QD+ F D ++VGDLISRL SDA +V++S+TQ VSDG +A+I           +S +
Sbjct: 195 AALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWK 254

Query: 267 LSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKE 326
           L+ ++++  PP+   A I+GRKIR+ S  LQ + G LT+V+EEQL+  RT+Q++  E+ E
Sbjct: 255 LTCVMMILAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNE 314

Query: 327 IHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTA 386
           + RY+  +R++F++G + A  +  FF +T  +G+ + L +L  G+ ++  G +T+G+L++
Sbjct: 315 VRRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTSMIQSGSMTVGELSS 374

Query: 387 FMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVP-GKGEIVF 445
           FM+Y  YTGSS+FGL+SFYSELM+G GAA R+FEL DR P I+PT GK  V   +  IVF
Sbjct: 375 FMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAQKPIVF 434

Query: 446 KDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFID 505
           K+V+F+YPTRP + IF+D++I I  G +VC VGPSG GKSTIA LLLR+Y+ +SG I   
Sbjct: 435 KNVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFG 494

Query: 506 GQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEE--IRMVAKQCFCHN 563
            +DI   N++  RR IG VQQEP+L +GT+ DNI Y +    ++++  IR    +  C  
Sbjct: 495 DEDIRNFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPPEIAEQDDRIRRAIGKANCTK 554

Query: 564 FIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINY 623
           F+  FP G  T++G +GA LSGGQKQRIA+ARA +  P +L+LDEATSALD +SE  +  
Sbjct: 555 FLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIVAK 614

Query: 624 TFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADP 674
              Q    +  T +SIAHRLSTI+ S  +IVLG  GSVVETG F++L A P
Sbjct: 615 NL-QRRVERGFTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFRDLIAIP 664

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]
           {ON} similar to uniprot|P33310 Saccharomyces cerevisiae
           YLR188W MDL1 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane mediates
           export of peptides generated upon proteolysis of
           mitochondrial proteins plays a role in the regulation of
           cellular resistance to oxidative stress
          Length = 714

 Score =  506 bits (1302), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 266/604 (44%), Positives = 389/604 (64%), Gaps = 23/604 (3%)

Query: 86  EQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGLETNEG 145
           +  SG +D+ RLL LA+P+   ++ A+ L+ +S  + M +P VIG +LD+ K+   +   
Sbjct: 85  KNSSGFRDITRLLGLARPEVWYIMGALCLIVISSTVSMLLPSVIGKLLDLAKSSSPSENE 144

Query: 146 KDGPISMADVPPIFMGYSIYEF--------LGGFAALMVFGIVANYGRIVLLRILSERVV 197
           K       D        +IY F        +GG   + V G  AN GRI++L++  ER+V
Sbjct: 145 KQESGDGDDKDKDKEEGTIYGFTPKQFCVIMGG---IFVAGAFANCGRIIILKVTGERLV 201

Query: 198 ARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXX 257
           ARLR   +K  + QDS F DR++VGDLISRL SD+ +V++S+TQ VSDG +A+I      
Sbjct: 202 ARLRTRTMKAALDQDSAFLDRNRVGDLISRLSSDSSIVAKSLTQNVSDGTRAVIQGFVGF 261

Query: 258 XXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTV 317
                IS QL+ ++ L  PP+   A I+G+KIR+ S  LQ + G LT+V+EEQL   +T+
Sbjct: 262 GMMTYISWQLTCVMGLMLPPIGAMAIIYGKKIRNLSKQLQTSVGGLTKVAEEQLGATKTI 321

Query: 318 QSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQG 377
           QS+V E+KEI RY+  +R +F++G + A  +  FF +T  +G+IS L +L  G+ ++  G
Sbjct: 322 QSYVGEKKEIRRYAKEVRQVFDIGLKEALTSGMFFGSTGFVGNISLLALLMSGASMIQSG 381

Query: 378 GLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGK--- 434
            +T+GDL++FM+Y  YTG S+FGL++FYSELM+G GAA R+FEL DR P+I PT GK   
Sbjct: 382 LITVGDLSSFMMYAVYTGGSMFGLSNFYSELMKGAGAAARVFELNDRKPAIAPTLGKGPT 441

Query: 435 --KFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLL 492
             + +P    I FKDV+F+YPTR    IF  +++ I  G ++C+ GPSG GKSTIA LL+
Sbjct: 442 SIRNLP----ISFKDVSFTYPTRLNKKIFNHLNLTIQPGEHICIAGPSGSGKSTIASLLV 497

Query: 493 RFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEI 552
           R+Y+   G I I   D+   N++  RR IG+V QEPVL +GT+ +NI Y +  + +++E 
Sbjct: 498 RYYDVDQGGISIGDTDLRTFNLRKYRRLIGVVHQEPVLFNGTILENILYAVPPSVAQDER 557

Query: 553 RMVAK--QCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEAT 610
           R+ A   +  C  F+  FP G +T++GP+GA LSGGQKQR+A+ARA +  P +LVLDEAT
Sbjct: 558 RVSAAIGKANCSKFLSNFPDGLETLVGPRGAQLSGGQKQRVALARAFLLDPALLVLDEAT 617

Query: 611 SALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKEL 670
           SALD +SE  +  T  + ++ + +T +SIAHR+STI  S  ++VLG DG VVE+G F+EL
Sbjct: 618 SALDSQSEEIVARTLQERVR-RGLTTISIAHRISTIAHSTRVVVLGRDGFVVESGPFQEL 676

Query: 671 FADP 674
              P
Sbjct: 677 IDRP 680

>KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 734

 Score =  506 bits (1302), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 272/630 (43%), Positives = 394/630 (62%), Gaps = 24/630 (3%)

Query: 67  TRSFTSSVRLLQAKSPK-------EAEQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSC 119
            R+    VR   + + K       E +  S  KD+ RL  LA+P+ K +  A+ L+ +S 
Sbjct: 53  NRTIMRQVRWQHSNASKPSTTLTSEEQNSSSWKDIKRLFQLARPESKSMFFALVLIILSS 112

Query: 120 GIGMTIPKVIGMILDVLKTGLETNEGKDGPISMA------------DVPPIFMGYSIYEF 167
            + M +P VIG ++DV K    ++   DG    A            D   + +G ++ +F
Sbjct: 113 SVSMLVPGVIGKLMDVAKEDGTSSSEADGKRGDATDKTDGSTAADTDSEKLILGLTLPQF 172

Query: 168 LGGFAALMVFGIVANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVGDLISR 227
            GG  +L V G  AN GRIV+L++  E++VARLR   +K  + QD+ F D +KVGDLISR
Sbjct: 173 YGGLFSLFVVGAAANMGRIVILKVTGEKLVARLRTRTLKAALQQDASFLDNNKVGDLISR 232

Query: 228 LGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIFGR 287
           L SDA +VS+S+TQ +SDG ++LI           IS +L+ +++L  PP+   A ++GR
Sbjct: 233 LSSDASIVSKSLTQNMSDGTRSLIQGFVGFGMMSYISWKLTCVMMLLAPPLAVMALVYGR 292

Query: 288 KIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYI 347
           KIR+ S  LQ + G LT+ +EEQLS  RT+Q++  E++ I  Y+  +R ++ VG + A  
Sbjct: 293 KIRNLSRTLQASVGGLTKAAEEQLSATRTIQAYGGEKQAIRHYAKEVRQVYQVGLKEALT 352

Query: 348 NAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSE 407
           +  FF  T  +G+ + L +L  G+ ++  G +T+GDL++FM+Y  YTGSS+FG++SFYSE
Sbjct: 353 SGGFFGLTGLVGNSAVLALLLTGTSMISTGAMTVGDLSSFMIYAVYTGSSLFGMSSFYSE 412

Query: 408 LMQGVGAATRLFELTDRVPSIKPTTGKKFVP-GKGEIVFKDVTFSYPTRPGNVIFRDMDI 466
           LM+G GAA R+FEL DR P+I PT G+  V   +  + FK V F+YPTR  +VIF D+ +
Sbjct: 413 LMKGAGAAARVFELNDRKPAIHPTKGRDPVSLARKPVEFKKVHFAYPTRRQHVIFEDLSL 472

Query: 467 KIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQ 526
           +I  G +VC+VGPSG GKST+A LLLRFY+  +G I I GQ+I+  N++  RR +G+VQQ
Sbjct: 473 RIDPGEHVCIVGPSGGGKSTVASLLLRFYDVDAGAILIGGQNIADFNLRKYRRLVGIVQQ 532

Query: 527 EPVLMSGTLRDNITYGLTETPSKEEIRMVAK---QCFCHNFIVKFPHGYDTVIGPQGALL 583
           EP+L +GT+ +NI Y + +    EE   VA+   Q  C  F+  FP G  T++GP+G  L
Sbjct: 533 EPMLFNGTILENILYTVPQRLLNEEDGRVARAIGQANCSAFLSSFPDGLQTMVGPRGTQL 592

Query: 584 SGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRL 643
           SGGQKQRIA+ARA +  P +L+LDEATSALD  SE  I  T      ++  T +SIAHR+
Sbjct: 593 SGGQKQRIALARAFLLDPDLLILDEATSALDSRSEEVIARTL-HSRTTRGKTTISIAHRV 651

Query: 644 STIRRSENIIVLGNDGSVVETGKFKELFAD 673
           STI+ S  +IVLG +G VVETG F EL ++
Sbjct: 652 STIQHSTRVIVLGRNGGVVETGTFDELASN 681

>Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188W
           (REAL)
          Length = 693

 Score =  504 bits (1298), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 283/668 (42%), Positives = 419/668 (62%), Gaps = 27/668 (4%)

Query: 22  SVILRRFTPLVRRLPIVQPSVRSVISKRCQLSPLSQIQ----FQTTRPLTRSFTSSVRLL 77
           SV+ R+FT   R L + +P ++ ++  +    P +       FQT R    S     +  
Sbjct: 9   SVLRRQFTS-SRALYLTKPLLKPIVYPKVWAKPTTHHNKPSMFQTIR-FQSSIIDGKKTA 66

Query: 78  QAKSP----KEAEQKS-GLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMI 132
              SP     +A+ KS G KD+ RL +L++P+   + +A+ L+ +S  + M +P VIG +
Sbjct: 67  SPDSPTLKLSDADSKSSGFKDIKRLFVLSRPESGYIGLALLLILISSSVSMAVPSVIGKL 126

Query: 133 LDVLKTGLETNEG---KDGPISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLL 189
           LD+     +  +    KD  +          G S  +F     A+ + G +AN  RI++L
Sbjct: 127 LDLASDDDDEEDAKETKDNKL---------YGLSKRQFFTALGAVFLIGAIANASRIIIL 177

Query: 190 RILSERVVARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKA 249
           ++  ER+VARLR   +K  + QD+ F D ++VGDLISRL SDA +V++S+TQ VSDG +A
Sbjct: 178 KVTGERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRA 237

Query: 250 LICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEE 309
           +I           +S +L+ ++++  PP+   A I+GRKIR+ S  LQ + G LT+V+EE
Sbjct: 238 IIQGFVGFGMMSFLSWKLTCVMMVLAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEE 297

Query: 310 QLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAY 369
           QL+  RT+Q++  E+ E+ RY+  +R++F+VG + A  +  FF +T  +G+ + L +L  
Sbjct: 298 QLNATRTIQAYGGEKNEVRRYAKEVRNVFHVGLKEAVTSGLFFGSTGLVGNAAMLSLLLV 357

Query: 370 GSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIK 429
           G+ ++  G +T+G+LT+FM+Y  YTGSS+FGL+SFYSELM+G GAA R+FEL DR P I+
Sbjct: 358 GTNMIQSGAMTVGELTSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIR 417

Query: 430 PTTGKKFVP-GKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIA 488
           PT GK  V      IVFKDV+F+YPTRP + IF+D++I I  G +VC VGPSG GKSTIA
Sbjct: 418 PTIGKDPVSLAHKPIVFKDVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIA 477

Query: 489 LLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPS 548
            LLLR+Y+ S+G I    +DI   N++  RR +G VQQEP+L +GT+ DNI Y +    +
Sbjct: 478 SLLLRYYDTSAGSIDFGDEDIKNFNLRKYRRLMGYVQQEPLLFNGTILDNILYCIPPEIA 537

Query: 549 KEEIRMVAK--QCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVL 606
           ++E R+     Q  C  F+  FP G  T++G +GA LSGGQKQRIA+ARA +  P +L+L
Sbjct: 538 EQEDRVARAIGQANCTKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLIL 597

Query: 607 DEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGK 666
           DEATSALD +SE  +     + +K + +T +SIAHRLSTI+ S  +IVLG  GSVVETG 
Sbjct: 598 DEATSALDSQSEEVVAKNLQRRVK-RGLTTISIAHRLSTIKHSTRVIVLGKHGSVVETGS 656

Query: 667 FKELFADP 674
           F++L + P
Sbjct: 657 FQDLISIP 664

>Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188W
           (REAL)
          Length = 696

 Score =  503 bits (1294), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 274/625 (43%), Positives = 404/625 (64%), Gaps = 17/625 (2%)

Query: 55  LSQ-IQFQTTRPLTRSFTS-SVRLLQAKSPKEAEQKSGLKDVVRLLMLAKPDWKLLVIAI 112
           LSQ I+ Q++    ++FT  +++L  A S     + SG KD+ RL +L+KP+ K + +A+
Sbjct: 53  LSQSIRLQSSVSEGKTFTKPTLKLSDANS-----KSSGFKDIKRLFVLSKPESKYIGLAL 107

Query: 113 TLLTVSCGIGMTIPKVIGMILDVLKTGLETNEGKDGPISMADVPPIFMGYSIYEFLGGFA 172
            L+ +S  + M +P VIG +LD+       +E +D             G +  +F     
Sbjct: 108 LLILISSSVSMAVPSVIGKLLDL------ASETEDEEKEEKAKSNKLYGLTKRQFFTALG 161

Query: 173 ALMVFGIVANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDA 232
            + + G VAN  RI++L++  ER+VARLR   +K  + QD+ F D ++VGDLISRL SDA
Sbjct: 162 LVFIIGAVANASRIIILKVTGERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDA 221

Query: 233 YVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDT 292
            +V++S+TQ VSDG +A+I           +S +L+ ++++  PP+   A I+GRKIR+ 
Sbjct: 222 SIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLTCVMMVLAPPLGAMALIYGRKIRNL 281

Query: 293 STDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFF 352
           S  LQ + G LT+V+EEQL+  RT+Q++  E+ E+ RY+  +R++F++G + A  +  FF
Sbjct: 282 SRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVRRYAKEVRNVFHIGLKEAVTSGLFF 341

Query: 353 TATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGV 412
            +T  +G+ + L +L  G+ ++  G +T+G+L++FM+Y  YTGSS+FGL+SFYSELM+G 
Sbjct: 342 GSTGLVGNTAMLSLLLVGTSMIQSGSMTVGELSSFMMYAVYTGSSLFGLSSFYSELMKGA 401

Query: 413 GAATRLFELTDRVPSIKPTTGKKFVP-GKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAG 471
           GAA R+FEL DR P I+PT GK  V   +  IVFK+V+F+YPTRP + IF+D++I I  G
Sbjct: 402 GAAARVFELNDRKPLIRPTIGKDPVSLAQKPIVFKNVSFTYPTRPKHQIFKDLNITINPG 461

Query: 472 SNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLM 531
            +VC VGPSG GKSTIA LLLR+Y+ +SG I    +DI   N++  RR IG VQQEP+L 
Sbjct: 462 EHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFGDEDIRSFNLRKYRRLIGYVQQEPLLF 521

Query: 532 SGTLRDNITYGLTETPSKEEIRM--VAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQ 589
           +GT+ DNI Y +    +++E R+     Q  C  F+  FP G  T +G +GA LSGGQKQ
Sbjct: 522 NGTILDNILYCIPPEIAEQEDRIGRAIGQANCTKFLANFPDGLQTTVGARGAQLSGGQKQ 581

Query: 590 RIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRS 649
           RIA+ARA +  P +L+LDEATSALD +SE  +     Q    + +T +SIAHRLSTI+ S
Sbjct: 582 RIALARAFLLDPAVLILDEATSALDSQSEEIVAKNL-QRRVERGLTTISIAHRLSTIKHS 640

Query: 650 ENIIVLGNDGSVVETGKFKELFADP 674
             ++VLG  GSVVETG F++L A P
Sbjct: 641 TRVVVLGKHGSVVETGSFQDLIAIP 665

>Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188W
           (MDL1) - ATP-binding cassette (ABC) transporter family
           member [contig 118] FULL
          Length = 706

 Score =  496 bits (1277), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 272/647 (42%), Positives = 406/647 (62%), Gaps = 17/647 (2%)

Query: 38  VQP-SVRSVISKRCQLSPLSQIQFQTTRPLTRSFTSSVRLLQAKSPKEAEQKSGLKDVVR 96
           V+P ++ +V  K   + P+S I    +R +  +   S +     +P+E    S  KD+ R
Sbjct: 33  VRPLTLTTVPCKSAWVKPISLIH--VSRQIRWNHAESRQPSSTLTPEE-HNSSSWKDIKR 89

Query: 97  LLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGLETN---EGKDGPISMA 153
           L  LA+P+ + +  A+ L+ +S  + M +P VIG ++D  K   + +   E      +  
Sbjct: 90  LFQLARPESRSMFFALALIIISSSVSMLVPGVIGKLMDAAKDDQQASKLVENDSDAAAPD 149

Query: 154 DVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRANVIKKTIHQDS 213
                  G ++ +F G   ++ V G  AN GRIV+L++  E++VARLR   +K ++ QD+
Sbjct: 150 ADGRQIFGLTMPQFYGVLFSVFVVGAAANMGRIVILKVTGEKLVARLRTRTLKASLQQDA 209

Query: 214 EFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLL 273
            F D +KVGDLISRL SDA +VS+S+TQ +SDG ++LI           IS +L+ +++L
Sbjct: 210 SFLDNNKVGDLISRLSSDASIVSKSLTQNMSDGTRSLIQGFVGFGMMSYISWKLTCVMML 269

Query: 274 FTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHA 333
             PP+   A I+G++IR+ S  LQ + G LT+ +EEQLS  RT+Q++  E+  IH+Y+  
Sbjct: 270 LAPPLAAMALIYGKRIRNLSRTLQASVGGLTKAAEEQLSATRTIQAYGGEKHAIHQYAKE 329

Query: 334 IRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEY 393
           +R ++ VG + A  +  FF  T  +G+++ L +L  G+ ++  G +T+GDL++FM+Y  Y
Sbjct: 330 VRQVYQVGLKEALTSGAFFGLTGLVGNVAVLALLLTGTSMIRTGAMTLGDLSSFMIYAVY 389

Query: 394 TGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGKGEIV-FKDVTFSY 452
           TGSS+FG++SFYSELM+G GAA R+FEL DR P+I PT G   V   G+ V F++V F+Y
Sbjct: 390 TGSSLFGMSSFYSELMKGAGAAARVFELNDRRPAIHPTRGIDPVSLAGKPVEFQNVKFAY 449

Query: 453 PTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKL 512
           PTR  + IF ++  +I AG +VC+VGPSG GKST+A LLLRFY+  +G I I GQ I+  
Sbjct: 450 PTRHQHTIFENLTFRINAGEHVCIVGPSGGGKSTVASLLLRFYDVDTGAITIGGQSIASF 509

Query: 513 NIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAK--QCFCHNFIVKFPH 570
           N++  RR +G+VQQEP+L +GT+ DNI Y + ++   +E R+     Q  C  F+  FP 
Sbjct: 510 NLRKYRRMLGVVQQEPMLFNGTILDNIVYSVPQSLLNDENRVARAIGQANCSAFLSSFPD 569

Query: 571 GYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMK 630
           G  T++GP+G  LSGGQKQRIA+ARA +  P +L+LDEATSALD  SE  +     + + 
Sbjct: 570 GLQTLVGPRGTQLSGGQKQRIALARAFLLDPDLLILDEATSALDSRSEEVV----ARALY 625

Query: 631 SKSV---TIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADP 674
           S+S    T +SIAHR+STI+ S  +IVLG  G VVETG F EL +DP
Sbjct: 626 SRSTRGKTTISIAHRVSTIQHSSRVIVLGRSGYVVETGTFDELISDP 672

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
           YLR188W
          Length = 707

 Score =  495 bits (1274), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 258/596 (43%), Positives = 382/596 (64%), Gaps = 17/596 (2%)

Query: 92  KDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGLETNEGKD---- 147
           +D+  L  LAKP+   ++ ++ L+ ++  + M +P VIG +LD+  TG+E    KD    
Sbjct: 97  EDIYNLFKLAKPEKWYIIASMGLIFITSAVSMLVPSVIGKLLDI-STGIEFASNKDENDE 155

Query: 148 --------GPISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVAR 199
                         +   +  GY+   F  G   + V G +AN GRI++L++  ER+VAR
Sbjct: 156 SSKEDKNENENENENKQTLIYGYTPLVFFSGLGVIFVVGAIANTGRIIILKLTGERIVAR 215

Query: 200 LRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXX 259
           LR   +K  + QD +F D +KVGDLISRL SD+ +VS ++T+ VSDG +A+I        
Sbjct: 216 LRTRTMKNILKQDGKFQDSNKVGDLISRLSSDSSIVSNAVTRNVSDGARAVIQGCVGVGM 275

Query: 260 XXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQS 319
              IS +LSG++L   PP+   A I+GRKIR+ S  LQE+ G LT++SEEQL+G RT+QS
Sbjct: 276 MSFISLKLSGVMLFMVPPIGVLAMIYGRKIRNISKKLQESVGSLTKISEEQLNGTRTIQS 335

Query: 320 FVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGL 379
           +V E+ EIH+Y+  +R +++VG   A  +  FF  T  +G+ + L +L  G  ++  G L
Sbjct: 336 YVGEKLEIHKYAKEVRKVYHVGLNEAVASGLFFGVTGLIGNGAMLSLLYVGCNMISNGTL 395

Query: 380 TIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVPG 439
           +IG L++FM+Y  YTGSS+FGL+SFYSE+M+G GAA+R+FE+   VP I  T G   +  
Sbjct: 396 SIGGLSSFMMYAVYTGSSLFGLSSFYSEIMKGSGAASRIFEINKYVPDINATKGIDPISF 455

Query: 440 KGE-IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPS 498
           + + I F+ + F+YPTR G++IF+D++IKI  G +VC++GPSG GKSTI+ LLLR+Y+P 
Sbjct: 456 QDKPIEFEHIKFAYPTRSGHMIFQDLNIKINPGEHVCIIGPSGSGKSTISSLLLRYYDPL 515

Query: 499 SGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTE--TPSKEEIRMVA 556
           +G I I G+DI + +++  R+ +G+V QEPVL +GT+ +NI Y + E     KE +    
Sbjct: 516 AGTISIGGKDIKEYSLRKYRKLMGVVHQEPVLFNGTILENILYNVPEEIANDKERLSNAI 575

Query: 557 KQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVE 616
           +   C+ F+   P G +T +GP+G  LSGGQKQR+A+ARA + +PT+LVLDEATSALD  
Sbjct: 576 ESSNCNKFLNTLPLGLETPVGPRGTQLSGGQKQRVALARAFLLEPTLLVLDEATSALDPR 635

Query: 617 SEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFA 672
           SE  +  T  Q   +K  T +SIAHR+STI+ S  ++VL   G VVETG ++EL  
Sbjct: 636 SESIVAQTLKQRC-AKGFTTISIAHRVSTIKHSSRVVVLDKVGHVVETGPYEELLG 690

>CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar to
           uniprot|P33310 Saccharomyces cerevisiae YLR188w MDL1 or
           uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 608

 Score =  466 bits (1198), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 256/580 (44%), Positives = 366/580 (63%), Gaps = 28/580 (4%)

Query: 94  VVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGLETNEGKDGPISMA 153
           V +LL LAKP+ K +  A+ L+ VS  + M++P VIG ++D   T        D PI   
Sbjct: 34  VKQLLRLAKPERKYIAGAVGLIAVSSAVSMSLPSVIGTLIDHAST-------PDAPI--- 83

Query: 154 DVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRANVIKKTIHQDS 213
                  G +  +FL    ++ V G +AN GRI++L+I  E++VARLR   +K  + QD+
Sbjct: 84  ------YGLTRNQFLLALGSVFVVGAIANSGRIIILKITGEKLVARLRTKTMKSMLSQDA 137

Query: 214 EFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLL 273
            F D+H+VGDLISRL SDA +VS+S+T  +SDG +A +           IS +L+ ++ +
Sbjct: 138 TFLDKHRVGDLISRLSSDASIVSKSVTSNLSDGCRATLQGVVGIGMMTYISLKLTTVMTM 197

Query: 274 FTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHA 333
             PP+   A ++G KI+  S  LQ+  GQL++ SEEQL+ ++TVQ++  E+KE+ RYS+ 
Sbjct: 198 MVPPLGILAMLYGGKIKKISRQLQDKVGQLSKTSEEQLNSLKTVQAYAGERKELQRYSNE 257

Query: 334 IRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEY 393
           +R +FN+G + A  +A FF +T  +G+I+ + +L  G+       +T+G+L++FM+Y  Y
Sbjct: 258 VRSVFNIGVKEAVASALFFGSTGLIGNIAMIGLLLVGTA---DSSITLGELSSFMMYGVY 314

Query: 394 TGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTG---KKFVPGKGEIVFKDVTF 450
           TGSSVFGLT FYSELM+G GAA R+ EL +    I PT G    K + G   I F +V+F
Sbjct: 315 TGSSVFGLTGFYSELMKGCGAAERVLELQNMKTKISPTKGISPPKTLKGL-PITFNNVSF 373

Query: 451 SYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDIS 510
           +Y    G  +  +M+ +I  G +VC VG SG GKSTI+ LLLR+Y   SG I I   DIS
Sbjct: 374 AYSN--GKSVLSEMNFQIHPGEHVCFVGGSGCGKSTISSLLLRYYRTGSGNISIGNYDIS 431

Query: 511 KLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPH 570
             N++  RR +G+VQQEP+L +GT+ DNITYGL +  S  ++ M  K   C  FI +   
Sbjct: 432 AFNLRKYRRMLGVVQQEPLLFNGTILDNITYGLHD-KSLTDLNMALKAANCDQFIKESHM 490

Query: 571 GYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMK 630
           G DT++GP+GA LSGGQ+QRIA+AR  ++ P IL+LDEATSALD +SE  IN    Q  +
Sbjct: 491 GLDTLVGPRGAQLSGGQRQRIALARVFLQNPDILILDEATSALDTKSEDIINKEL-QRRQ 549

Query: 631 SKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKEL 670
              +T +SIAHRLSTIR S  +IV+  DG VVE+G F +L
Sbjct: 550 EAGMTTISIAHRLSTIRHSSRVIVI-EDGRVVESGSFDQL 588

>Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa]
           {ON} YMR301C (ATM1) - mitochondrial ABC transporter
           protein [contig 73] FULL
          Length = 719

 Score =  216 bits (550), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 197/669 (29%), Positives = 318/669 (47%), Gaps = 52/669 (7%)

Query: 27  RFTPL----VRRLPIVQP---SVRSVISKRCQLSPLSQIQFQTTRPLTRSFTSSVRLLQA 79
           R +PL    + RLP   P   S+R+  + +  L  + ++     +PL +  T SV+  ++
Sbjct: 53  RGSPLLMSSITRLPFSAPRVNSLRAFSANKAYL--MDKVTTSLKKPLPK-LTESVKD-KS 108

Query: 80  KSPKEAEQKSGLKDVVRLLMLAKPDWKL---LVIAITLLTVSCGIGMTIPKVIGMILDVL 136
           K+P  +E K  LKD+ + +     D K+   ++IA+ LL  S  + + +P     I+D +
Sbjct: 109 KAPTISELKI-LKDLFKYIW-PSGDNKVKIRVLIALGLLVGSKLLNVQVPFFFKQIVDSM 166

Query: 137 KTGLETNEGKDGPISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERV 196
                  E  D       V PI +G  I  +       ++FG + N     +   + +  
Sbjct: 167 NI-----EWTDA----TSVLPIAIGSMILSYGAARFGSVLFGELRN----AIFASVGQSA 213

Query: 197 VARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXX 256
           + R+     +  +  D  +    + G L   +      +S  ++  V   F  +      
Sbjct: 214 ITRVSLQTFQHLMKLDLGWHLSRQTGGLTRAMDRGTKGISYVLSAMV---FHIIPITVEI 270

Query: 257 XXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQE----ATGQLTRVSEEQLS 312
                 ++ Q  G     T   +   SIF  K     T+ ++    A  +   V+ + L 
Sbjct: 271 GAVCGILTYQFGGSFAAMTFSTMLLYSIFTFKTTAWRTEFRKSANKADNKAASVAVDSLI 330

Query: 313 GVRTVQSFVAEQKEIHRYSHAI---RDI-FNVGKRAAYINA-QFFTATSSLGDISFLVVL 367
               V+ F  EQ   ++Y  ++   RD    V +  A++N+ Q    TS+L  + ++   
Sbjct: 331 NFEAVKYFNNEQYLANKYHKSLAQYRDSQIKVAQSLAFLNSGQNLIFTSALTAMMYM--- 387

Query: 368 AYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPS 427
             G   V+ G L++GDL             +  L S Y EL Q +     LF+L     S
Sbjct: 388 --GCTGVMSGELSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFQLQRNKVS 445

Query: 428 IKPTTGKKFVPGK--GEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKS 485
           I+ +     +P     EIVFK+V+F Y   P  +I ++    IP GS   +VGPSG GKS
Sbjct: 446 IQNSKKPLMLPPNVPSEIVFKNVSFGYD--PDRLILKNASFTIPTGSKTAIVGPSGSGKS 503

Query: 486 TIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTE 545
           TI  L+ RFY+P  G+I +DG+D+ +L+I+SLRR IG+V Q+  L + ++ DN+ +G  +
Sbjct: 504 TILKLVFRFYDPIEGRILLDGKDVRELDIESLRRSIGVVPQDTPLFNESIWDNVKFGRID 563

Query: 546 TPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILV 605
             + +EI     +      I + P G DT++G +G ++SGG+KQR+AIAR L+K   I+ 
Sbjct: 564 A-TDQEIERAIDRAQLRALIRQLPKGRDTIVGERGLMISGGEKQRLAIARVLLKDAPIMF 622

Query: 606 LDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETG 665
            DEATSALD  +E A+  T  +   + S T V IAHRL TI  ++ IIVL + G V E G
Sbjct: 623 FDEATSALDTHTEQALLRTIKENFTTGSKTSVYIAHRLRTIADADKIIVLEH-GRVKEEG 681

Query: 666 KFKELFADP 674
           K  EL A P
Sbjct: 682 KHAELLATP 690

>KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 694

 Score =  214 bits (544), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 149/416 (35%), Positives = 224/416 (53%), Gaps = 26/416 (6%)

Query: 272 LLFTPPVLFSASIFGRKIRDTSTDLQE----ATGQLTRVSEEQLSGVRTVQSFVAEQKEI 327
           + FT  +L+S  IF  K     T+ ++    A  +   V+ + L     V+ F  EQ   
Sbjct: 260 MTFTTMLLYS--IFTFKTTAWRTEFRKSANKADNKAATVAVDSLINFEAVKYFNNEQFLA 317

Query: 328 HRYSHAI---RDI-FNVGKRAAYINA-QFFTATSSLGDISFLVVLAYGSYLVLQGGLTIG 382
           ++Y +++   RD    V +  A++NA Q F  TS+L  + ++     G   V+ G L++G
Sbjct: 318 NKYHNSLAQYRDSQIKVAQSLAFLNAGQNFIFTSALTAMMYM-----GCTGVISGTLSVG 372

Query: 383 DLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSI----KPTTGKKFVP 438
           DL             +  L S Y EL Q +     LF+L      I    KP       P
Sbjct: 373 DLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFQLQRNKVKIQNKEKPLMLSSQRP 432

Query: 439 GKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPS 498
            K  IVF++V+F Y   P  +I ++    +PAG    +VGPSG GKSTI  L+ RFY+P 
Sbjct: 433 SK--IVFENVSFGYD--PDRMILKNSSFTMPAGWKTAIVGPSGSGKSTILKLVFRFYDPQ 488

Query: 499 SGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQ 558
            G+I +DG+D+ +L+I+SLRR IG+V Q+  L + ++ +N+ +G   + S EEIR+  ++
Sbjct: 489 EGRILVDGKDVRELDIESLRRAIGVVPQDTPLFNDSIWENVRFGKI-SASDEEIRLAVEK 547

Query: 559 CFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESE 618
               + + + P G DT++G +G ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E
Sbjct: 548 AQLESLVDQLPKGRDTIVGERGLMISGGEKQRLAIARVLLKDAPIMFFDEATSALDTHTE 607

Query: 619 GAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADP 674
            A+  T      + S T V IAHRL TI  ++ IIV+   G V E GK  EL A P
Sbjct: 608 QALLRTIKDNFPTGSKTSVYIAHRLRTIADADKIIVI-QQGQVKEEGKHAELLAKP 662

>SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of
           iron-sulfur (Fe/S) clusters to the cytosol member of the
           ATP-binding cassette (ABC) transporter family
          Length = 700

 Score =  207 bits (528), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 140/403 (34%), Positives = 212/403 (52%), Gaps = 20/403 (4%)

Query: 283 SIFGRKIRDTSTDLQE----ATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIF 338
           SIF  K     T+ +     A  +   V+ + L     V+ F  E+    +Y +++ +  
Sbjct: 277 SIFTFKTTAWRTEFRRSANRADNKAASVALDSLINFEAVKYFNNERYLADKYHNSLTNYT 336

Query: 339 N----VGKRAAYINA-QFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEY 393
           N    V +  A++N+ Q    TS+L  + ++     G   V+ G L++GDL         
Sbjct: 337 NSQIKVAQSLAFLNSGQNLIFTSALTAMMYM-----GCTGVMSGDLSVGDLVLINQLVFQ 391

Query: 394 TGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGKG--EIVFKDVTFS 451
               +  L S Y EL Q +     LF+L     +I+ +     +P     EI F++VTF 
Sbjct: 392 LSVPLNFLGSVYRELKQSLIDMESLFKLQKNKVNIQNSKTPLMLPKDKPCEIKFENVTFG 451

Query: 452 YPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISK 511
           Y   P   I  + +  +PAG    +VGPSG GKSTI  L+ RFY+P  G+I IDG+DI +
Sbjct: 452 Y--HPDRKILENANFTLPAGWKTAIVGPSGSGKSTILKLVFRFYDPQEGRILIDGKDIRE 509

Query: 512 LNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHG 571
           L++KSLRR IG+V Q+  L + T+ +N+ +G   T + ++IR    +      I   P G
Sbjct: 510 LDLKSLRRAIGVVPQDTPLFNDTIWENVKFGKI-TATDDDIRKAIDKAQLAPLIHSLPQG 568

Query: 572 YDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKS 631
            +T++G +G ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E A+  T  +    
Sbjct: 569 SETIVGERGLMISGGEKQRLAIARVLLKDTPIMFFDEATSALDTHTEQALLRTIKENFAG 628

Query: 632 KSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADP 674
            S T + IAHRL TI  ++ I+VL N G V E GK  EL + P
Sbjct: 629 NSRTSIYIAHRLRTIADADKIVVLEN-GRVKEEGKHAELLSKP 670

>Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {ON}
           YMR301C (REAL)
          Length = 693

 Score =  206 bits (524), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 199/676 (29%), Positives = 320/676 (47%), Gaps = 59/676 (8%)

Query: 21  RSVILRRFTPLVRRLPIVQPSVRSVISKRCQLSPLSQIQFQTTRPLTRSFTSSVRLLQAK 80
           RS I+     L  + P++  SV S +    +  P+ +   + T P+++  T + ++  +K
Sbjct: 28  RSPIIISVYKLSTQRPLLFSSVGSNLWNDARKDPVHKKLIEPTSPVSKPKTQAEKV--SK 85

Query: 81  SPKEAEQKSGLKDVVRLLMLAKPDWKL---LVIAITLLTVSCGIGMTIPKVIGMILDVLK 137
           +P  +E K  LKD+ R +   + + K+   ++IA+ LL  +  + + +P      +D + 
Sbjct: 86  APTMSELKI-LKDLFRYIW-PQGNNKVRIRVLIALGLLISAKILNVQVPFFFKQTIDSMN 143

Query: 138 TGLETNEGKDGPISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVV 197
              +     D  I++    P  +G +I          + +G  A +G  VL   L   V 
Sbjct: 144 ITWD-----DPTIAL----PAAIGLTI----------LCYG-TARFGS-VLFGELRNAVF 182

Query: 198 ARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSM---TQKVSDGFKALICXX 254
           AR+  N I+    Q      +  +G  +SR       ++R+M   T+ +S    A++   
Sbjct: 183 ARVAQNAIRTVSLQTFRHLMKLDLGWHLSRQTGG---LTRAMDRGTKGISYVLTAMVFHI 239

Query: 255 XXXXXXXSI-----SPQLSGLLLLFTPPVLFSASIFGRKIRDTST----DLQEATGQLTR 305
                  S+     + Q        T   +   S+F  K     T    D   A  +   
Sbjct: 240 IPISFEISVVCGILTYQFGASFAAITFSTMLLYSMFTIKTTAWRTNFRRDANRADNKAAS 299

Query: 306 VSEEQLSGVRTVQSFVAEQKEIHRYSHAI---RDI-FNVGKRAAYINA-QFFTATSSLGD 360
           V+ + L     V+ F  E+    +Y+ ++   RD    V +  A++N+ Q    TS+L  
Sbjct: 300 VALDSLINFEAVKYFNNEKYLADKYNGSLINYRDSQIKVSQSLAFLNSGQNLIFTSALTA 359

Query: 361 ISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFE 420
           + ++     G   V+ G LT+GDL             +  L S Y EL Q +     LF+
Sbjct: 360 MMYM-----GCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMEALFK 414

Query: 421 LTDRVPSIKPTTGKKFVPGK--GEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVG 478
           L      IK       +P     +I F++VTF Y   P   I ++    IPAGS   +VG
Sbjct: 415 LRKNEIKIKNAERPLMLPEHVPYDITFQNVTFGY--HPDRKILKNASFTIPAGSKTAIVG 472

Query: 479 PSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDN 538
            SG GKSTI  L+ RFY+P SG+I I+G+DI + +I +LR+ IG+V Q+  L + T+ +N
Sbjct: 473 SSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVVPQDTPLFNDTIWEN 532

Query: 539 ITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALI 598
           + +G  +  + EE+  V ++      I K P G++T++G +G ++SGG+KQR+AIAR L+
Sbjct: 533 VKFGRIDA-TDEEVNTVVEKAQLAPLIKKLPQGFNTIVGERGLMISGGEKQRLAIARVLL 591

Query: 599 KKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGND 658
           K   I+  DEATSALD  +E A+  T      S S T V IAHRL TI  ++ IIV  N 
Sbjct: 592 KNARIMFFDEATSALDTHTEQALLRTIRSNFPSGSRTSVYIAHRLRTIADADKIIVFDN- 650

Query: 659 GSVVETGKFKELFADP 674
           G V E GK  EL A P
Sbjct: 651 GKVREEGKHLELLATP 666

>Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {ON}
           YMR301C (REAL)
          Length = 691

 Score =  205 bits (522), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 137/387 (35%), Positives = 205/387 (52%), Gaps = 16/387 (4%)

Query: 295 DLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDI----FNVGKRAAYINA- 349
           D   A  +   V+ + L     V+ F  E+    +Y+ ++ +       V +  A++N+ 
Sbjct: 287 DANRADNKAASVALDSLINFEAVKYFNNEKYLSSKYNSSLMNYRDSQIKVSQSLAFLNSG 346

Query: 350 QFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELM 409
           Q    T++L  + ++     G   V+ G LT+GDL             +  L S Y +L 
Sbjct: 347 QNLIFTTALTAMMYM-----GCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRDLK 401

Query: 410 QGVGAATRLFELTDRVPSIKPTTGKKFVPGK--GEIVFKDVTFSYPTRPGNVIFRDMDIK 467
           Q +     LF+L      IK       +P     EI F++VTF Y   P   I ++    
Sbjct: 402 QSLIDMETLFKLRKNEVKIKSVERPLMLPEHVPYEITFENVTFGY--HPDRKILKNASFT 459

Query: 468 IPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQE 527
           IPAG    +VG SG GKSTI  L+ RFY+P SG+I I+G+DI + +I +LRR IG+V Q+
Sbjct: 460 IPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRRVIGVVPQD 519

Query: 528 PVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQ 587
             L + T+ +N+ +G  +  + EE++   ++      I K P G++T++G +G ++SGG+
Sbjct: 520 TPLFNDTIWENVKFGRIDA-TDEEVKTAVQKAQLAPLIKKLPQGFETIVGERGLMISGGE 578

Query: 588 KQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIR 647
           KQR+AIAR L+K   I+  DEATSALD  +E A+  T      S S T V IAHRL TI 
Sbjct: 579 KQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRSNFPSGSRTSVYIAHRLRTIA 638

Query: 648 RSENIIVLGNDGSVVETGKFKELFADP 674
            ++ IIVL N G+V E GK  EL A P
Sbjct: 639 DADKIIVLDN-GTVKEDGKHIELLATP 664

>Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {ON}
           YMR301C (REAL)
          Length = 687

 Score =  204 bits (519), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 141/389 (36%), Positives = 208/389 (53%), Gaps = 20/389 (5%)

Query: 295 DLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAI---RDI-FNVGKRAAYINA- 349
           D  +A  +   V+ + L     V+ F  E+    +Y+ ++   RD    V +  A++N+ 
Sbjct: 286 DANKADNKAASVALDSLINFEAVKYFNNEKYLSDKYNSSLISYRDSQIKVSQSLAFLNSG 345

Query: 350 QFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELM 409
           Q    T++L  + ++     G   V+ G LT+GDL             +  L S Y +L 
Sbjct: 346 QNLIFTTALTAMMYM-----GCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRDLK 400

Query: 410 QGVGAATRLFELTDRVPSIK----PTTGKKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMD 465
           Q +     LF+L      IK    P    + VP   +I F++VTF Y   P   I ++  
Sbjct: 401 QSLIDMETLFKLRRNEVKIKNAERPLMLPEHVPY--DITFENVTFGY--HPDRKILKNAS 456

Query: 466 IKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQ 525
             IPAG    +VG SG GKSTI  L+ RFY+P SG+I I+G+DI + +I +LR+ IG+V 
Sbjct: 457 FTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIREYDINALRKVIGVVP 516

Query: 526 QEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSG 585
           Q+  L + T+ +N+ +G  +  + EE+  V ++      I K P G+DT++G +G ++SG
Sbjct: 517 QDTPLFNDTIWENVKFGRIDA-TDEEVMTVVEKAQLAPLIKKLPQGFDTIVGERGLMISG 575

Query: 586 GQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLST 645
           G+KQR+AIAR L+K   I+  DEATSALD  +E A+  T      S S T V IAHRL T
Sbjct: 576 GEKQRLAIARVLLKNAKIMFFDEATSALDTHTEQALLRTIRSNFTSGSRTSVYIAHRLRT 635

Query: 646 IRRSENIIVLGNDGSVVETGKFKELFADP 674
           I  ++ IIVL N G V E GK  EL A P
Sbjct: 636 IADADKIIVLDN-GRVREEGKHLELLATP 663

>YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON}
           ATM1Mitochondrial inner membrane ATP-binding cassette
           (ABC) transporter, exports mitochondrially synthesized
           precursors of iron-sulfur (Fe/S) clusters to the cytosol
          Length = 690

 Score =  203 bits (517), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 138/387 (35%), Positives = 204/387 (52%), Gaps = 16/387 (4%)

Query: 295 DLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDI----FNVGKRAAYINA- 349
           D  +A  +   V+ + L     V+ F  E+    +Y+ ++ +       V +  A++N+ 
Sbjct: 286 DANKADNKAASVALDSLINFEAVKYFNNEKYLADKYNGSLMNYRDSQIKVSQSLAFLNSG 345

Query: 350 QFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELM 409
           Q    T++L  + ++     G   V+ G LT+GDL             +  L S Y +L 
Sbjct: 346 QNLIFTTALTAMMYM-----GCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRDLK 400

Query: 410 QGVGAATRLFELTDRVPSIKPTTGKKFVPGK--GEIVFKDVTFSYPTRPGNVIFRDMDIK 467
           Q +     LF+L      IK       +P     +I F++VTF Y   P   I ++    
Sbjct: 401 QSLIDMETLFKLRKNEVKIKNAERPLMLPENVPYDITFENVTFGY--HPDRKILKNASFT 458

Query: 468 IPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQE 527
           IPAG    +VG SG GKSTI  L+ RFY+P SG+I I+G+DI + +I +LR+ IG+V Q+
Sbjct: 459 IPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVVPQD 518

Query: 528 PVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQ 587
             L + T+ +N+ +G  +   +E I +V K       I K P G+DT++G +G ++SGG+
Sbjct: 519 TPLFNDTIWENVKFGRIDATDEEVITVVEKAQLAP-LIKKLPQGFDTIVGERGLMISGGE 577

Query: 588 KQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIR 647
           KQR+AIAR L+K   I+  DEATSALD  +E A+  T      S S T V IAHRL TI 
Sbjct: 578 KQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRDNFTSGSRTSVYIAHRLRTIA 637

Query: 648 RSENIIVLGNDGSVVETGKFKELFADP 674
            ++ IIVL N G V E GK  EL A P
Sbjct: 638 DADKIIVLDN-GRVREEGKHLELLAMP 663

>NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20
          Length = 702

 Score =  202 bits (515), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 151/417 (36%), Positives = 217/417 (52%), Gaps = 31/417 (7%)

Query: 274 FTPPVLFSASIFGRKIRDTST------DLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEI 327
           FT  +L+S  IF   IR T+       D  +A  +   V+ + L     V+ F  E+   
Sbjct: 262 FTTMILYS--IF--TIRTTAWRTQFRRDANKADNKGASVALDSLINFEAVKYFNNEKYLA 317

Query: 328 HRYSHAI---RDI-FNVGKRAAYINA-QFFTATSSLGDISFLVVLAYGSYLVLQGGLTIG 382
            +Y  ++   RD    V +  AY+N+ Q    TS+L  + ++     G   V+ G LT+G
Sbjct: 318 DKYHTSLIKYRDSQIKVSQSLAYLNSGQNLIFTSALTAMMYM-----GCTGVIGGDLTVG 372

Query: 383 DLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGK-----KFV 437
           DL             +  L S Y EL Q +     LF+L  R   IK   G      K  
Sbjct: 373 DLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFQL--RKNEIKIENGTNPIVLKAS 430

Query: 438 PGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNP 497
            G  EI F++VTF Y ++    I  +    IP G    VVGPSG GKSTI  L+ RFY+P
Sbjct: 431 DGPFEITFENVTFGYDSK--RKILNNASFTIPGGLKTAVVGPSGSGKSTILKLVFRFYDP 488

Query: 498 SSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAK 557
             G+I I+G D+ + ++ SLRR +G+V Q+  L + T+ +N+ +G  +  + EE+  V +
Sbjct: 489 EQGRILINGVDVKEYDVDSLRRVMGVVPQDTPLFNDTIWENVKFGRIDA-TDEEVHTVIE 547

Query: 558 QCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVES 617
           +      I K P GY+T++G +G ++SGG+KQR+AIAR L+K   I+  DEATSALD  +
Sbjct: 548 KAQLAPLIKKLPQGYETIVGERGMMISGGEKQRLAIARVLLKNAKIMFFDEATSALDTHT 607

Query: 618 EGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADP 674
           E A+  T     +S S T V IAHRL TI  ++ IIVL  DG+V E G    L A P
Sbjct: 608 EQALLTTIRANFESGSRTSVYIAHRLRTIADADKIIVL-EDGAVKEEGTHSGLLATP 663

>KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.20
           YMR301C
          Length = 695

 Score =  201 bits (512), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 135/375 (36%), Positives = 200/375 (53%), Gaps = 17/375 (4%)

Query: 306 VSEEQLSGVRTVQSFVAEQKEIHRYSHAI---RDI-FNVGKRAAYINA-QFFTATSSLGD 360
           ++ + L     V+ F  E     +Y++A+   RD    V +  A++N+ Q    TS+L  
Sbjct: 287 IALDSLINFEAVKYFNNESYLASKYNNALMTYRDAQIKVSQSLAFLNSGQNLIFTSALTA 346

Query: 361 ISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFE 420
           + ++     G   +L G LT+GDL             +  L S Y EL Q +     LF+
Sbjct: 347 MMYM-----GCTGILGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFK 401

Query: 421 LTDRVPSIKPTTGKKFVPGKG---EIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVV 477
           L      IK     K +P  G   EI F++VTF Y   P   I ++    I AG  + +V
Sbjct: 402 LRRNEVVIKNVEQPKMLPADGKPFEIRFENVTFGY--EPDRTILKNASFVIAAGKKIAIV 459

Query: 478 GPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRD 537
           GPSG GKSTI  L+ RFY+P  G+I I+G D+ ++++ SLR+ IG+V Q+  L + T+ +
Sbjct: 460 GPSGSGKSTILKLVFRFYDPQEGRILINGIDVKEIDLDSLRKVIGVVPQDTPLFNDTIWE 519

Query: 538 NITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARAL 597
           N+ +G  +  + EE+    ++      I K   G DT++G +G ++SGG+KQR+AIAR L
Sbjct: 520 NVRFGRIDA-TDEEVWAAVEKAHLSPLISKLSRGTDTIVGERGLMISGGEKQRLAIARVL 578

Query: 598 IKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGN 657
           +K   I+  DEATSALD  +E  +  T     K+ S T + IAHRL TI  ++ IIVL  
Sbjct: 579 LKNADIMFFDEATSALDTHTEQNLLKTIRANFKTGSKTSIYIAHRLRTIADADKIIVL-E 637

Query: 658 DGSVVETGKFKELFA 672
           DGSV E G   EL A
Sbjct: 638 DGSVKEEGTHTELLA 652

>KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 720

 Score =  201 bits (510), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 135/385 (35%), Positives = 203/385 (52%), Gaps = 16/385 (4%)

Query: 297 QEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAI---RDI-FNVGKRAAYINA-QF 351
             A  +   V+ + L     V+ F  E+   ++Y  ++   RD    V +  A++NA Q 
Sbjct: 308 NRADNKAASVALDSLINFEAVKYFNNEEYLANKYHQSLSKYRDSQIKVAQSLAFLNAGQN 367

Query: 352 FTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQG 411
           F  TS+L  + ++     G+  V++G LT+GDL             +  L S Y EL Q 
Sbjct: 368 FIFTSALTAMMYM-----GASGVMEGALTVGDLVLINQLVFQLSVPLNFLGSVYRELKQS 422

Query: 412 VGAATRLFELTDRVPSIKPTTGKKFVPGK--GEIVFKDVTFSYPTRPGNVIFRDMDIKIP 469
           +     LF+L      IK T     +P     EI F++VTF Y  +P   I ++    I 
Sbjct: 423 LIDMESLFKLQKNPILIKNTERPLMLPEHLPCEIKFENVTFGY--QPDRNILKNATFTIA 480

Query: 470 AGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPV 529
            G    +VGPSG GKSTI  L+ RFY+P  G+I +DG+DI +L++  LRR +G+V Q+  
Sbjct: 481 PGKKTAIVGPSGSGKSTILRLVFRFYDPQQGRILLDGKDIRELDLDELRRIVGVVPQDTP 540

Query: 530 LMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQ 589
           L + T+ +N+ +G       E +  + K     + I K P G +T++G +G ++SGG+KQ
Sbjct: 541 LFNDTIWENVKFGRINATDNEIVTAIEKAQLS-DLIHKLPKGTETIVGERGLMISGGEKQ 599

Query: 590 RIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRS 649
           R+AIAR L+K   I+  DEATSALD  +E ++  T  +     + T V IAHRL TI  +
Sbjct: 600 RLAIARVLLKDTPIMFFDEATSALDTHTEQSLLKTIKENFSDVAKTSVYIAHRLRTIADA 659

Query: 650 ENIIVLGNDGSVVETGKFKELFADP 674
           + IIVL N G+V E G    L A+P
Sbjct: 660 DKIIVLEN-GAVREEGTHNALLANP 683

>Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {ON}
           similar to Ashbya gossypii AGL335W
          Length = 696

 Score =  199 bits (505), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 132/387 (34%), Positives = 204/387 (52%), Gaps = 16/387 (4%)

Query: 295 DLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAI---RDI-FNVGKRAAYINA- 349
           D   A  +   V+ + L     V+ F  E+   ++Y  ++   RD    V +  A++N+ 
Sbjct: 294 DANSADNKAASVALDSLINFEAVKYFNNEEYLANKYHKSLLTYRDSQIKVQQSLAFLNSG 353

Query: 350 QFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELM 409
           Q    TS+L  + ++         V++G LT+GDL             +  L S Y EL 
Sbjct: 354 QNLIFTSALTAVMYMACSG-----VMEGSLTVGDLVLINQLIFQLSLPLNFLGSVYRELK 408

Query: 410 QGVGAATRLFELTDRVPSIKPTTGKKFVPGK--GEIVFKDVTFSYPTRPGNVIFRDMDIK 467
           Q +     LF L     +IK     + +P K   +I F++VTF Y   P   I ++    
Sbjct: 409 QSLIDMESLFRLQKNKITIKNVLNPQMLPEKLPSDIRFENVTFGYD--PERKILKNATFT 466

Query: 468 IPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQE 527
           IPAG    +VGPSG GKSTI  L+ RFY P  G+I IDG+DI ++++ SLR+ IG+V Q+
Sbjct: 467 IPAGKKTAIVGPSGSGKSTILRLVFRFYEPEQGRILIDGKDIREVDLDSLRKSIGVVPQD 526

Query: 528 PVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQ 587
             L + T+ +N+ +G  +  S ++I    ++      I   P G +T++G +G ++SGG+
Sbjct: 527 TPLFNDTIWENVKFGRIDA-SDKDITNAIERAQLTKLIQNLPKGINTIVGERGLMISGGE 585

Query: 588 KQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIR 647
           KQR+AI+R L+K   ++  DEATSALD  +E ++  T  +  + +S T V IAHRL TI 
Sbjct: 586 KQRLAISRVLLKDCPLMFFDEATSALDTHTEQSLLKTINENFEGQSKTSVYIAHRLRTIA 645

Query: 648 RSENIIVLGNDGSVVETGKFKELFADP 674
            ++ IIVL N+  V E G  K L   P
Sbjct: 646 DADKIIVL-NNSRVHEEGDHKTLLKTP 671

>KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {ON}
           Anc_5.20 YMR301C
          Length = 709

 Score =  199 bits (505), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 134/386 (34%), Positives = 202/386 (52%), Gaps = 17/386 (4%)

Query: 295 DLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFN----VGKRAAYINA- 349
           D  +A  +   ++ + L     V+ F  E     +Y+ A+ D  N    + K  A++N+ 
Sbjct: 303 DANKADNKGASIALDSLINFEAVKYFNNENYLSSKYNSALIDYRNSQIKISKSLAFLNSG 362

Query: 350 QFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELM 409
           Q    T++L  + +L     G   V+ G LT+GDL             +  L S Y EL 
Sbjct: 363 QNLIFTTALTGMMYL-----GCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELK 417

Query: 410 QGVGAATRLFELTDRVPSIKPTTGKKFV---PGKGEIVFKDVTFSYPTRPGNVIFRDMDI 466
           Q +     LF+L      I      K +    G  EI F++VTF Y       I ++   
Sbjct: 418 QSLIDMESLFKLRKNEVKIHNIENPKIILKEDGPFEITFENVTFGY--HADRKILKNASF 475

Query: 467 KIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQ 526
            IPAG    +VGPSG GKSTI  L+ RFY+P  G+I I+G D+ ++ + SLR+ IG+V Q
Sbjct: 476 TIPAGWKTAIVGPSGSGKSTILKLVFRFYDPEEGRILINGIDVREIELDSLRKLIGVVPQ 535

Query: 527 EPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGG 586
           +  L + ++ +N+ +G  +     EI  V ++    + I K P  Y+T++G +G ++SGG
Sbjct: 536 DTPLFNDSIWENVKFGRIDALD-SEIYEVIEKAQLDSLIRKLPQSYETIVGERGLMISGG 594

Query: 587 QKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTI 646
           +KQR+AIAR L+K  +++  DEATSALD  +E A+  T     K+ S T + IAHRL TI
Sbjct: 595 EKQRLAIARVLLKDASVMFFDEATSALDTHTEQALLKTIRANFKTGSRTSIYIAHRLRTI 654

Query: 647 RRSENIIVLGNDGSVVETGKFKELFA 672
             ++ IIVL  DG+V E G   EL A
Sbjct: 655 ADADKIIVL-EDGTVREEGTHNELLA 679

>Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}
           complement(65118..67244) [2127 nt, 709 aa]
          Length = 708

 Score =  197 bits (502), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 141/411 (34%), Positives = 212/411 (51%), Gaps = 23/411 (5%)

Query: 274 FTPPVLFSASIFGRKIRDTSTDLQEATGQLTR----VSEEQLSGVRTVQSFVAEQKEIHR 329
           FT  +L++  IF  +     T+ + A  +       ++ + L     V+ F  EQ   ++
Sbjct: 276 FTTMLLYA--IFTIRTTAWRTEFRRAANRADNKGASIALDSLINFEAVKYFNNEQYLANK 333

Query: 330 YSHAIRDIFN----VGKRAAYINA-QFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDL 384
           Y  ++ D  N    V +  A++N+ Q    TS+L  I +L     G   V+ G LT+GDL
Sbjct: 334 YYSSLVDYRNSQVKVAQSLAFLNSGQNLIFTSALTAIMYL-----GCTGVIGGNLTVGDL 388

Query: 385 TAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGK---G 441
                        +  L S Y EL Q +     LF+L      I+       +P +    
Sbjct: 389 VLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLRKNEIKIQNVHRPLMLPNELTPF 448

Query: 442 EIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQ 501
           EI F++VTF Y       I ++    IPAG    VVGPSG GKSTI  L+ RFY+P  G+
Sbjct: 449 EIKFENVTFGYDKERK--ILKNASFTIPAGWKTAVVGPSGSGKSTILKLVFRFYDPEEGR 506

Query: 502 IFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFC 561
           I ++G DI ++++ SLR+ IG+V Q+  L + T+ +N+ +G  E    E ++ + K    
Sbjct: 507 ILLNGTDIKEIDLASLRKVIGVVPQDTPLFNDTIWENVKFGRIEATDNEILQAIEKAQLA 566

Query: 562 HNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAI 621
              I K P G +T++G +G ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E ++
Sbjct: 567 P-LIKKLPKGRETIVGERGLMISGGEKQRLAIARVLLKNSGIMFFDEATSALDTHTEQSL 625

Query: 622 NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFA 672
             T  +     S T V IAHRL TI  ++ IIVL  DG V E G  ++L A
Sbjct: 626 LRTIKENFDGSSRTSVYIAHRLRTIADADKIIVL-KDGQVEEEGTHRQLIA 675

>TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20
           YMR301C
          Length = 696

 Score =  196 bits (497), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 138/404 (34%), Positives = 206/404 (50%), Gaps = 21/404 (5%)

Query: 283 SIFGRKIRDTST----DLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAI---R 335
           SIF  K+    T    D  +A  +   V+ + L     V+ F  E     +Y +++   R
Sbjct: 266 SIFTIKVTAWRTAFRRDANKADNKAASVALDSLINFEAVKHFNNENYLAGKYHNSLMKYR 325

Query: 336 DI-FNVGKRAAYINA-QFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEY 393
           D    + +  A++NA Q F  TS+L  + ++     G   V+ G LT+GDL         
Sbjct: 326 DSQVKIAQSLAFLNAGQNFIFTSALSAMMYM-----GCTGVIGGDLTVGDLVLINQLVFQ 380

Query: 394 TGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVP---GKGEIVFKDVTF 450
               +  L S Y EL Q +     LF L +    I        +P   G  EI F++VTF
Sbjct: 381 LSVPLNFLGSVYRELKQSLIDMEALFNLRNNKIKIHNNDKPLMLPENAGPFEIKFENVTF 440

Query: 451 SYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDIS 510
            Y TR    I R+    IPAG    +VGPSG GKSTI  L+ RFY+P SG++ ++G+D+ 
Sbjct: 441 GYDTR--RKILRNASFTIPAGVKTAIVGPSGSGKSTILKLVFRFYDPESGRVLVNGKDVR 498

Query: 511 KLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPH 570
           + ++ S R+ IG+V Q+  L + T+ +N+ +G  +    E    + K       I K P 
Sbjct: 499 EYDLDSFRKVIGVVPQDTPLFNDTIWENVKFGRIDATDDEVTNAIEKAQLAP-LIHKLPV 557

Query: 571 GYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMK 630
           G  T++G +G ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E ++  T  +   
Sbjct: 558 GSATIVGERGLMISGGEKQRLAIARVLLKNSQIMFFDEATSALDTHTEQSLLKTIRENFD 617

Query: 631 SKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADP 674
             S T V +AHRL TI  ++ I+VL  +G V E G   EL + P
Sbjct: 618 RGSRTSVYVAHRLRTIADADKILVL-EEGCVREEGSHTELLSRP 660

>TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1257

 Score =  197 bits (501), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 150/524 (28%), Positives = 251/524 (47%), Gaps = 41/524 (7%)

Query: 173  ALMVFGI-----VANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFF--DRHKVGDLI 225
            +L+V G+     + N+ +  L    SE  + +LR  V+++   ++ ++F  +RHK  ++ 
Sbjct: 736  SLIVIGVAIADAILNFLQYFLFGYCSEYWILQLRNQVMQRISFEELDWFQRERHKASEVS 795

Query: 226  SR----------LGSDAYVVSRSMTQKVSDGF-KALICXXXXXXXXXSISPQLSGLLLLF 274
            +           L SD  +   S     S G   ALI           I  +LS + +  
Sbjct: 796  ALLLNDLRDLRALASDFLIAVSSFAVVSSVGIIWALI-----------IGWKLSLVCISM 844

Query: 275  TPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAI 334
             P ++  ++++G  ++   T  + A   L  +  E  +G++T++    E   + +Y    
Sbjct: 845  FPLIVIFSAVYGMALQRQETQYKSAVVDLENLLYEVATGIKTIRRLQLETNFLRQYKRLE 904

Query: 335  RDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYT 394
              +  +  R A           +L      ++  Y   LV+ G  T   +   +    +T
Sbjct: 905  SHMRVIASRRAITTGLGVAVIEALAMSIQAILFYYALKLVIDGQYTTKKMFETLTLLLFT 964

Query: 395  GSSVFGLTSFYSELMQGVGAATRLFELTD-RVPSIKP------TTGKKFVPGKGEIVFKD 447
              +   L S   ++ +G  AA R+ ++ D ++   KP      TT          I  ++
Sbjct: 965  IMTCNILISQVPDISRGQRAANRILQMLDEKLEREKPHQEKKQTTSGSVSESSAVISLQN 1024

Query: 448  VTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQ 507
            VTF+YP+ P   IF  + +++P G    +VG SG GKST+  LL + Y P+SG + ++ +
Sbjct: 1025 VTFAYPSAPSIHIFDSLYLELPIGRTFALVGQSGSGKSTLVTLLTQLYRPTSGTVLVENK 1084

Query: 508  DISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVK 567
            D+++ NI+ LRR + +V+Q P + SGT+R+N+ YGL   P + E+  V +    H+FI K
Sbjct: 1085 DVNEWNIRDLRRQMSVVEQTPTIFSGTVRENLLYGLHHDPLEVEMYDVLRYVGIHDFISK 1144

Query: 568  FPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQ 627
             P G DT I     LLSGGQ QR+ IARA++K+P IL+LDE TSALD  S   IN    +
Sbjct: 1145 LPLGLDTTIDID--LLSGGQLQRLCIARAILKRPKILILDECTSALDPFSSHVINNIVRR 1202

Query: 628  LMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELF 671
                 +   +SI H +  ++  + II L N G V  TG F  L 
Sbjct: 1203 --GCPAPLTISITHNVDMMKACDEIIFLKN-GRVAGTGSFDALL 1243

 Score =  141 bits (356), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 137/515 (26%), Positives = 245/515 (47%), Gaps = 18/515 (3%)

Query: 173 ALMVFG---IVANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVGDLISRLG 229
           A+M  G   +   +  I    +L ER    +R  ++ K +    E++D  K  D+     
Sbjct: 63  AIMALGGASLPTTWASISAWMLLGERCGFGIRRRLLYKYLENPFEWYD--KTEDICGNFT 120

Query: 230 SDAYVV--SRSMTQKVSDGF-KALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIFG 286
                V  +R+   + S    ++L+            S  L+ + L   P ++     F 
Sbjct: 121 QQNRCVEEARASCAEASAVITRSLVTIIALIGTSFYASWSLTLVTLCSAPLIIMCGWFFS 180

Query: 287 RKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAY 346
           RK++  +    E T + +++ +  ++  + ++    E +EI  + + +++  N   +   
Sbjct: 181 RKVQRYADLENEQTSKASQLLDWSMTAAQFIRLSGTELREIKSFKNCVQNCTNNFVKMCQ 240

Query: 347 INAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYS 406
            ++        L    F+    +GS ++ +G + IGD+          GS++ G      
Sbjct: 241 YSSINLATLKFLSLAMFVQAFWFGSTMIRKGKMNIGDVITCFHSCILLGSTISGTLQQLV 300

Query: 407 ELMQGVGAATRL--FELTDRVPS--IKPTTGKKFVPGKGEIVFKDVTFSYPTRPGNVIFR 462
            + +G  A   +  F   D+  +  I+      F   KG+I F++V FSYP+RP + + R
Sbjct: 301 IIQKGSVAVNIVSKFLADDKTATTDIRRWQDVPFPELKGDIRFQNVEFSYPSRPDHNVLR 360

Query: 463 DMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIG 522
            + +   AG    ++G SG GKS+++ LLL+FY   +G I +DG++I  ++   L ++I 
Sbjct: 361 SISLNFRAGKTTFLLGKSGSGKSSLSNLLLKFYENYTGVISVDGRNIKHIDQSQLIKNIT 420

Query: 523 LVQQEPVLMSGTLRDNITYGLTETPSKE---EIRMVAKQCFCHNFIVKFPHGYDTVIGPQ 579
           +V+Q   + +GTL++NI  G+     +E   ++++V +     NFI     G +T+IG  
Sbjct: 421 VVEQRCNVFNGTLKENIIIGIDGADEEEILTKLKLVCRISLLENFIHDLSDGLNTLIGSG 480

Query: 580 GALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSI 639
           G  LSGGQ+Q++AIARAL+K P IL+LDE+ SALDV   G I        K K+  I++ 
Sbjct: 481 GISLSGGQQQKVAIARALMKDPQILILDESLSALDVLQRGLILRAIRTHRKEKTTIILT- 539

Query: 640 AHRLSTIRRSENIIVLGNDGSVVETGKFKELFADP 674
            H L+ I  S +   L   G  +E G  + L  DP
Sbjct: 540 -HELNQI-GSNDFCYLIESGQCIEHGLEETLVNDP 572

>AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR301C (ATM1)
          Length = 691

 Score =  192 bits (489), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 133/385 (34%), Positives = 198/385 (51%), Gaps = 16/385 (4%)

Query: 295 DLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAI---RDI-FNVGKRAAYIN-A 349
           D  +A  +   V+ + L     V+ F  E+    +Y  ++   RD    V +  A++N  
Sbjct: 285 DANKADNKAASVALDSLINFEAVKYFNNEKYLADKYHTSLMKYRDSQIKVSQSLAFLNTG 344

Query: 350 QFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELM 409
           Q    T++L  + ++         V+QG LT+GDL             +  L S Y +L 
Sbjct: 345 QNLIFTTALTAMMYMACNG-----VMQGSLTVGDLVLINQLVFQLSVPLNFLGSVYRDLK 399

Query: 410 QGVGAATRLFELTDRVPSIKPTTGKKFVPGKG--EIVFKDVTFSYPTRPGNVIFRDMDIK 467
           Q +     LF+L     +IK +   + +P     +I F++VTF Y   P   I  ++   
Sbjct: 400 QSLIDMESLFKLQKNQVTIKNSPNAQNLPIHKPLDIRFENVTFGYD--PERRILNNVSFT 457

Query: 468 IPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQE 527
           IPAG    +VGPSG GKSTI  L+ RFY P  G+I + G DI  L++ SLR+ IG+V Q+
Sbjct: 458 IPAGMKTAIVGPSGSGKSTILKLVFRFYEPEQGRILVGGTDIRDLDLLSLRKAIGVVPQD 517

Query: 528 PVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQ 587
             L + T+ +N+ +G   +   E +R + K       +   P G  TV+G +G ++SGG+
Sbjct: 518 TPLFNDTIWENVKFGNISSSDDEILRAIEKAQLT-KLLQNLPKGASTVVGERGLMISGGE 576

Query: 588 KQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIR 647
           KQR+AIAR L+K   ++  DEATSALD  +E A+ +T  Q   S S T V +AHRL TI 
Sbjct: 577 KQRLAIARVLLKDAPLMFFDEATSALDTHTEQALLHTIQQNFSSNSKTSVYVAHRLRTIA 636

Query: 648 RSENIIVLGNDGSVVETGKFKELFA 672
            ++ IIVL   GSV E G    L A
Sbjct: 637 DADKIIVL-EQGSVREEGTHSSLLA 660

>NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {ON}
           Anc_5.20 YMR301C
          Length = 730

 Score =  192 bits (487), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 156/461 (33%), Positives = 231/461 (50%), Gaps = 41/461 (8%)

Query: 232 AYVVSRSMTQKVSDGFK-ALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIR 290
           +YV+S  +   +  GF+ +++C         S +       + FT  +L+S  IF   IR
Sbjct: 257 SYVLSAMLFHIIPIGFEISVVCGILTYQFGASFAG------ITFTTMLLYS--IF--TIR 306

Query: 291 DTST------DLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAI---RD-IFNV 340
            T+       D  +A  +   V+ + L     V+ F  E    ++Y  ++   RD    V
Sbjct: 307 TTAWRTQFRRDANKADNKGASVALDSLINFEAVKYFNNETYLSNKYHDSLLQYRDSTIKV 366

Query: 341 GKRAAYINA-QFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVF 399
            +  A++N+ Q    TS+L  + +L     G   V++G LT+GDL             + 
Sbjct: 367 AQSLAFLNSGQNLIFTSALTMMMYL-----GCTGVIEGNLTVGDLVLINQLVFQLSVPLN 421

Query: 400 GLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGK--------KFVPGKGEIVFKDVTFS 451
            L S Y EL Q +     LF+L  R   IK    K        K   G  EI F++VTF 
Sbjct: 422 FLGSVYRELKQSLIDMESLFQL--RKNPIKIQNAKTGPAPIMLKSSDGPFEIKFENVTFG 479

Query: 452 YPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISK 511
           Y T     I ++    IPAG    VVGPSG GKSTI  L+ RFY+P  G++ I+G ++ +
Sbjct: 480 YDT--NRKILKNASFIIPAGLKTAVVGPSGSGKSTILKLVFRFYDPEEGRVLINGINVQR 537

Query: 512 LNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHG 571
            +I SLRR +G+V Q+  L + T+ +N+ +G     + EEI+ V ++      I K P  
Sbjct: 538 YDIDSLRRVMGVVPQDTPLFNDTIWENVKFGRINA-NDEEIKQVIEKAQLAPLIEKLPQR 596

Query: 572 YDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKS 631
             T++G +G ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E A+  T      S
Sbjct: 597 EKTIVGERGLMISGGEKQRLAIARVLLKDANIMFFDEATSALDTHTEQALLNTIRANFPS 656

Query: 632 KSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFA 672
            + T + IAHRL TI  ++ IIVL  DG V E G   EL A
Sbjct: 657 GTRTSIYIAHRLRTIADADKIIVL-EDGKVKEEGSHNELLA 696

>TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa]
           {ON} Anc_5.20 YMR301C
          Length = 725

 Score =  192 bits (487), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 142/410 (34%), Positives = 210/410 (51%), Gaps = 20/410 (4%)

Query: 274 FTPPVLFSASIFGRKIRDTSTDLQ--EATGQLTRVSEEQLSGVRTVQSFVAEQ---KEIH 328
           FT  +L+S   F      T    Q  +A  +   ++ + L     V+ F  E+   ++ H
Sbjct: 283 FTTMLLYSIFTFKTTAWRTKFRRQANKADNKGASIALDSLINFEAVKYFNNEEYLAQKYH 342

Query: 329 RYSHAIRDI-FNVGKRAAYINA-QFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTA 386
           +     RD    V +  A++N+ Q    TS+L      V++  G   ++ G LT+GDL  
Sbjct: 343 KTLSQYRDSQIKVAQSLAFLNSGQNLIFTSALT-----VMMYMGCTGIIGGNLTVGDLVL 397

Query: 387 FMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGKGE---- 442
                      +  L S Y EL Q +     LF+L      IK       +  KG     
Sbjct: 398 INQLVFQLSVPLNFLGSVYRELKQSLIDMEYLFQLKKNPIIIKNVEKPLMLAEKGHMPMT 457

Query: 443 IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI 502
           I F++VTF Y  +    I ++   +I +G    +VGPSG GKSTI  LL RFY+P  G+I
Sbjct: 458 IRFENVTFGYDKQ--RKILKNASFQIESGQKTAIVGPSGSGKSTILKLLFRFYDPEEGRI 515

Query: 503 FIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCH 562
            ++G D  + +I SLR+ IG+V Q+  L + T+ +N+ +G     S +EI  V  +    
Sbjct: 516 LVNGVDAREYDIDSLRKVIGVVPQDTPLFNDTIWENVRFGRI-GASDDEITQVINKAQLG 574

Query: 563 NFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAIN 622
             +VK P G +T++G +G ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E A+ 
Sbjct: 575 PLLVKLPQGRETIVGERGLMISGGEKQRLAIARVLLKDADIMFFDEATSALDTHTEQALL 634

Query: 623 YTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFA 672
            T  +  K  S T V IAHRL TI  ++ IIVL  +G+V E GK  EL A
Sbjct: 635 KTINENFKKGSRTSVYIAHRLRTIADADKIIVL-QEGTVREEGKHSELLA 683

>ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} similar
           to uniprot|P40416 Saccharomyces cerevisiae YMR301C ATM1
           Mitochondrial inner membrane transporter exports
           mitochondrially synthesized precursors of iron- sulfur
           (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 709

 Score =  191 bits (484), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 137/408 (33%), Positives = 209/408 (51%), Gaps = 19/408 (4%)

Query: 274 FTPPVLFSASIFGRKIRDTS--TDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYS 331
           FT  +L+S   F      T    +  +A  +   V+ + L     V++F  E+    +Y 
Sbjct: 258 FTTMLLYSIFTFRTTAWRTKFRREANKADNKAASVALDSLINFEAVKNFNNEKYLAEKYE 317

Query: 332 HAI---RDI-FNVGKRAAYINA-QFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTA 386
            ++   RD    V +  A++N+ Q    T++L  + ++     G   ++ G LT+GDL  
Sbjct: 318 TSLLKYRDSQVRVAQSLAFLNSGQNLIFTTALTAMMYM-----GCTGIIGGSLTVGDLVL 372

Query: 387 FMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVP---GKGEI 443
                      +  L S Y EL Q +     LF L +    I   +  K +P   G  +I
Sbjct: 373 INQLVFQLSVPLNFLGSVYRELKQSLIDMESLFNLRNNPILIDNPSKPKMLPANAGPFDI 432

Query: 444 VFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIF 503
           VF++VTF Y   P   I ++    IPAG    VVGPSG GKST+  L+ RFY+P  G+I 
Sbjct: 433 VFENVTFGYD--PRRKILQNASFVIPAGWKTAVVGPSGSGKSTLLKLVFRFYDPQEGRIL 490

Query: 504 IDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHN 563
           ++G DI + ++ SLRR IG+V Q+  L + T+ +N+ +G  +   +E  R + K      
Sbjct: 491 VNGIDIREYDLDSLRRAIGVVPQDTPLFNDTIWENVKFGRIDADDQEVTRSIEKAHLAP- 549

Query: 564 FIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINY 623
            + + P G +T++G +G ++SGG+KQR+AIAR L+K  +I+  DEATSALD  +E A+  
Sbjct: 550 LVYRLPGGLNTIVGERGLMISGGEKQRLAIARVLLKNSSIMFFDEATSALDTHTEQALLR 609

Query: 624 TFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELF 671
           T        S T V IAHRL TI  ++ IIVL  +G   E G   EL 
Sbjct: 610 TIRANFDRGSKTSVYIAHRLRTIADADKIIVL-EEGRPREEGTHHELL 656

>CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa]
           {ON} similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301c ATM1
          Length = 727

 Score =  191 bits (484), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 164/526 (31%), Positives = 260/526 (49%), Gaps = 48/526 (9%)

Query: 174 LMVFGIVANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAY 233
           +M +G+ A +G  VL   L   + AR+  N I+    Q  E   +  +G  +SR      
Sbjct: 186 IMCYGL-ARFG-AVLFGELRNAIFARVAQNAIRNVSLQTFEHLMKLDLGWHLSRQTGG-- 241

Query: 234 VVSRSM---TQKVSDGFKALICXXXXXXXXXSISPQLSGLL----------LLFTPPVLF 280
            ++R+M   T+ +S    A++          S+   + G+L          + FT  +L+
Sbjct: 242 -LTRAMDRGTKGISYVLSAMVFHIIPITFEISV---VCGILTYQFGASFAGITFTTMLLY 297

Query: 281 SASIFGRKIRDTS------TDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAI 334
           S  IF   IR T+       +  +A  +   V+ + L     V+ F  E    ++Y +++
Sbjct: 298 S--IF--TIRTTAWRTRFRKEANKADNKGASVALDSLINFEAVKYFNNESYLANKYHNSL 353

Query: 335 ---RDI-FNVGKRAAYINA-QFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFML 389
              RD    V +  A++N+ Q    T++L  + ++     G   V+ G LT+GDL     
Sbjct: 354 IKYRDSQVKVAQSLAFLNSGQSLIFTTALTGMMYM-----GCTGVIGGDLTVGDLVLINQ 408

Query: 390 YTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVP---GKGEIVFK 446
                   +  L S Y EL Q +     LF+L      I+  +  K +    G  EI F+
Sbjct: 409 LVFQLSVPLNFLGSVYRELKQSLIDMESLFKLRKNQVKIQNCSQPKSISKSDGPFEIKFE 468

Query: 447 DVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDG 506
           +VTF Y  +    I ++    IPAG    + GPSG GKST+  L+ RFY+P  G++ ++G
Sbjct: 469 NVTFGYDGQRK--ILKNASFTIPAGMKTAIAGPSGSGKSTVLKLVFRFYDPEEGRVLVNG 526

Query: 507 QDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIV 566
            D+ + +I  LR+ IG+V Q+  L + T+ +N+ +G  E  S EEI  V  +    + I 
Sbjct: 527 VDVREYDIDQLRKAIGVVPQDTPLFNDTIWENVKFGRIE-ASDEEITRVIDKAQLSDLIA 585

Query: 567 KFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFG 626
           K P G  T++G +G ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E ++  T  
Sbjct: 586 KLPQGSSTIVGERGLMISGGEKQRLAIARVLLKDADIMFFDEATSALDTHTEQSLLRTIR 645

Query: 627 QLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFA 672
           +   S   T V IAHRL TI  ++ IIVL  +G+V E G  +EL A
Sbjct: 646 RNFNSGEKTSVYIAHRLRTIADADKIIVL-EEGTVREEGTHQELLA 690

>YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}
            STE6Plasma membrane ATP-binding cassette (ABC)
            transporter required for the export of a-factor,
            catalyzes ATP hydrolysis coupled to a-factor transport;
            contains 12 transmembrane domains and two ATP binding
            domains; expressed only in MATa cells
          Length = 1290

 Score =  193 bits (490), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 153/530 (28%), Positives = 266/530 (50%), Gaps = 44/530 (8%)

Query: 173  ALMVFGIVA-----NYGRIVLLRILSERVVARLRANVIKKTIHQDSEFF--DRHKVGDLI 225
            +L+V G+ A     N+ +  LL   SE  V  LR  V++K   ++ ++F  + +K  ++ 
Sbjct: 763  SLLVLGVAAADGIFNFAKGFLLDCCSEYWVMDLRNEVMEKLTRKNMDWFSGENNKASEIS 822

Query: 226  SRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSIS-PQLSGLLLLFTPPVLFSASI 284
            + + +D   + RS+  +      + +           +S  +LS + +   P ++  ++I
Sbjct: 823  ALVLNDLRDL-RSLVSEFLSAMTSFVTVSTIGLIWALVSGWKLSLVCISMFPLIIIFSAI 881

Query: 285  FGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAE---QKEIHRYSHAIRDIFNVG 341
            +G  ++   TD + +  QL     + ++ ++T++   AE   Q   H     ++ I    
Sbjct: 882  YGGILQKCETDYKTSVAQLENCLYQIVTNIKTIKCLQAEFHFQLTYHDLKIKMQQI--AS 939

Query: 342  KRAAYINAQFFTATSSLGDISF-LVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFG 400
            KRA  I   F  + +++  +    ++  YG  LV+    T  ++        +T  S   
Sbjct: 940  KRA--IATGFGISMTNMIVMCIQAIIYYYGLKLVMIHEYTSKEMFTTFTLLLFTIMSCTS 997

Query: 401  LTSFYSELMQGVGAATRLFELTD-------------RVPSIKPTT--GKKFVPGKGEIVF 445
            L S   ++ +G  AA+ ++ + D             R   I   T  GK+  P    +  
Sbjct: 998  LVSQIPDISRGQRAASWIYRILDEKHNTLEVENNNARTVGIAGHTYHGKEKKP---IVSI 1054

Query: 446  KDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFID 505
            +++TF+YP+ P   ++++M+  +  G  + ++G SG GKST+ LLL + YN   G+I ID
Sbjct: 1055 QNLTFAYPSAPTAFVYKNMNFDMFCGQTLGIIGESGTGKSTLVLLLTKLYNCEVGKIKID 1114

Query: 506  GQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFI 565
            G D++  N+ SLR+ I +V+Q+P+L +GT+RDN+TYGL +   + E+    K    H+F+
Sbjct: 1115 GTDVNDWNLTSLRKEISVVEQKPLLFNGTIRDNLTYGLQDEILEIEMYDALKYVGIHDFV 1174

Query: 566  VKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTF 625
            +  P G DT I     LLSGGQ QR+ IARAL++K  IL+LDE TSALD  S   IN   
Sbjct: 1175 ISSPQGLDTRIDT--TLLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSSIIN--- 1229

Query: 626  GQLMKSK--SVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFAD 673
             +++K    ++  + I H    +R   +I VL  DG VVE G F  L+ +
Sbjct: 1230 -EIVKKGPPALLTMVITHSEQMMRSCNSIAVL-KDGKVVERGNFDTLYNN 1277

 Score =  186 bits (471), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 143/508 (28%), Positives = 246/508 (48%), Gaps = 37/508 (7%)

Query: 192 LSERVVARLRANVIKKTIHQD-SEFFDRHK--VGDLISRLGSDAYVVSRSMTQKVSDGFK 248
           + ER   R+R+ +++  + +   E++D ++  +GD  +++      +  S  +  +  F+
Sbjct: 99  IGERQGFRIRSQILEAYLEEKPMEWYDNNEKLLGDF-TQINRCVEELRSSSAEASAITFQ 157

Query: 249 ALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSE 308
            L+            S  L+ ++L  +P + F A +F R I   S      T +  ++  
Sbjct: 158 NLVAICALLGTSFYYSWSLTLIILCSSPIITFFAVVFSRMIHVYSEKENSETSKAAQLLT 217

Query: 309 EQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVV-- 366
             ++  + V+ +  ++ E  ++   I +         +I + FF A ++ G + FL +  
Sbjct: 218 WSMNAAQLVRLYCTQRLERKKFKEIILNC-----NTFFIKSCFFVAANA-GILRFLTLTM 271

Query: 367 ----LAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFEL- 421
                 +GS ++ +G L I D+          GS++         L +G  A  ++  L 
Sbjct: 272 FVQGFWFGSAMIKKGKLNINDVITCFHSCIMLGSTLNNTLHQIVVLQKGGVAMEKIMTLL 331

Query: 422 ---TDRVPSIKPTTGKKFVP---GKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVC 475
              + R P +  T   +F P      ++ F +V+FSYP+RP   + +++ +   AG    
Sbjct: 332 KDGSKRNP-LNKTVAHQF-PLDYATSDLTFANVSFSYPSRPSEAVLKNVSLNFSAGQFTF 389

Query: 476 VVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTL 535
           +VG SG GKST++ LLLRFY+  +G I I+G +I  ++ K L  +I +V+Q   L + TL
Sbjct: 390 IVGKSGSGKSTLSNLLLRFYDGYNGSISINGHNIQTIDQKLLIENITVVEQRCTLFNDTL 449

Query: 536 RDNITYGLTET------PSKEEIRMVAKQC---FCHNFIVKFPHGYDTVIGPQGALLSGG 586
           R NI  G T++       + E   ++   C       FI+  P G +T+IG  G  LSGG
Sbjct: 450 RKNILLGSTDSVRNADCSTNENRHLIKDACQMALLDRFILDLPDGLETLIGTGGVTLSGG 509

Query: 587 QKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTI 646
           Q+QR+AIARA I+   IL LDEA SALD+     +        K K+  I++  H LS I
Sbjct: 510 QQQRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRKGKTTIILT--HELSQI 567

Query: 647 RRSENIIVLGNDGSVVETGKFKELFADP 674
             S++ + L  +G VVE+G   EL ADP
Sbjct: 568 -ESDDYLYLMKEGEVVESGTQSELLADP 594

>TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {ON}
           Anc_5.20 YMR301C
          Length = 711

 Score =  189 bits (479), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 131/388 (33%), Positives = 197/388 (50%), Gaps = 21/388 (5%)

Query: 297 QEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDI----FNVGKRAAYINA-QF 351
            +A  +   ++ + L     V+ F  EQ    +Y+ +++        V +  A++N+ Q 
Sbjct: 305 NKADNKGASIALDSLINFEAVKYFNNEQYLASKYNTSLKSYTEAQVKVAQSLAFLNSGQN 364

Query: 352 FTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQG 411
              TS+L  + ++     G   +L G L++GDL             +  L S Y +L Q 
Sbjct: 365 LIFTSALTAMMYM-----GCTGILGGNLSVGDLVLINQLVFQLSVPLNFLGSVYRDLKQS 419

Query: 412 VGAATRLFELTDRVPSIKPTTGKK-----FVPGKGEIVFKDVTFSYPTRPGNVIFRDMDI 466
           +     LF+L  R   +K    K         G   I FK+VTF Y   P   I R+   
Sbjct: 420 LIDMESLFKL--RKNEVKILNNKNPAILSLKDGPFNIEFKNVTFGYD--PNRKILRNASF 475

Query: 467 KIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQ 526
            IPAG    VVGPSG GKSTI  L+ RFY+P  G++ ++G D+   ++ SLRR IG+V Q
Sbjct: 476 IIPAGVKTAVVGPSGSGKSTILKLVFRFYDPEEGRVLVNGIDVRDYDLDSLRRAIGVVPQ 535

Query: 527 EPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGG 586
           +  L + T+ +N+ +G   T + E+I    ++      I K P  Y+T++G +G ++SGG
Sbjct: 536 DTPLFNDTIWENVKFG-DVTATDEQILNAVEKAQLGTLIEKLPKKYETIVGERGLMISGG 594

Query: 587 QKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTI 646
           +KQR+AIAR L+K   I+  DEATSALD  +E  +  T        S T V IAHRL T+
Sbjct: 595 EKQRLAIARVLLKNAPIMFFDEATSALDTHTEQELLKTIKNNFDKGSRTSVYIAHRLRTV 654

Query: 647 RRSENIIVLGNDGSVVETGKFKELFADP 674
             S+ IIVL  +GS+ E G    L + P
Sbjct: 655 ADSDKIIVL-KEGSIFEEGTHLGLLSKP 681

>KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1275

 Score =  186 bits (472), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 135/507 (26%), Positives = 249/507 (49%), Gaps = 28/507 (5%)

Query: 181  ANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFD--RHKVGDLISRLGSDAYVVSRS 238
              + +  ++   SE  +  LR  V++   +   E+F    +K  ++ +   +D   +   
Sbjct: 766  CTFSKTFIMGYCSEYWIMDLRKKVMRTITYNKFEWFQLAENKPSEVSALALNDLRDLRTL 825

Query: 239  MTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQE 298
            +T+ ++     L+              +LS + +   P ++  + ++G  ++   TD + 
Sbjct: 826  VTEFLATASTFLVVSTCGLIWALVAGWKLSLVSISMFPLIIVFSGVYGAALQKCETDYKS 885

Query: 299  ATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSL 358
            A  QL     E +  ++T++    +    +RY    + + ++G+R + I       T +L
Sbjct: 886  AVAQLENCLYEVVVSMKTIRCLQLQTHFQNRYDRRKQRMLSLGRRRSVITGCGIAITHTL 945

Query: 359  GDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRL 418
                  ++  YG  LV+ G  T   +        +T  +   L +   E+ +G  AAT +
Sbjct: 946  TLCIQAILYYYGIKLVIDGKYTSKKMFEVFTLILFTIMTCTNLINQIPEVTRGQRAATYI 1005

Query: 419  F-------------ELTDRVPSIKPTTGKKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMD 465
            +             ++ +R   I  T+ K  +     ++ KD+TF+YP  P   ++  ++
Sbjct: 1006 YRILKEAAATREHQDMHNRTLPISNTSEKDTM-----VLVKDLTFAYPATPSKHVYEHLN 1060

Query: 466  IKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQ 525
            + + + ++V +VG SG GKSTI  LL + Y+     I++DG D+S+ +  SLR  I +V+
Sbjct: 1061 LNLKSDTSVALVGESGSGKSTIISLLTKLYDVPEKHIYVDGTDLSEWDTNSLRNQISVVE 1120

Query: 526  QEPVLMSGTLRDNITYGLTETPSKE-EIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLS 584
            Q   L++GT+R+N+TYGL E  + E ++  + K    ++F+ + P+G DT++     LLS
Sbjct: 1121 QSANLLNGTIRENLTYGLPEEDTTEVDLIGILKLVSIYDFVSRLPNGIDTIVDRD--LLS 1178

Query: 585  GGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKS-KSVTIVSIAHRL 643
            GGQ QR+ IARAL+K   IL+LDE TSALD  S    N     + K   +  I++I H  
Sbjct: 1179 GGQAQRLCIARALVKPHRILILDECTSALDALS---TNIIIDIVRKGIPNTLIIAITHDE 1235

Query: 644  STIRRSENIIVLGNDGSVVETGKFKEL 670
              +R  E++++L N G++VE G F EL
Sbjct: 1236 HMMRSCESVLLLKN-GAIVEQGSFVEL 1261

 Score =  151 bits (381), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 148/610 (24%), Positives = 273/610 (44%), Gaps = 83/610 (13%)

Query: 102 KPDWKLLVIAITLLTVSCGIGMTIPKVI-GMILDVLKTGLETNEGKDGPISMADVPPIFM 160
           + D+KLL + +TL T++ G+   I  ++ G + D+L      +      + +  +  + +
Sbjct: 12  EKDYKLLTV-VTLTTIASGLIPAITSILTGRVFDILSNISLNDRQFSHQLVLRSMSVMIL 70

Query: 161 GYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFD--- 217
           G         F  + +F        I     L E    R+R N++   + +   ++D   
Sbjct: 71  G------AASFPVMWIF--------ITSWMHLGEVQGDRIRINMLGSYLSKSWTWYDGNG 116

Query: 218 RHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPP 277
           +  +G+  ++L      V +S ++  +   ++ +            S  L+ L++L + P
Sbjct: 117 KRLLGEF-TQLSRCIEEVRQSSSESAAITLQSFVSVLSLIGTSFYYSWSLT-LIILCSTP 174

Query: 278 VLFSASIFGRKIRDTSTDLQ-EATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRD 336
           ++ + +I+  K+ +  TDL+ + T     +    +     V+ + A+ +EI ++  ++  
Sbjct: 175 IITAIAIYFAKLTNKYTDLENKETSYAAELLTWSMRFNDMVKFYTAQNEEISKFDTSVTR 234

Query: 337 IFNVGKRAAYINAQFFTATSSLGDISFLVV------LAYGSYLVLQGGLTIGDLTAFMLY 390
                  + +I A  ++A +S   I FL +        +G+ ++ +  L I D+      
Sbjct: 235 C-----NSLFIKACLYSALNS-SIIRFLTLCMFVQGFWFGATMIRRNKLDINDV------ 282

Query: 391 TEYTGSSVFGLTSFYSELMQGVGAATRLFELT---------DRVPSIKPTTGKKFV---- 437
                     +T F+S LM G   +  + ++T          ++       GK  +    
Sbjct: 283 ----------ITCFHSCLMLGATVSEAMSQVTVIQKGHVANKKLEGFLELEGKTIMQAAL 332

Query: 438 --PGKGE---IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLL 492
             P KG    I F +++F YP R  N    ++ +++ +G    ++G SG GKST+A LLL
Sbjct: 333 KCPPKGNSLSITFNNISFKYPCRTSNSAVENVSLRLESGKMTFIIGKSGSGKSTLAKLLL 392

Query: 493 RFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPS---- 548
           RFY   SG I +D   I  LN + L  +I +V+Q   L + TLR+NI  G +E  S    
Sbjct: 393 RFYEEYSGSITVDNISICDLNQEWLLSNITVVEQNCTLFNDTLRNNILLG-SENQSEPAR 451

Query: 549 ----KEEIRMVAKQC---FCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKP 601
               +E  R + K C     +  +     G DTVIG  G  LSGGQ+QR+A+ARA ++  
Sbjct: 452 MESIEERERKLRKACNFALLNEMLADLTDGLDTVIGSGGVELSGGQRQRVALARAFLRNT 511

Query: 602 TILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSV 661
            I++ DE+ SALDV     +        + K  T + + H LS I  ++ I ++ + G V
Sbjct: 512 PIMIFDESVSALDVAHRKLLMKAIRSWRQGK--TTIVLTHELSQINPTDFIYIMEH-GRV 568

Query: 662 VETGKFKELF 671
            E G  ++L 
Sbjct: 569 CEYGYQEDLL 578

>Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON}
            (464370..468200) [3831 nt, 1277 aa]
          Length = 1276

 Score =  185 bits (470), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 140/509 (27%), Positives = 253/509 (49%), Gaps = 26/509 (5%)

Query: 180  VANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFDR--HKVGDLISRLGSDAYVVSR 237
            V+N+ +  +L   SE  +  LR   +++   +  E+F R  +K  ++ + L +D   +  
Sbjct: 763  VSNFLKTFILGYCSEYWIMDLRNRAMEEIAQKKLEWFSREENKSPEIAALLMNDLRDLRS 822

Query: 238  SMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQ 297
             ++Q +S     L           +   +LS + +   P ++  + I+G  +++  T  +
Sbjct: 823  LVSQFLSVISTFLTVSLVGLIWAIATGWKLSLVCISMFPLIVIFSIIYGTVLKNYETTYK 882

Query: 298  EATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRD-IFNVGKRAAYINAQFFTATS 356
                 L  +  E ++GV+T++  +  Q    +  H ++D +  + ++ A +       T+
Sbjct: 883  TKVANLENLEYEIITGVKTIKC-LQLQNHFKKCYHKLKDEMGQIARKRAIVTGLGIAITT 941

Query: 357  SLGDISFLVVLAYGSYLVLQGGL---TIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVG 413
            ++      ++  YG  LV+ G     T+      +L+T  T +S   L S   ++ +G  
Sbjct: 942  AIATTIQSILYYYGLKLVMDGEYSTRTMFQTFTLLLFTVMTCNS---LISQIPDISRGQR 998

Query: 414  AATRLFELTDRVPSIKPTT-----------GKKFVPGKGEIVFKDVTFSYPTRPGNVIFR 462
            AA+ ++ + +     K  T           G+K    +  +   ++ F+YPT     I+ 
Sbjct: 999  AASWIYRIIEESEDTKEQTITDGRFDEIHCGEKVDKTQPLVSIHNLEFAYPTALDVNIYD 1058

Query: 463  DMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIG 522
            ++ + +  G  V +VG SG GKST+  LL + Y  +   I IDG D+++ + ++LRR I 
Sbjct: 1059 NLSLDLNVGQTVAIVGESGSGKSTLVYLLTKLYQVADNCIDIDGTDVNEWDNETLRRQIS 1118

Query: 523  LVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGAL 582
            +V+Q+PVL  GT+R+N+ YGL  +P + +I  + K    ++FI   P G +T +    +L
Sbjct: 1119 VVEQKPVLFPGTVRENLIYGLYFSPLEIDIIDILKYVGVYDFIESLPEGLETSVDT--SL 1176

Query: 583  LSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHR 642
            +SGGQ QR+ IARAL++KP IL+LDE TSALD  S   IN    +     S+  +SI H 
Sbjct: 1177 ISGGQAQRLCIARALLRKPKILILDECTSALDANSSKIINDIVAK--GPPSLLTISITHN 1234

Query: 643  LSTIRRSENIIVLGNDGSVVETGKFKELF 671
               + RS N + +  DG + ETG F +LF
Sbjct: 1235 -EQMMRSCNTVAVLKDGKICETGPFNKLF 1262

 Score =  146 bits (368), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 118/424 (27%), Positives = 203/424 (47%), Gaps = 23/424 (5%)

Query: 264 SPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAE 323
           S  L+ ++L  TP ++  A IF R I+  +      +G    +    ++  + ++    +
Sbjct: 173 SWSLTLIILCGTPLLIILAFIFSRSIQKYAALENTESGLAADLLAWSMNSAQMIKLSCTQ 232

Query: 324 QKEIHRYSH---AIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLT 380
            KEI  +        D F   K + Y+ A   T    L    F+    +G+  + +G L 
Sbjct: 233 LKEIESFEELTLKCNDYF--IKLSLYVAANISTL-RFLSLAMFVQGFWFGNTEIRKGNLN 289

Query: 381 IGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFE-LTDRVPSIKPTTGKKFVPG 439
           I D+          GS++     +   L +G  A  ++   L D    I  +  K+    
Sbjct: 290 ISDVITCFSSCLMLGSTLNTTLGYLIFLQKGQVALRKIQSFLNDNKVEIDESALKQIDIS 349

Query: 440 KGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSS 499
           K +I F+ V+FSYP+RP + +  D+ I   +G    +VG SG GKST++ LLL+ Y+   
Sbjct: 350 KADISFRHVSFSYPSRPADDVLNDISIDFLSGKTTFIVGRSGSGKSTLSNLLLKLYDEYD 409

Query: 500 GQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYG---------LTETPSKE 550
           G I I    I +++ + L ++I +V+Q   L + TL +NI  G         + +   KE
Sbjct: 410 GYISIGSTHIREIDQQVLIKNITVVEQRCTLFNDTLVNNILLGSQDEDKSSPVVQKKLKE 469

Query: 551 EIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEAT 610
            I+M    C   + I    +G DT++G  G  LSGGQ+QR+A+ARA ++   +L+LDEA 
Sbjct: 470 AIKMA---CL-ESVIDSLSNGLDTILGTGGISLSGGQQQRVALARAYMRDTEVLILDEAV 525

Query: 611 SALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKEL 670
           SALD+     +     +  + ++  I++  H LS I   + + V+  +G ++E+G   +L
Sbjct: 526 SALDIVHREQLMSNITKWRQGRTTIILT--HELSQISIQDYLYVV-EEGRIIESGFQGQL 582

Query: 671 FADP 674
             DP
Sbjct: 583 MYDP 586

>TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_1.527
            YKL209C
          Length = 1296

 Score =  183 bits (465), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 132/502 (26%), Positives = 245/502 (48%), Gaps = 17/502 (3%)

Query: 180  VANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFF--DRHKVGDLISRLGSDAYVVSR 237
            ++N+ +  LL I SE  +  LR   +K+ + +  ++F  ++++  ++ + + +D   + R
Sbjct: 784  ISNFFKGFLLGICSEYWIMDLRDKFMKEILRKKIQWFSDEKYQTAEMSALILNDLRDL-R 842

Query: 238  SMTQKVSDGFKALICXXXXXXXXXSIS-PQLSGLLLLFTPPVLFSASIFGRKIRDTSTDL 296
            S+  +        I           ++  +L+ + +   P ++  ++I+G  ++ + TD 
Sbjct: 843  SLVSEFMSAMATFIVVSLFGLIWALVTGWKLALVCIAMFPLIIIFSAIYGAVLQKSETDY 902

Query: 297  QEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATS 356
            + +   L  +  + +S ++T++S   E    H Y  A   + NV  + +       + T+
Sbjct: 903  KSSVANLENIEFDIVSNIKTIKSLQLEGHFYHNYKVAETKLKNVATKRSIYTGLGISITN 962

Query: 357  SLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAAT 416
            ++      ++  YG  L++ G  T+  +        +T  +   L +   ++ +G  AA+
Sbjct: 963  TITMCIQAILYYYGFKLIMDGEYTVKQMFTTFTLLLFTVMTCNSLVNQIPDMSRGQRAAS 1022

Query: 417  RLFELTDRVPSIKPTTGKKFVPGKGEIV--------FKDVTFSYPTRPGNVIFRDMDIKI 468
             ++ +  +    K       +      +         K++TF+Y + P   +   + +K+
Sbjct: 1023 WVYSILQQSDDTKEVNDPNSIIVDNNTISNDFPILDIKNLTFAYESTPSIKVLDGLTLKL 1082

Query: 469  PAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEP 528
              G  + + G SG GK+T+  LL++FY+    QI+ +G+DI     +SLR  I +V+Q+P
Sbjct: 1083 FPGDKLAIAGESGCGKTTLLSLLVKFYDVDPNQIYFNGKDILNYEFESLRDAIVIVEQKP 1142

Query: 529  VLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQK 588
             ++SG++RDN+        S  E+  V K     +FI   P G DT+I     LLSGGQ 
Sbjct: 1143 SVLSGSIRDNLLGNNKRLISDYELYDVLKLTGIFDFIETLPSGIDTIIDT--TLLSGGQA 1200

Query: 589  QRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRR 648
            QRI IARAL++KP IL+LDE TSALD  S   IN    + +    VTI+SI H  S +  
Sbjct: 1201 QRICIARALLRKPKILILDECTSALDAMSADIINNLVSKEL--NGVTIISITHSESMMTS 1258

Query: 649  SENIIVLGNDGSVVETGKFKEL 670
             +N+ VL N G +VE G +  L
Sbjct: 1259 CQNVAVLKN-GKIVEVGTYDSL 1279

 Score =  165 bits (418), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 146/591 (24%), Positives = 274/591 (46%), Gaps = 44/591 (7%)

Query: 104 DWKLLVIAITLLTVSCGIGMTIPKVI-GMILDVLKTGLETNEGKD---GPISMADVPPIF 159
           D+KLL + I+L T++ G+  TI  ++ G I  +LK  +     K      +++  +  + 
Sbjct: 29  DYKLLFL-ISLSTLANGLVPTISSILTGRIFAILKDFVNPELSKSQIHNKLTLNTMSIMI 87

Query: 160 MGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFDRH 219
           +G      +G F   +++  ++ +  I       ER   ++R  ++   + Q   ++D +
Sbjct: 88  LG------VGCFP--IMWTCISTWMSI------GERQGIKVRTKILNNYLTQSMTWYDLN 133

Query: 220 KV--GDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPP 277
           +   GD  ++L      +  S  +  +  F+  I            S  L+ ++L  TP 
Sbjct: 134 EQLQGDF-TQLHRCVEELRSSSAEASAVTFQNCIAIIALIATSFYYSWSLTLIILCSTPI 192

Query: 278 VLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDI 337
           +   +  F   I+  +      T    ++  E +  ++ ++    + K++ ++  +I   
Sbjct: 193 ICIFSICFSIMIQKFANLENNETTVSAQIFTETIQNIQLIKLNNLQLKKLMKFQTSISKC 252

Query: 338 FNVGKRAAYINAQFFTA--TSSLGDISFLVVL---AYGSYLVLQGGLTIGDLTAFMLYTE 392
                   +I    + +  TS L  ++ L+ +    +GS ++ +G L I ++        
Sbjct: 253 -----NKFFIQMCLYVSLNTSILRTLTLLMFVQGFWFGSTMIRKGHLKIDEVITCFSSCL 307

Query: 393 YTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGKGEIVFKDVTFSY 452
             GS +         L +G  A  ++ +  D                   I F++++F+Y
Sbjct: 308 LLGSIISNTLHQIVVLQKGEVALQKIVDFLDEADDPLEINSAPITLINSNISFQNISFAY 367

Query: 453 PTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKL 512
           P+RP   I   +++     +   +VG SG GKST++ LLL+FY    G I ID  +I  L
Sbjct: 368 PSRPNENILNQINLYFQNSATTFIVGKSGSGKSTLSNLLLKFYETYKGDILIDNINIKNL 427

Query: 513 NIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSK---------EEIRMVAKQCFCHN 563
           N K+L  +I +V+Q+  L + T+R+NI +G++   ++         E ++         +
Sbjct: 428 NQKNLLDNIMIVEQKCTLFNDTIRNNILFGVSNFTNQYASNRPNLNERLKNACTFALLDH 487

Query: 564 FIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINY 623
           F++  P+G DTVIG  G  LSGGQ+QR+A+ARA ++ P IL+LDEA SALDV     +  
Sbjct: 488 FLIDLPNGIDTVIGTGGITLSGGQQQRVALARAYMRDPPILILDEAVSALDVNIRELLMK 547

Query: 624 TFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADP 674
              +L +S   TI+ + H L+ I   + + V+ + G ++E GK KEL  DP
Sbjct: 548 AI-KLWRSNKTTII-LTHDLTQIDNDDFLYVIKH-GRIIEHGKRKELITDP 595

>Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON}
           YKL209C (REAL)
          Length = 1316

 Score =  183 bits (464), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 156/605 (25%), Positives = 269/605 (44%), Gaps = 65/605 (10%)

Query: 102 KPDWKLLVIAITLLTVSCGIGMTIPKVI-GMILDVLKTGLETNEGKD------------G 148
           + D+KLL++ I + TV+ G+   I  ++ G + D+L   + +    D             
Sbjct: 47  RSDYKLLILMI-ISTVATGLVPAITSILTGRVFDLLSVFVLSGSHNDLYPQLVQRAMAVM 105

Query: 149 PISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRANVIKKT 208
            + +A VP +++  + + ++G    L               RI S+ + A L    +K  
Sbjct: 106 ALGVASVPAMWLSLTSWMYIGEKQGL---------------RIRSQLLEAYLEKKPMKWY 150

Query: 209 IHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLS 268
              D+   D  ++   +  L S       S  +  +  F+ L+            S  L+
Sbjct: 151 DVNDTLLGDFTQINRCVEELRS-------SSAEASAITFQNLVAICALLGTSFYYSWSLT 203

Query: 269 GLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIH 328
            ++L  +P + F A  F R +   S    E T +  ++    ++  + V+ +  +  E  
Sbjct: 204 LIILCSSPIITFFAVAFSRMVHMYSQKENEETSKAAQLFAWSMNAAQLVRLYCTQPLERK 263

Query: 329 RYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVV------LAYGSYLVLQGGLTIG 382
           ++   I     +     +I +  F A ++ G + FL +        +GS ++ QG L I 
Sbjct: 264 KFQRII-----LSCNTFFIKSCLFVAANA-GILRFLTLTMFVQGFWFGSTMIKQGKLNIN 317

Query: 383 DLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVP---- 438
           D+          GS++         L +G  A  ++  L +  P   P    +       
Sbjct: 318 DVITCFHSCILLGSTLNNTLHQIVVLQKGEVALQKIMNLLENGPKCNPPNEIELHQYPLD 377

Query: 439 -GKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNP 497
               ++VF +V+FSYP+RP  ++  +  +K PAG    +VG SG GKST++ LLL+FY+ 
Sbjct: 378 YANSDLVFDNVSFSYPSRPSEIVLENASLKFPAGQFTFIVGKSGSGKSTLSSLLLKFYDG 437

Query: 498 SSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEE------ 551
             G I I+G++I  +  K L ++I +V+Q   L + TLR NI  G TE     +      
Sbjct: 438 YDGSISINGRNIQAIPQKLLIKNITVVEQRCTLFNDTLRKNILLGSTELAKNADYSTNKN 497

Query: 552 ---IRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDE 608
              I+   +       I+  P G +T+IG  G  LSGGQ+QR+A+ARA I+   IL LDE
Sbjct: 498 TNLIKDACRMALLDRLILDLPDGLETLIGSGGVTLSGGQQQRVAMARAFIRDTPILFLDE 557

Query: 609 ATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFK 668
           A SALD+     +        K K+  I++  H L  +  S++ + L  +G V+E+G   
Sbjct: 558 AVSALDIIHRNLLMKAIRHWRKGKTTIILT--HELGQV-ESDDHLYLMQEGKVIESGTQS 614

Query: 669 ELFAD 673
           EL AD
Sbjct: 615 ELLAD 619

 Score =  160 bits (405), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 147/527 (27%), Positives = 256/527 (48%), Gaps = 38/527 (7%)

Query: 173  ALMVFGIVA-----NYGRIVLLRILSERVVARLRANVIKKTIHQDSEFF--DRHKVGDLI 225
            + +V G+ A     N+ +  LL   SE  +  LR  V++K   +   +F  + +K  ++ 
Sbjct: 789  SCIVLGVAAADGIFNFAKGFLLGYCSEYWIMDLRNEVMEKLTKKSMNWFSGEDNKASEVS 848

Query: 226  SRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSIS-PQLSGLLLLFTPPVLFSASI 284
            + + +D   + RS+  +      + I            S  +LS + +   P ++  ++I
Sbjct: 849  ALVLNDLRDL-RSLVSEFLSAITSFITVSFIGLVWALASGWKLSLVCISMFPLIIIFSAI 907

Query: 285  FGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAE---QKEIHRYSHAIRDIFNVG 341
            +G  ++   TD + +  QL     + ++ ++T++   AE   Q   H+    +  I    
Sbjct: 908  YGSILQKHETDYKTSVVQLENCLYQIVTNIKTIKYLQAEFHFQLSYHKLKTKMEQI--AS 965

Query: 342  KRAAYINAQFFTATSSLGDISFLVVLAY-GSYLVLQGGLTIGDLTAFMLYTEYTGSSVFG 400
            KRA  I   F  + +++  +    +L Y G  LV+    T   +        +T  S   
Sbjct: 966  KRA--IATGFGISMTNMIAMCIQAILYYYGLKLVMVHEYTSKKMFTTFTLLLFTIMSCTS 1023

Query: 401  LTSFYSELMQGVGAATRLFELTD--RVPSIKPTTGKKFVPGKGE----------IVFKDV 448
            L S   ++ +G  AA+ ++ + D  +V         + +   GE          +  +++
Sbjct: 1024 LVSQIPDISRGQRAASWIYRILDEKQVTLEIEDNNARSIGIIGETYHEKQTTPMLSIQNL 1083

Query: 449  TFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQD 508
            TF+YP+ P  +I+++M++ +  G  + +VG SG GKST+ LLL R Y+   G I +DG D
Sbjct: 1084 TFAYPSAPSVLIYKNMNLNMFCGQTIGIVGGSGSGKSTLVLLLTRLYDCEVGSIKLDGTD 1143

Query: 509  ISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKF 568
            ++  N+  LRR I +V+Q+P+L +GT+RDN+TYG      + EI    K    ++F+   
Sbjct: 1144 VNDWNLTVLRREISVVEQKPLLFNGTIRDNLTYGCLGEILEIEIYDALKYVGIYDFVASL 1203

Query: 569  PHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQL 628
            P G  T I     LLSGGQ QR+ IARAL++KP IL+LDE TSALD  S   I     ++
Sbjct: 1204 PLGLGTRIDTN--LLSGGQAQRLCIARALVRKPKILILDECTSALDSMSSHVIK----EI 1257

Query: 629  MKS--KSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFAD 673
            +K    ++  + I H    +R  ++I V   DG V+E G F  L+ +
Sbjct: 1258 VKKGPPALLTLVITHDEQMMRCCDSIAVF-KDGKVIEEGSFDTLYNN 1303

>NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1.527
           YKL209C
          Length = 1293

 Score =  181 bits (459), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 138/502 (27%), Positives = 237/502 (47%), Gaps = 30/502 (5%)

Query: 192 LSERVVARLRANVIKKTIHQDSEFFDRHK--VGDLISRLGSDAYVVSRSMTQKVSDGFKA 249
           L ER    +R  ++ + + +  E++D H   +GD  +++      +  S  +  +  F+ 
Sbjct: 100 LGERQGFAIRKRLLNEYLVKPMEWYDCHDKLLGDF-TQVNRCVEELRSSSAEASAITFQN 158

Query: 250 LICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEE 309
            +            S  L+ ++L   P ++  A +F   I   +      TG+  ++   
Sbjct: 159 FVAMLALIGTSFYYSWSLTLIILCSAPLIILFAILFSHMIHKYTELENSETGKAAQLLNW 218

Query: 310 QLSGVRTVQSFVAEQKEIHRYSHAI---RDIFNVGKRAAYINAQFFTATSSLGDIS---F 363
            ++  + V+ +  +  EIH +   +    D+F   K   Y++A     TS L  +S   F
Sbjct: 219 SMNSAQLVKLYCTQAYEIHSFKELVGQCNDLF--IKSCFYVSAN----TSILRFLSLSMF 272

Query: 364 LVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFEL-- 421
           +    +G+ +V +G L+I D+          GS++         L +G  A  ++ +   
Sbjct: 273 VQGFWFGAIMVKKGKLSIKDVITCFHSCLMLGSTLNNTLQQIVVLQKGDVALKKILDFIS 332

Query: 422 -TDRVPSIKPTTGKKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPS 480
            + R PS++P          GEI F++++F+YPTRP   + +D+ I    G +  ++G S
Sbjct: 333 FSQRSPSLEPPYEPSVPISNGEISFQNISFAYPTRPHQTVLKDVSITFQPGRSTFIIGKS 392

Query: 481 GRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNIT 540
           G GKST+A LLL+FYN   G I I   ++ K+N   L  +I +V+Q   L + TLR+N+ 
Sbjct: 393 GSGKSTLANLLLKFYNDYQGSIKIGNTNVKKINKNWLFENITVVEQRCTLFNDTLRNNLL 452

Query: 541 YGLTETPSKEE---------IRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRI 591
            G++ +  K E         ++   +       I + P G DT+IG  G  LSGGQ+QR+
Sbjct: 453 LGISNSNQKVEQDDIEISQRLKDACRIAMLEELIRELPDGLDTIIGAGGVSLSGGQQQRV 512

Query: 592 AIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSEN 651
           AIARA IK  ++L+LDEA SALD+     I          K+  I++  H LS +   + 
Sbjct: 513 AIARAYIKDSSVLILDEAVSALDIIHRELIMKAIKNWRSGKTTIILT--HDLSQLDYDDF 570

Query: 652 IIVLGNDGSVVETGKFKELFAD 673
           + V   DG V E+G  + L  D
Sbjct: 571 LYVF-EDGEVKESGYQQALLQD 591

 Score =  166 bits (419), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 119/421 (28%), Positives = 205/421 (48%), Gaps = 20/421 (4%)

Query: 266  QLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQK 325
            +LS + +   P ++  + I+G  ++   T  + A  +L     E ++ ++T++   A + 
Sbjct: 868  KLSLVCISMFPLIILVSGIYGSTLQRYETMYKTAVAELENHEYEIMTKIKTIRYLQASKY 927

Query: 326  EIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLT 385
             I  Y     ++  +  + +       + T+++      ++  YG  LV +G  +   + 
Sbjct: 928  FIKNYKVLENNLKKIAHKRSIATGFGISITNTIAVCIQSILYYYGLRLVFKGEYSSKKMF 987

Query: 386  AFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPT------TGKKFVPG 439
                   +T  S   L S   ++ +G  AA+ L+ + D     K +      +    + G
Sbjct: 988  ETFTLLLFTIISCTSLVSQIPDISRGQRAASWLYRILDESDDNKESVDSGSRSADIIISG 1047

Query: 440  KGE----IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSN-VCVVGPSGRGKSTIALLLLRF 494
                   I  K++ FSYP+     I++++ + + +    + +VG SG GKST+  LL + 
Sbjct: 1048 NTNSVPLISIKNLRFSYPSAQTVEIYKNITLHVTSSQKTIGIVGESGSGKSTLMYLLTKL 1107

Query: 495  YNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRM 554
            Y   +  I+IDG D+++ +   LR+ I +V+Q P L  GT+RDN+ YG     S+ EI  
Sbjct: 1108 YKTPANSIYIDGTDVNEWDTLKLRKQISVVEQNPTLFEGTVRDNLVYGTLNDISEIEIYD 1167

Query: 555  VAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALD 614
            V K    + FI   P G D+ I  +  L+SGGQ QR+ IARAL++KPTIL+LDE TSALD
Sbjct: 1168 VLKYLGIYEFIENLPMGLDSRIDTK--LVSGGQAQRLCIARALLRKPTILILDECTSALD 1225

Query: 615  VESEGAINYTFGQLMKS--KSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFA 672
              S   IN     L+K+   +V  + I H    +    ++ V+  DG + E G F EL  
Sbjct: 1226 AASAHLIN----NLVKNGLPTVLTIVITHSKQMMEACNSLAVI-KDGRLAEQGNFAELMK 1280

Query: 673  D 673
            +
Sbjct: 1281 N 1281

>Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON}
            YKL209C (REAL)
          Length = 1295

 Score =  180 bits (457), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 148/527 (28%), Positives = 248/527 (47%), Gaps = 38/527 (7%)

Query: 173  ALMVFGIVA-----NYGRIVLLRILSERVVARLRANVIKKTIHQDSEFF--DRHKVGDLI 225
            + +V G+ A     N+ +  LL   SE  +  LR  +++K   ++  +F  + +K  ++ 
Sbjct: 764  SFVVLGVAAADGIFNFAKGFLLGYCSEYWIMDLRNEIMEKVTRKNINWFSGENNKAAEIS 823

Query: 226  SRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSIS-PQLSGLLLLFTPPVLFSASI 284
            + + +D   + RS+  +      + I           IS  +LS + +   P ++  + I
Sbjct: 824  ALVMNDLRDL-RSLVSEFLSAMTSFITVSTIGLVWALISGWKLSLVCISMFPLIIIFSVI 882

Query: 285  FGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAE---QKEIHRYSHAIRDIFNVG 341
            +G  ++   TD + +  QL     + ++ ++T++   AE   Q   H     +  I    
Sbjct: 883  YGSSLQTYETDYKSSVAQLENCLYQIVTSIKTIKCLQAEFHFQLTYHDMKTKMEGI--AS 940

Query: 342  KRAAYINAQFFTATSSLGDISFLVVLAY-GSYLVLQGGLTIGDLTAFMLYTEYTGSSVFG 400
            KRA  I   F  + +++  +    +L Y G  LV+    T   + A      +T  S   
Sbjct: 941  KRA--IATGFGVSMTNMIAMCIQAILYYYGLKLVMVHEYTSKKMFATFTLLLFTIMSCTT 998

Query: 401  LTSFYSELMQGVGAATRLFELTDRVPS---IKPTTGKKFVPGKGE---------IVFKDV 448
            L     ++ +G  AA+ ++ + D       I+   G+      G          +  +++
Sbjct: 999  LVGQIPDISRGQRAASWIYRILDEAECTLEIEDNNGRVLGISGGTYYGNSNKPIVSIQNL 1058

Query: 449  TFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQD 508
            TF+YP+ P   I++ MD+ +  G  V +VG SG GKST+ LLL   Y    G I IDG D
Sbjct: 1059 TFAYPSAPNISIYKRMDLNMFCGQTVGIVGESGSGKSTLVLLLTGLYACKVGCIEIDGTD 1118

Query: 509  ISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKF 568
            ++  N+ SLRR I +V+Q+P L  G++RDN+TYG        E+    K    ++F+   
Sbjct: 1119 VNDWNLTSLRREISVVEQKPSLFDGSIRDNLTYGCLGQMPDFELYDALKYVGIYDFVASL 1178

Query: 569  PHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQL 628
            P   DT I     LLSGGQ QR+ IARAL++K  IL+LDE TSALD  S   IN     +
Sbjct: 1179 PQSLDTRIDTN--LLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSRIIN----DI 1232

Query: 629  MKSK--SVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFAD 673
            +K    ++  + I H    +R   +++V   DG +VE G F  L+ D
Sbjct: 1233 VKKGPPALLTMVITHNEEMMRCCSSVVVF-KDGKIVEEGSFDTLYND 1278

 Score =  172 bits (435), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 136/505 (26%), Positives = 246/505 (48%), Gaps = 33/505 (6%)

Query: 192 LSERVVARLRANVIKKTIHQDS-EFFDRHK--VGDLISRLGSDAYVVSRSMTQKVSDGFK 248
           + ER   R+R+ +++  + +   E++D ++  +GD  +++      +  S  +  +  F+
Sbjct: 100 IGERQGFRIRSMLLEAYLKKKPIEWYDANETLLGDF-TQINRCVEELRSSSAEASAITFQ 158

Query: 249 ALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSE 308
            L+            S  L+ ++L  +P +   A  F R I   +      TG+  ++  
Sbjct: 159 NLVAICALIGTSFFYSWSLTLIILCSSPIIALFAVAFCRMIHIYTKKENTETGKAAQLLT 218

Query: 309 EQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVV-- 366
             ++  + V+ +  +  E  ++   + +         +I + F+ A ++ G + FL +  
Sbjct: 219 WSMNAAQLVRLYCTQPLERKKFEEIVSNC-----NTFFIKSCFYLAANA-GVLRFLTLTM 272

Query: 367 ----LAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELT 422
                 +GS ++ +G L I D+          G+++         L +G  A  ++  L 
Sbjct: 273 FVQGFWFGSTMIRKGRLNINDVITCFHSCIMLGTTLNNTLHQIVVLQKGEVALEKIMTLL 332

Query: 423 DRVPSIKPT-TGKKFVP----GKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVV 477
           +  P    + T + + P      G++VF++V+F+YP+RP   I ++  IK P G    +V
Sbjct: 333 ENGPKRNTSNTIELYQPLIDYATGDLVFENVSFAYPSRPTETILQNAGIKFPGGQFTFIV 392

Query: 478 GPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRD 537
           G SG GKSTI+ LLL+FY+   G I I+G++I  +  KSL  +I +V+Q   L + TL++
Sbjct: 393 GKSGSGKSTISNLLLKFYDGYDGSISINGRNIQTIPQKSLIENITVVEQRCTLFNNTLKN 452

Query: 538 NITYGLT------ETPSKEEIRMVAKQC---FCHNFIVKFPHGYDTVIGPQGALLSGGQK 588
           NI  G T      ++ + +   ++ + C        I+  P G +T+IG  G  LSGGQ+
Sbjct: 453 NILLGSTGSIRNADSNTIDNNNLIKEACRMALLDRLILDLPDGLETIIGSGGITLSGGQQ 512

Query: 589 QRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRR 648
           QR+AIARA I+   IL LDEA SALD+     +        K K+  I++  H+LS I  
Sbjct: 513 QRVAIARAFIRDTPILFLDEAISALDIVHRNLLMKAIRHWRKGKTTIILT--HQLSQI-E 569

Query: 649 SENIIVLGNDGSVVETGKFKELFAD 673
           +++ + L  DG V+E+G   EL  D
Sbjct: 570 ADDYLYLMQDGKVIESGIQSELLVD 594

>AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKL209C (STE6)
          Length = 1284

 Score =  180 bits (456), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 134/502 (26%), Positives = 238/502 (47%), Gaps = 12/502 (2%)

Query: 177  FGIVANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVS 236
            F  V N+ ++ LL  +SE+ V +LR N+++  + +D  +  ++K  ++ +   +D   + 
Sbjct: 773  FDAVFNFLQLFLLGFVSEQCVRQLRGNMMQLVLKRDLHWISQNKSSEITALTMNDLRDLR 832

Query: 237  RSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDL 296
               +  +S      +           I  +L+ + L   P  +   +++G  ++ +    
Sbjct: 833  NVTSILLSSLTSLCVLASVGLIWAIVIGWKLTLVCLSLLPLFIGVITLYGMFVQKSEVQY 892

Query: 297  QEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATS 356
            + A  QL  +  E + GV+T++    E     RY+   + +    +R + +       TS
Sbjct: 893  KTAVSQLENLLSEIVKGVKTIKCLQLEPYFQGRYATMEKYLKKQMRRRSILYGSGLAITS 952

Query: 357  SLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAAT 416
             L  +   ++  YG  LV+ G      L        +T  S  GL S      +G  A T
Sbjct: 953  CLVILLQTILYYYGIRLVVTGEYDSKQLFQTFTLILFTTMSSVGLLSALPSSSRGQRAGT 1012

Query: 417  RLFELT-------DRVPSIKPTTGKKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIP 469
             +F +        D   ++           +  +V + + F+YP      I+++ +++I 
Sbjct: 1013 FVFGMLEEPLPEPDNYSAVLRKAPTNHFSREPLVVLRALNFAYPAAKDVQIYKNFNLRIN 1072

Query: 470  AGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPV 529
             G+ V +VG SG GKST+  L+   Y      +FIDG DI    + +LR+ I +V+Q+P 
Sbjct: 1073 QGTKVAIVGESGSGKSTLFYLICGLYPVKPASLFIDGTDICNWEMSALRKIIAVVEQKPR 1132

Query: 530  LMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQ 589
              +GT+R+N+ YGL  T +  EI  V  +    NF+   P G +T +     L+SGGQ Q
Sbjct: 1133 FFNGTIRENLVYGLEGTITDNEIYEVLAEVRIINFVRSLPEGLETRVDTN--LVSGGQLQ 1190

Query: 590  RIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRS 649
            R++I RAL+++PT+L+LDE TSALD  +  AI       +    +T++ I H    ++  
Sbjct: 1191 RLSIVRALLRRPTLLILDECTSALDAANANAIANVVRNSL--HDITVIVITHSKQMMKMC 1248

Query: 650  ENIIVLGNDGSVVETGKFKELF 671
            + I+VL N G+V E G F +LF
Sbjct: 1249 DRIVVLKN-GAVAEDGSFDDLF 1269

 Score =  117 bits (293), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 133/615 (21%), Positives = 260/615 (42%), Gaps = 56/615 (9%)

Query: 87  QKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGLETNEGK 146
           +++ +KD +   +    D+ LL+  IT+  +   +   +  + G + DV++   +     
Sbjct: 3   KRAQIKDGIYSYVYISKDYGLLITMITMTIIWGTVPAVVAVLTGRVFDVMQQLAQMKYN- 61

Query: 147 DGPISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRANVIK 206
               + A+   + +  S+        ++ +  I   +  I    +L ER   R+R  +++
Sbjct: 62  ----TQAEFLHVLLVRSL-----ELGSVGLVQIPVQWIAITSWMLLGERQSLRIRRELLR 112

Query: 207 KTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDG--------FKALICXXXXXX 258
             + +  +++D  K+ D+     +  Y ++    ++            F++ +       
Sbjct: 113 SYLAKPMQWYD--KIDDI-----NGMYTITNRCVEEARASCAEASGVLFQSAVTALILAV 165

Query: 259 XXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQ 318
                S +L+ + L   P +     +F + ++  +    E T   +      L+    V+
Sbjct: 166 TAFKFSAKLTVVTLAGAPLLALLTVVFSKFVQKYAALENEQTSSASSTLSWALNSATMVK 225

Query: 319 SFVAEQKEIHRYSHAIRDIFNVGKR-------AAYINAQFFTATSSLGDISFLVVLAYGS 371
            F  +  E+ +++ A+    N+ K+        + IN     A   L  + F+    YGS
Sbjct: 226 LFGTQDLELRKFNKAV----NLSKKYFVRTLICSSINQ---AAMRFLSLMMFVQAFWYGS 278

Query: 372 YLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPT 431
            L+ +  +    +      +    SS+  + S    L +G  A  ++ E  +  P  +P 
Sbjct: 279 ILIQRDEVETAAVITVFSASVLLSSSINAMLSKVVLLQKGKVACRQIAEAVNVEPEGRPN 338

Query: 432 TGK---------KFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGR 482
                              EIVF  V+F+YP RP       + +         +VG SG 
Sbjct: 339 QYAFPYEVGHIIALEDQPSEIVFDQVSFNYPARPDTKALDGVSLTFRPNQITFIVGKSGS 398

Query: 483 GKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYG 542
           GKST+  LLL+FY+   G I ++  ++  ++   L ++I LV+Q   L +GTL +NIT  
Sbjct: 399 GKSTLGNLLLKFYSDYEGIITVNSTNLRGIDRSWLLQNITLVEQSCTLFNGTLFENIT-- 456

Query: 543 LTETPSKEEIRMVAKQC---FCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIK 599
           L+  P  +    V + C        +   P G  T +G  G  +SGGQ+QR+A+ARA+++
Sbjct: 457 LSAKPVNKTAGAVKRACQMALLEKLVFDLPEGLHTKVGSGGISMSGGQQQRVALARAILR 516

Query: 600 KPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDG 659
              +L+LDEA SALD+     +          K+  I++  H LS +   ++ + +   G
Sbjct: 517 DAPVLILDEAISALDIIHRDLLMEVIRSWRADKTTIILT--HELSHV-LDDDYLYMMEHG 573

Query: 660 SVVETGKFKELFADP 674
            V+E G   EL ++P
Sbjct: 574 QVIEQGYKSELLSNP 588

>SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1310

 Score =  179 bits (455), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 144/493 (29%), Positives = 237/493 (48%), Gaps = 25/493 (5%)

Query: 193  SERVVARLRANVIKKTIHQDSEFF--DRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKAL 250
            SE  +  LR   I+K   QD  +F  D +K  ++ + + +D   + RS+  +       L
Sbjct: 818  SEYWIRDLRMLAIRKITAQDLHWFSLDMNKSSEISALVLNDLRDL-RSLVSEFLSSISTL 876

Query: 251  ICXXXXXXXXXSIS-PQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEE 309
            I           IS  +LS + +   P  +  +  +G  ++   TD +    +L     E
Sbjct: 877  IIVSSVGIVWAFISGWKLSLVCISLFPIFILFSCFYGGLLQRYETDYKTKVAELENQLHE 936

Query: 310  QLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVL-A 368
               G+ T++    E + + +Y +  + +    K+ A I   F  A S+   ++   +L  
Sbjct: 937  IFRGITTIRYLKLEYQFLEKYYNLEKKMRRASKKRA-ITIGFGVAASNTLTLAVQAILFY 995

Query: 369  YGSYLVLQGGLT---IGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRV 425
            YG  LV  G  +   + +    +L+T  T  S+ G      ++ +G  AAT +F + D  
Sbjct: 996  YGIKLVTTGSYSTEKMFETFTLLLFTVMTCVSLIGQIP---DISRGQRAATYIFRIIDNQ 1052

Query: 426  PSIKPTTGKKFVPGKGE----IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSG 481
                    KK    K      I  K+++FSYP+ P   I++ + + + +G  + VVG SG
Sbjct: 1053 SPAAKDEKKKIASYKFTHDPLISVKNLSFSYPSAPSTAIYKGLKLDVFSGETIAVVGESG 1112

Query: 482  RGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITY 541
             GKST+ LL+   Y   +G I IDG DI++ +   LR  I +V+Q+P    GT+ +N+ Y
Sbjct: 1113 SGKSTLTLLISALYEVPNGSIEIDGIDINRWDTNKLRTIISVVEQKPQFFDGTVGENLLY 1172

Query: 542  GLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKP 601
            G++   ++ +++         +F+   P G DT I    +L+SGGQ QR++IARA+++KP
Sbjct: 1173 GISGRVTQIQVKEALCLAGVQDFVFSLPEGLDTRIDT--SLISGGQAQRLSIARAMLRKP 1230

Query: 602  TILVLDEATSALDVESEGAINYTFGQLMKSK--SVTIVSIAHRLSTIRRSENIIVLGNDG 659
             IL LDE TSALD  +  AI      L+K     +T + I H    +R  E I VL N G
Sbjct: 1231 KILFLDECTSALDTSNTHAI----ANLIKKHFCGITTIVITHNEQMMRACERIAVLQN-G 1285

Query: 660  SVVETGKFKELFA 672
             V E G F +L+A
Sbjct: 1286 KVAEDGSFDDLYA 1298

 Score =  134 bits (337), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 113/418 (27%), Positives = 193/418 (46%), Gaps = 32/418 (7%)

Query: 270 LLLLFTPPVLFSASIFGRKIRDTSTDLQE-ATGQLTRVSEEQLSGVRTVQSFVAEQKEIH 328
           L+++   P++   S+   K+ +  T L+   + +  ++          ++ F  +Q EI 
Sbjct: 182 LVIMAGVPIIIVFSVILSKLIERFTRLENMESSRAAQMVSWSFDAAEMIRLFCTQQFEIE 241

Query: 329 RYSHAIRDI------FNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIG 382
           ++  +++         ++   A+Y   +FFT         F+    +G+ ++ QG LT G
Sbjct: 242 KFELSVKKCTKYFIRISLFSSASYAMLRFFTLCM------FIQGFWFGNKMIRQGVLTTG 295

Query: 383 DLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELT---DRVPS-----------I 428
           D+          G+++         + +G  A  ++   T   +  P            +
Sbjct: 296 DVITCFSSCLLLGNTLNNTLQQVITMQKGKVALGKILMFTSEENDFPDHRNEIISDAFIL 355

Query: 429 KPTTGKKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIA 488
                 KF  G GEI FK+V+FSYPTRP   + +++ +  P      +VG SG GKSTI 
Sbjct: 356 NHINANKFRCG-GEISFKNVSFSYPTRPNYHVLKNVSLNFPKNKTTFIVGKSGSGKSTIG 414

Query: 489 LLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPS 548
            LLL+ Y   +G I +DG DI  +    L  +I LV+Q   L + T+++NI  G      
Sbjct: 415 KLLLKSYGGYTGAIEVDGIDIQHIKTSWLAENITLVEQSCTLFNDTIKNNILLGCKGKAY 474

Query: 549 KEE-IRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLD 607
            +  +R   +       I   P+G DTV+G  G  LSGGQKQR+A+ARA ++   IL+LD
Sbjct: 475 GDSLVREACQMALLDRLIFDLPNGLDTVLGSGGVSLSGGQKQRVALARARVRDSPILILD 534

Query: 608 EATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETG 665
           EA S +D+     +     +    K +T V + H L+ I   E+ +    +G + E+G
Sbjct: 535 EAISGMDIIHRDLLVEAIKKW--RKGMTTVIVTHELTQI-SDEDYLYFMEEGQIRESG 589

>Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON}
            YKL209C (REAL)
          Length = 1290

 Score =  179 bits (453), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 141/522 (27%), Positives = 248/522 (47%), Gaps = 32/522 (6%)

Query: 173  ALMVFGIVA-----NYGRIVLLRILSERVVARLRANVIKKTIHQDSEFF--DRHKVGDLI 225
            + +V G+ A     N+ +  LL   SE  +  LR  ++ K   ++  +F  + +K  ++ 
Sbjct: 764  SFIVLGVAAADGFFNFAKGFLLGYCSEYWIMDLRNKIMDKLTRKNINWFSGESNKASEIT 823

Query: 226  SRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSIS-PQLSGLLLLFTPPVLFSASI 284
            + + +D   + RS+  +      + +           +S  +LS + +   P ++  ++I
Sbjct: 824  ALVLNDLRDL-RSLVSEFLSAMTSFVTVSTIGLVWALVSGWKLSLVCISMFPLIVIFSAI 882

Query: 285  FGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRA 344
            +G  ++   TD + +  QL     + ++ ++T++   AE      Y    + +  +  + 
Sbjct: 883  YGGILQKYETDYKTSVAQLENCLYQIMTSIKTIKCLQAEFHFQLSYHDLKKKMEQIAYKR 942

Query: 345  AYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLT---IGDLTAFMLYTEYTGSSVFGL 401
            A       + T+ +      ++  YG  LVL    T   + +    +L+T  + +S+ G 
Sbjct: 943  AIATGFGISVTNMIAMCIQAILYYYGLKLVLVHEYTSKKMFETFTLLLFTIMSCTSLVGQ 1002

Query: 402  TSFYSELMQGVGAATRLFELTDR---VPSIKPTTGKKFVPGKGE---------IVFKDVT 449
                 ++ +G  AA+ ++ + D       I+    +       E         I  ++++
Sbjct: 1003 IP---DISRGQRAASWIYRILDEEEDTLEIENNDARALDISGAEYYGDRNIPIISIRNLS 1059

Query: 450  FSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDI 509
            F+YP+ P   IF+ MD+ +     + +VG SG GKST+ALLL R YN  +  I IDG D+
Sbjct: 1060 FAYPSAPNVPIFKHMDLDMFCEQTIGIVGESGSGKSTLALLLTRLYNCEANSIIIDGTDV 1119

Query: 510  SKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFP 569
            +  N+ SLR+ I +V+Q+P    G++RDN+TYG      + EI  V K    ++F+   P
Sbjct: 1120 NDWNLTSLRKQISVVEQKPSFFDGSIRDNLTYGCLGEMLEVEIYDVLKYVGIYDFVASLP 1179

Query: 570  HGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLM 629
             G DT +     LLSGGQ QR+ IARAL++K  IL+LDE TSALD  S   IN    +  
Sbjct: 1180 QGLDTRVDTN--LLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSRIINDIVRK-- 1235

Query: 630  KSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELF 671
                +  + I H    +R   +I VL + G VVE G F  L+
Sbjct: 1236 GPPGLLTLVITHSEQMMRCCNSIAVLKH-GKVVEEGNFDNLY 1276

 Score =  150 bits (378), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 119/430 (27%), Positives = 205/430 (47%), Gaps = 29/430 (6%)

Query: 264 SPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAE 323
           S  L+ ++L  +P +   A IF R I   +      T    ++    ++  + V+ +  +
Sbjct: 174 SWSLTLIILCSSPVITIFAVIFSRLIHTYTQKENTETSNAAQLFTWSMNAAQLVRLYCTQ 233

Query: 324 QKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVV------LAYGSYLVLQG 377
             E  ++   I     +     +I +  + A ++ G + FL +        +GS ++ +G
Sbjct: 234 PLERQKFQEII-----LSCNTFFIKSCLYVAANA-GILRFLTLTMFVQGFWFGSTMIRKG 287

Query: 378 GLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFV 437
            L I D+          GS++         L +G  A  ++  L +       +  ++ +
Sbjct: 288 KLNINDVITCFHSCIMLGSTLNSTLHQIVVLQKGEVALQKIMALLESGSKQNASNTREHL 347

Query: 438 P-----GKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLL 492
                    ++VF++V+F+YP+RP   + +++++K P+G    +VG SG GKSTI+ LLL
Sbjct: 348 QPPLNFATSDLVFENVSFAYPSRPSETVLQNVNLKFPSGQFTFIVGKSGSGKSTISNLLL 407

Query: 493 RFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEE- 551
            FY+   G I I+G++   +  K L  +I +V+Q   L + TL+ NI  G T +    + 
Sbjct: 408 NFYDNYDGSILINGRNTQSIQQKLLVSNITVVEQRCTLFNDTLKKNILLGSTGSIGNADT 467

Query: 552 --------IRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTI 603
                   I+   +       I+  P G +T+IG  G  LSGGQ+QR+AIARA I+   I
Sbjct: 468 NTIGNNNLIKDACRMALLDRLILDLPDGLETLIGSGGVSLSGGQQQRVAIARAFIRDTPI 527

Query: 604 LVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVE 663
           L LDEA SALD+     +        K K+  I++  H LS I   +++ V+  +G VVE
Sbjct: 528 LFLDEAVSALDIVHRNLLMKAIRHWRKGKTTIILT--HELSQIESDDHLYVM-QEGRVVE 584

Query: 664 TGKFKELFAD 673
           +G   EL AD
Sbjct: 585 SGIQSELLAD 594

>NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1.527
          Length = 1288

 Score =  175 bits (444), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 144/514 (28%), Positives = 253/514 (49%), Gaps = 37/514 (7%)

Query: 180  VANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFF--DRHKVGDLISRLGSDAYVVSR 237
            V+N+ +  +L   SE  +  LR   ++  +++D  +F  D +K  +L + L +D   +  
Sbjct: 773  VSNFLKAYILGYCSENWIMDLRNEAMESILNKDLFWFSKDTNKSSELSALLLNDLRDLRS 832

Query: 238  SMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQ 297
             +++ +S     ++              +LS + L   P ++  ++++G  ++   T  +
Sbjct: 833  LVSEFLSAMTTFMVVSLIGLIWALVSGWKLSLVCLSMFPLIIAFSAVYGTMLQKYETTYK 892

Query: 298  EATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYS---HAIRDIFNVGKRAAYINAQFFTA 354
             +   L     E ++G++T++S  AE   I  YS   H +R I    KR+  I   F  +
Sbjct: 893  TSVAALENQEYEIMTGIKTIRSLQAESHFIKNYSGLEHNMRAI--AHKRS--IATGFGIS 948

Query: 355  TSSLGDISFLVVLAY-GSYLVLQGGLT---IGDLTAFMLYTEYTGSSVFG---------- 400
             +++  I    +L Y G  LV +G  +   + +    +L+T  T +S+            
Sbjct: 949  VTNMITICIQSILYYYGIKLVFEGEYSSKKMFETFTLLLFTIMTCTSLVNQIPDISRGQR 1008

Query: 401  -LTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGKGEIVFKDVTFSYPTRPGNV 459
              T  Y  L +G+ +    FE   +   + P    K  P    I  +++TF+YP+     
Sbjct: 1009 SATFLYRILDEGLASDESEFETHRKAEIVAPKQESKSNP---LIKIQNLTFAYPSETNVN 1065

Query: 460  IFRDMDIKIPAGS-NVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLR 518
            ++ D+++++ A    + +VG SG GKST+  LL + Y  +   I++DG D++   + +LR
Sbjct: 1066 VYEDLNLEMHASEKTIGLVGESGSGKSTLMYLLTKLYQVAPHSIYLDGTDVNDWGLMNLR 1125

Query: 519  RHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGP 578
              I +V+Q+P L  GT+R+N++YG++      E+  + K    + F+   P G DT I  
Sbjct: 1126 TQISVVEQKPTLFDGTVRENLSYGISTDILDMELFDMLKYVGIYEFVESLPFGLDTRIDT 1185

Query: 579  QGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKS--KSVTI 636
            +  LLSGGQ QRI IARAL++KP IL+LDE TSALD  S   I      ++K+   ++  
Sbjct: 1186 K--LLSGGQAQRICIARALLRKPKILILDECTSALDALSANII----IDIVKNGPPALLT 1239

Query: 637  VSIAHRLSTIRRSENIIVLGNDGSVVETGKFKEL 670
            + I H    +R    I VL N G ++E G FKEL
Sbjct: 1240 IVITHSEKMMRACNTIAVLKN-GKIIEKGGFKEL 1272

 Score =  136 bits (343), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 118/419 (28%), Positives = 206/419 (49%), Gaps = 29/419 (6%)

Query: 270 LLLLFTPPVLFSASIFGRKIRDTSTDLQEA-TGQLTRVSEEQLSGVRTVQSFVAEQKEIH 328
           L++L T P++ + ++F   +    T+L+   TG+  +++   +  ++ V+ +  + +E+ 
Sbjct: 180 LIILCTAPIIIAFAVFFSHMIHKYTELENTETGKAAQLANWAMDSIQLVKLYCTQFREVR 239

Query: 329 RY---SHAIRDIFNVGKRAAYINAQFFTATSSLGDIS-FLVVLAYGSYLVLQGGLTIGDL 384
            +   +    D+F   K   Y++A   TA      +S F+    +G+ +V +G L I ++
Sbjct: 240 NFRELTSNCNDLF--IKCCLYVSAN--TALLRFLSLSMFIQGFWFGATMVRKGKLQISNV 295

Query: 385 TAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFE-LTDRV------PSIKPTTGKKFV 437
                     GS++         L +G  A  ++   L+  V      P  +P T  +  
Sbjct: 296 VTCFQSCLMLGSTLSNTLQVIVILQKGDVALKKILGFLSTSVDHGADEPIYEPETPAELC 355

Query: 438 PGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNP 497
                I F ++TFSYP+RP + + +++ +         ++G SG GKST++ LLL+FY+ 
Sbjct: 356 T----IAFNNITFSYPSRPSHPVLKNVSLCFEPTKFTFIIGKSGSGKSTLSNLLLKFYDD 411

Query: 498 SSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLT--ETPSKEEIRMV 555
            +G I + G D+ ++N   L  ++ +V+Q   L + TLR+NI  G++  +    E I   
Sbjct: 412 YNGTITVKGNDVKEINRNWLLNNVTVVEQRCTLFNDTLRNNILLGVSKDQLEDHESIEQK 471

Query: 556 AKQ-C---FCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATS 611
            K  C        +   PHG +T+IG  G  LSGGQ+QR+AIARA ++   IL+LDEA S
Sbjct: 472 LKDACSISMLDRLVCDLPHGLNTIIGSGGISLSGGQQQRVAIARAFMRNKPILILDEAVS 531

Query: 612 ALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKEL 670
           ALD+     +     Q    K  T + + H LS I   +   V+  +G V E G  K+L
Sbjct: 532 ALDIIHRELLMKNIRQWRSGK--TTILLTHELSQIEPDDYTYVI-QEGEVKENGYQKDL 587

>KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1270

 Score =  175 bits (444), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 145/498 (29%), Positives = 242/498 (48%), Gaps = 25/498 (5%)

Query: 189  LRILSERVVARLRANVIKKTIHQDSEFF--DRHKVGDLISRLGSDAYVVSRSMTQKVSDG 246
            L  +SE  +  LR   ++   +++ E+F  D +K  +L + + +D   +   +++ +S  
Sbjct: 769  LGFVSENWIMDLRNKAMESITNKELEWFYKDENKSSELAALVLNDLRDLRSLISEFISAM 828

Query: 247  FKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRV 306
               ++          +   +LS + +   P ++  ++I+G  ++   T  +     L   
Sbjct: 829  STFIVVSLAGLIWALTTGWKLSLVCIAMFPLIILFSAIYGSILQRYETTYKTTVADLENC 888

Query: 307  SEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVV 366
              E + G++T++    EQ  I RYS     + ++G++ A         T++L      ++
Sbjct: 889  VYEIMLGIKTIRCLQLEQHFIQRYSVLEARMKHIGRKRAIATGFGIAITTALVMCIEAIL 948

Query: 367  LAYGSYLVLQGGLTIGDLT---AFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFEL-- 421
              YG  LV  G  T   +      +L+T  T +S   L +   ++ +G  AA+R+F +  
Sbjct: 949  FYYGLKLVFIGEYTTMKMFKTFTLLLFTIMTCTS---LINQIPDVTRGQRAASRIFRILD 1005

Query: 422  -TDRVPSIKPTTGK-KFVPG----KGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVC 475
             +DR        G+ + +P     K  I   ++ F YP+   + +F  ++++I     V 
Sbjct: 1006 ESDRFLEDSDEHGRTRGIPKNNSIKSIITINNLQFHYPSAESSNVFNRLNLQIADNQTVA 1065

Query: 476  VVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTL 535
            VV  SG GKST+  LL R Y      IFIDG DI++  + SLR  I +V+Q+P L  G++
Sbjct: 1066 VVAESGSGKSTLLYLLTRLYKVDFNSIFIDGTDINEWQLTSLRNLIAIVEQKPTLFEGSI 1125

Query: 536  RDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIAR 595
            R N+ YG        +I  V KQ    +F+   P+G DT +    +LLSGGQ QRI IAR
Sbjct: 1126 RKNLIYGNKLEIMDMDIYDVLKQVGIFDFVTSLPNGIDTNVDT--SLLSGGQAQRICIAR 1183

Query: 596  ALIKKPTILVLDEATSALDVESEGAINYTFGQLMKS--KSVTIVSIAHRLSTIRRSENII 653
            AL++K  IL+LDE TSALD ES     +    L+KS    V  ++I H    +R   N+I
Sbjct: 1184 ALLRKSKILILDECTSALDAESA----FVIQNLVKSGLPGVLTIAITHSEPMMRACGNVI 1239

Query: 654  VLGNDGSVVETGKFKELF 671
            VL  DG   + G F EL+
Sbjct: 1240 VL-QDGETAQQGTFDELY 1256

 Score =  131 bits (330), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 122/509 (23%), Positives = 233/509 (45%), Gaps = 62/509 (12%)

Query: 199 RLRANVIKKTIHQDSEFFDRHK--VGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXX 256
           R+R  ++   + +  E+FD +   +GD +        V S S  +  +  F+  +     
Sbjct: 103 RIRRTILLSYLKKPMEWFDENDQLLGDFVQMHRCVEEVRSGS-AEASAITFQNFVAIIAL 161

Query: 257 XXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRT 316
                  S  L+ ++L  +P ++  A+ F R I + +    + TG   +     ++  + 
Sbjct: 162 VCTSFYYSWSLTLIILCSSPLLIVLAAFFSRMIENFTKLENDETGIAAQSLTWSMNAAQL 221

Query: 317 VQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSS-----LGDISFLVVLAYGS 371
           V+ +  +  EI ++   +     +     +INA F+ + ++     L    F+    +GS
Sbjct: 222 VKLYCTQDFEIKKFKEIV-----IRCNDYFINAWFYVSANTSILRFLSLAMFVQGFWFGS 276

Query: 372 YLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPT 431
            ++ +  +++  +                +T F S LM G    T L ++   V   K  
Sbjct: 277 TMIKKNKMSVDQV----------------ITCFSSCLMLGSILNTTLPQI---VLLQKAH 317

Query: 432 TG----KKFVPGKGE-------------------IVFKDVTFSYPTRPGNVIFRDMDIKI 468
            G    + F+  K E                   I F  ++F YP+RP +++ +++ +  
Sbjct: 318 VGLNRVQDFLEDKSEMATDRDRQTSINLDNVPISISFDAISFCYPSRPDDMVLKNISMNF 377

Query: 469 PAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEP 528
                  +VG SG GKST++ LLL+FYN  +G I ++G ++  ++   + +++ LV+Q+ 
Sbjct: 378 DPNKTTFIVGKSGSGKSTMSNLLLKFYNGYNGCIKVNGVNVQSIDRHWITKNVTLVEQKC 437

Query: 529 VLMSGTLRDNITYGLTETPSKEEI----RMVAKQCFCHNFIVKFPHGYDTVIGPQGALLS 584
            L + TLR+N+  GL+   + E++    +   +     N I K P G DT +G  G  LS
Sbjct: 438 TLFNDTLRNNLLIGLSHISAAEDVDSRLQEACRFALLDNVIEKLPSGLDTKVGSGGVSLS 497

Query: 585 GGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLS 644
           GGQ+QR+A+ARA ++   +++LDEA SALD  +   +        +SK+  I++  H L+
Sbjct: 498 GGQQQRVALARAYLRDTPVVILDEAISALDARNRRQLMENIRIWTRSKTAIILT--HELN 555

Query: 645 TIRRSENIIVLGNDGSVVETGKFKELFAD 673
            I  S+ + ++ N G + E G   EL  +
Sbjct: 556 QILPSDFLYLMEN-GQIKEEGYQNELIEN 583

>TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1253

 Score =  172 bits (435), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 127/503 (25%), Positives = 240/503 (47%), Gaps = 17/503 (3%)

Query: 182  NYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFDR--HKVGDLISRLGSDAYVVSRSM 239
            N+ +I +L   SE  +  LR  +++    +  E++ R  +K  ++ +   +D   +   +
Sbjct: 739  NFIKIFILGYCSEYWIMDLRNELMQCVSQKRFEWYGRSSNKSSEISALALNDLRDLRTLV 798

Query: 240  TQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEA 299
            T+ +S     +           +   +LS + +   P ++  + I+G  +++  T  + A
Sbjct: 799  TEFLSTMSTFVTVSMMGLIWAIATGWKLSLVCISMFPLIIIFSMIYGTVLQNYETSYKSA 858

Query: 300  TGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLG 359
               L  +  E ++ ++T++        +  YS   + +  + K+   +     +  +++ 
Sbjct: 859  VADLENLQYEMITSIKTIKCLRLNDHFLGLYSELEKKMKRIAKKRTIVTGLGLSMLTTIT 918

Query: 360  DISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLF 419
                 ++  YG  LVL G  T   +        +T ++   L S   ++ +G  AA+ + 
Sbjct: 919  TCIQSILYYYGLKLVLTGEYTSKTMFQTFTLVLFTVTTCNSLVSQIPDVSRGQRAASWVL 978

Query: 420  ELTDRVPSIKPTTGKKFVPGKGE--------IVFKDVTFSYPTRPGNVIFRDMDIKIPAG 471
             + D     K   G+       E        I  +++ F YP  PG  +++D+++KI +G
Sbjct: 979  RIIDENEYTKEVNGEDCRVETIEHENDSDPLIEIENLNFHYPNTPGVNVYQDLNLKINSG 1038

Query: 472  SNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLM 531
              + +VG SG GKST+  LL + Y+    +I I+G DI+  +   LR  I +V+Q+P L 
Sbjct: 1039 ETIGLVGQSGSGKSTLMYLLTKLYDVQDNRILINGTDINDWSYDILRAEICVVEQKPNLF 1098

Query: 532  SGTLRDNITYGLTETP--SKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQ 589
             GT+R+NITYG++E    S+ E++ + +    H F+   P   DTV+     LLSGGQ Q
Sbjct: 1099 HGTIRENITYGVSEKNPVSETEVQELLQLVDMHEFVEALPKALDTVVDI--GLLSGGQAQ 1156

Query: 590  RIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVS--IAHRLSTIR 647
            R+ I R L++KP +L+LDE TS+LD ++   +      L       I++  I H    ++
Sbjct: 1157 RLCIVRTLLRKPKVLILDECTSSLDAQTTQIVIALIKDLNTKLGWDILTIVITHNRQMMQ 1216

Query: 648  RSENIIVLGNDGSVVETGKFKEL 670
                ++VL + G VVE G+F +L
Sbjct: 1217 CCSRLVVL-DVGRVVEDGQFDDL 1238

 Score =  164 bits (416), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 140/527 (26%), Positives = 247/527 (46%), Gaps = 49/527 (9%)

Query: 173 ALMVFGIVANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDA 232
           AL   GI + +  I     L ER   R+R+ ++++ + +  E++D      L   L  D 
Sbjct: 74  ALGAAGIPSMWMSISSWMALGERQGFRVRSKLLEEYLEKPMEWYD------LKENLAGDF 127

Query: 233 YVVSRSM-------------TQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVL 279
             ++R M             T +      ALIC           S QL+ ++L  +P ++
Sbjct: 128 TQLNRCMEELRSGSAEASAVTYQNCVAIIALICVSFYY------SWQLTLIILCTSPFII 181

Query: 280 FSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFN 339
             A+ F R I+  ++   + T     +    +   +TV+    + KEI ++   +     
Sbjct: 182 VCAACFSRFIQKYASFENKETAAAADLLMWTMDSSQTVKLSCTQSKEIKKFETLVSKC-- 239

Query: 340 VGKRAAYINAQFFTATSSLGDISFLVV------LAYGSYLVLQGGLTIGD-LTAFMLYTE 392
                 +I    FTA +++G + FL +        +GS ++ +G L I D +T F  Y+ 
Sbjct: 240 ---NDYFIRTSLFTA-ANIGILRFLTLSMFVQGFWFGSTMIRKGKLNISDVITCF--YSC 293

Query: 393 YTGSSVFGLTSFYSELMQ-GVGAATRLFELTDRVPSI--KPTTGKKFVPGKGEIVFKDVT 449
               S+   T  +   +Q G  A  ++ +  +  P +  K  T    V    +I   ++T
Sbjct: 294 LMLGSILNTTLHHVIFIQKGQVALAKIQKFINESPELPSKTLTSSGLVYSHVDISIDNLT 353

Query: 450 FSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDI 509
           F+YP+RP   + +++ +KI +     +VG SG GKSTI  L+++FY    G I +  +DI
Sbjct: 354 FAYPSRPTENVLKNVSLKIKSARTTFIVGKSGSGKSTITNLIMKFYEDYKGNIIVGDKDI 413

Query: 510 SKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQC--FCHNFIV- 566
             + I  L ++I LV+Q   L + TL++NI  G   T       +++  C   C + ++ 
Sbjct: 414 RSVPIDELLQNITLVEQRCTLFNDTLKNNILLGSKYTSQTINDGLLSSICSLACLDSVIS 473

Query: 567 KFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFG 626
             P G +T +G  G  LSGGQ+QR+A+ARA ++   IL+LDEA SALD+     +     
Sbjct: 474 SLPDGIETRLGTDGITLSGGQQQRVALARAFLRDTDILILDEAVSALDIMQREILMRNIS 533

Query: 627 QLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFAD 673
           ++ ++K+  I++  H L+ I  ++ I +  N+  + E G  K L  D
Sbjct: 534 KVRQNKTTIILT--HDLNQINDNDYIYLFENN-EIKENGFKKTLMND 577

>ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1273

 Score =  171 bits (433), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 146/523 (27%), Positives = 254/523 (48%), Gaps = 39/523 (7%)

Query: 173  ALMVFGIVANYGRIVLLR--IL---SERVVARLRANVIKKTIHQDSEFF--DRHKVGDLI 225
            A +V GI A    + LL+  IL   SE  +  LR + ++K  +   E+   D +K  +L 
Sbjct: 751  AFIVMGIAAADSGLTLLKEFILGYHSEIYIRTLRDDAMRKITYNRIEWLTQDNNKPSELS 810

Query: 226  SRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIF 285
            + L +D   +  S +  +S     +I              +LS + +   P ++  + I+
Sbjct: 811  ALLMNDLRDLRTSTSNFISFVSSFVIVSSVGLIWAIVTGWKLSLVCISMFPLLVIFSMIY 870

Query: 286  GRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAA 345
            G  ++   T+ +    +L  V  E ++G++T++     Q E H      +  FNV K+ A
Sbjct: 871  GILLKKYETEYKNTIAKLENVQYEVVTGMKTIRCL---QIEDH-----FKAKFNVLKQTA 922

Query: 346  YINAQ-------FFTATSSLGDISFLVVLAYGSY-LVLQGGLTIGDLTAFMLYTEYTGSS 397
             +  Q       F  A S+   +S   +L Y +  LV+ G  T   +        +T  +
Sbjct: 923  KLMGQRRAIVTGFGVAVSNGLTMSIQGILYYYAIKLVIHGEYTTKKMFETFTLLLFTIMT 982

Query: 398  VFGLTSFYSELMQGVGAATRLFELTDRVPSIK--PTTGKKFVP----GKGEIV-FKDVTF 450
               L +   ++ +G  AA++++ + + +   +   T G + VP      G I+ F D++F
Sbjct: 983  CNNLVNQIPDIRRGQRAASKIYRILEGIDESECFETEGHRIVPIVENPTGPIIRFNDLSF 1042

Query: 451  SYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDIS 510
            +YPT P   I + + ++I +G  + +VG SG GKST+  ++ R Y   S  +F+D  D++
Sbjct: 1043 AYPTAPTVKILKHLSMEIYSGDRIAIVGESGCGKSTLVNIITRLYECPSNSLFVDNTDVN 1102

Query: 511  KLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPH 570
               +  LR  I +V+Q+P L  GT+R+N+ YG     +  ++  + K    ++F    P 
Sbjct: 1103 DWALPKLREQIAVVEQKPTLFKGTIRENLVYGSPLGTADVDVFNMLKYVGIYDFFATLPE 1162

Query: 571  GYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMK 630
            G +T I     LLSGGQ QR+ IARAL+++P IL+LDE TSALD  S   IN    ++++
Sbjct: 1163 GLETKI--DSGLLSGGQNQRLCIARALLQRPKILILDECTSALDTMSSHIIN----EIIR 1216

Query: 631  SKSVTI--VSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELF 671
                T+  +SI H    +R    + VL + G +VE G  ++L 
Sbjct: 1217 EGPPTMLTISITHDEQMVRACNKVAVL-DQGHIVEMGNREDLL 1258

 Score =  168 bits (426), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 140/499 (28%), Positives = 232/499 (46%), Gaps = 26/499 (5%)

Query: 191 ILSERVVARLRANVIKKTIHQDSEFFDRHKV--GDLISRLGSDAYVVSRSMTQKVSDGFK 248
           +L ER   R+R  +I   + +  +++D +    GDL ++       +  S  +  +  +K
Sbjct: 88  LLGERQNFRVRTQLIDSYLQKPMKWYDDNDTLTGDL-TQTNRCVEELRSSSAEASALTWK 146

Query: 249 ALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSE 308
            L+            S  L+ + +   P ++  A  F R I   S      T   +++  
Sbjct: 147 NLVTILALTVTSFYYSWSLTLVTMCGAPVIVLCAIFFSRLIHIYSEKENSHTAISSQLLS 206

Query: 309 EQLSGVRTVQSFVAEQKEIHRYSHAIRDIF-NVGKRAAYINA-----QFFTATSSLGDIS 362
             +   + V+    +  E+  +  A++    N  K   Y +A     +F T T       
Sbjct: 207 WSMEAAQLVRLSCMQLVEVQNFQLAVKKCSKNFMKMCLYASANTAILKFLTLTI------ 260

Query: 363 FLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELT 422
           F+    +GS ++ +  L I D+          G+++ G       L +G      + E  
Sbjct: 261 FVQAFWFGSTMIRKHKLRIEDVITCFQSCVLLGATINGTLHQIVILQKGKVGVINVNEFL 320

Query: 423 DRVPSIKP--TTGKKFVPGKG---EIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVV 477
            +   +K      ++F    G   +I  ++V F+YP+RP     +++ + +P G    VV
Sbjct: 321 KKDEYLKEDFKNNRRFYLDGGISEKIELRNVQFNYPSRPTVPALKNVSLTLPVGKITYVV 380

Query: 478 GPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRD 537
           G SG GKS++  LLL+ Y+  +G I IDG DI  ++ KS+ ++I LV+Q   L + TLR+
Sbjct: 381 GKSGSGKSSLGNLLLKLYDDYNGSISIDGIDIKGIDQKSILKNITLVEQRCTLFNDTLRN 440

Query: 538 NITYGLTETPS---KEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIA 594
           NI +G  ET      E ++   +     NFI   P G DT+IG  G   SGGQ+QRIAIA
Sbjct: 441 NILFGSKETDELVRDESLKAACRISLLDNFIYDLPEGLDTLIGTGGITPSGGQQQRIAIA 500

Query: 595 RALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIV 654
           RA ++   ILVLDEA SALD+   G +        +S+  TI+ + H LS I   +++I 
Sbjct: 501 RAYMRDTPILVLDEAVSALDIIHRGLLMNAIRN-WRSEKTTII-LTHDLSEI-GPDDMIY 557

Query: 655 LGNDGSVVETGKFKELFAD 673
           L  DG VVE G+ + L  +
Sbjct: 558 LLEDGEVVEQGQQRNLLLN 576

>Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} similar to
            Ashbya gossypii AFR432W
          Length = 1315

 Score =  169 bits (427), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 148/540 (27%), Positives = 250/540 (46%), Gaps = 51/540 (9%)

Query: 156  PPIFMGYSIYEFL-----GGFAALMVFGIVANYGRIVLLRILSERVVARLRANVIKKTIH 210
            PP  M +S+         G F  L  F          +L + SE  +  LR   + +  +
Sbjct: 786  PPYLMKWSLVVICVSVTDGCFTFLKKF----------ILSVCSELWIMSLRIKAMDRISN 835

Query: 211  QDSEFF--DRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLS 268
            QD  +F  D +K  ++ + + +D   + R +          LI           +S    
Sbjct: 836  QDVHWFSLDINKPSEISALILNDLRDL-RYLVSGFLSAVTTLIFVSAIGLAWAFVSGWKL 894

Query: 269  GLLLLFTPPVLFSAS-IFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEI 327
             L+ + T P+    + I+G  ++   TD + A  +L     E + G++TV+    E    
Sbjct: 895  SLVCISTIPLFIGVTGIYGGVLQKYETDYKTAVAELENNMFEFVKGIKTVRCLQLESHFS 954

Query: 328  HRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAY-GSYLVLQGGLTIGDLT- 385
            ++Y+     + +  +R A +   F  A S+   I    +L Y G  LV+ G  T  +L  
Sbjct: 955  NKYTMLEEGMKHQSRRRAVVTG-FGVALSNALVIGVQAILYYYGIKLVVDGEYTPDNLLQ 1013

Query: 386  --AFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDR-------------VPSIKP 430
                +++T  T S++      +S   +G  AAT +F + +               P  KP
Sbjct: 1014 TFTLLVFTIMTCSALMYEVPSFS---RGRRAATYVFRILNTRSDFLSIDDDFRTEPIEKP 1070

Query: 431  TTGKKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALL 490
            +           I  +D+TF+YP+     +++ + + I  G N+ +VG SG GKST+ L+
Sbjct: 1071 SHMNPL------IRIQDLTFAYPSALDVEVYKKLSLTINFGENLAIVGESGSGKSTMGLI 1124

Query: 491  LLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKE 550
            L   Y  +   +FID  DI K N+ SLR+HI +V+Q+     G++RDN+ YGL    +  
Sbjct: 1125 LCGLYPVNGNTVFIDDTDICKWNLSSLRKHISMVEQKAKFFDGSIRDNLIYGLDRIVTDS 1184

Query: 551  EIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEAT 610
            +I  V       +F+ + P G +T I     L+SGGQ QRI+I RAL+++P +L+LDE T
Sbjct: 1185 QIFEVLSLVGIADFVKELPQGLNTRIDTN--LISGGQAQRISIGRALLRQPKLLILDECT 1242

Query: 611  SALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKEL 670
            S+LD ++  AI    G  +    +T + I H  + + +S N I+   +G + E G F+EL
Sbjct: 1243 SSLDAKNAQAIASLVGSSL--YGITTIVITHN-TQMMKSCNRILFFKNGRISEEGTFQEL 1299

 Score =  119 bits (299), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 106/423 (25%), Positives = 193/423 (45%), Gaps = 27/423 (6%)

Query: 270 LLLLFTPPVLFSASIFGRKIRDTSTDLQEA-TGQLTRVSEEQLSGVRTVQSFVAEQKEIH 328
           L++L + P++ + +I   K+ +  T+L+   T     +    +   + ++ F  EQ E+ 
Sbjct: 180 LVILASTPLIIALAIIFSKLVEKYTELENTETSHAASILTWSMEAPQLIRLFGTEQVELQ 239

Query: 329 RYSHAIRD----IFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDL 384
           ++S +++       N+ K AA   A        L  I F+    +G+ ++ +G L  G +
Sbjct: 240 KFSISVKKCSKFFINLSKYAAANQASL----RGLSLIMFVQGFWFGNTMIKRGKLNSGQV 295

Query: 385 TAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTD-RVPSIKPTTGKKF----VPG 439
                     G+++         + +G  A  ++  + +    +++   G+ F     P 
Sbjct: 296 ITCFSACILLGTTLNNTLQHIVIMQKGKVALQKILSMVESESDALRGRRGETFEIFPSPI 355

Query: 440 KG---------EIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALL 490
            G         +I F++V+FSYP+RP      ++ +         +VG SG GKST++ L
Sbjct: 356 SGMFVSPVFPKQITFENVSFSYPSRPNEYALDNVSLTFYPEKITFIVGKSGSGKSTLSNL 415

Query: 491 LLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKE 550
           LL+ Y+   G I +   DI       L  +I LV+Q   L + +L +N+     +    E
Sbjct: 416 LLKLYSDYEGTIKVGTLDIRATKDSWLLENITLVEQSCTLFNDSLLNNLLLTAKDDNKNE 475

Query: 551 -EIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEA 609
             I+   +       +   P G  TVIG  G  LSGGQ+QR+A+ARA+++   +L+LDE+
Sbjct: 476 ASIKRACQMALLEKLLFDLPDGLSTVIGSNGISLSGGQQQRVALARAILRDTPVLILDES 535

Query: 610 TSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKE 669
            SALD+     +          K+  I++  H LS I   ++ + L  DG V E G  ++
Sbjct: 536 ISALDIIHRDLLMEVIRNWRAGKTTIILT--HELSHI-LDDDYLYLMEDGKVGEHGYKRD 592

Query: 670 LFA 672
           L +
Sbjct: 593 LLS 595

>KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209C STE6 ATP-binding cassette (ABC) transporter
            required for the export of a-factor catalyzes ATP
            hydrolysis coupled to a-factor transport contains 12
            transmembrane domains and two ATP binding domains
            expressed only in MATa cells
          Length = 1298

 Score =  166 bits (421), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 126/419 (30%), Positives = 209/419 (49%), Gaps = 22/419 (5%)

Query: 266  QLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQL-SGVR---TVQSFV 321
            +LS + +   P  +     +G  ++    + + A   +    E+QL S VR   T++   
Sbjct: 876  KLSLVCISLIPAFILFTGAYGGLLQKCEANYKSAVASM----EDQLYSAVRRIKTIRCLQ 931

Query: 322  AEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATS-SLGDISFLVVLAYGSYLVLQGGLT 380
             E++ I  Y   +     +  R   +   F  A S +L  I+  ++L YG  LV+ G  +
Sbjct: 932  VEERVIKEY-EVLEGKAKLAGRKRALGTGFGVALSNALTLITQSILLYYGMKLVITGEYS 990

Query: 381  IGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTT--GKKFVP 438
               +   +    +T  +   L +   E+ +G  AAT LF + D           G+  + 
Sbjct: 991  SERMFQTLTLLLFTIMTCMSLIAQIPEISRGQRAATYLFRILDSETQFADANLEGESALT 1050

Query: 439  GKGE-----IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLR 493
             +G      I  KD+ FSY      +++R +++ + AG  V +VG SG GKST+  L+ R
Sbjct: 1051 SRGCSNEALIFIKDLRFSYSFLNNPMVYRGLNLSVKAGETVALVGLSGSGKSTLWHLITR 1110

Query: 494  FYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIR 553
             Y   SG I+ DG D+++    +LR+ I +V+Q P L  G++ DN+TYGL+ +  + EIR
Sbjct: 1111 LYRVPSGSIWFDGLDVNEWEEWALRKRIAVVEQRPSLFRGSIFDNLTYGLSTSVDEREIR 1170

Query: 554  MVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSAL 613
             + +     +F+   P G  + I     +LSGGQ QR+AI RAL++KP +LVLDE TSAL
Sbjct: 1171 ELLELVGMMDFVNSNPLGLQSFIDTD--VLSGGQLQRLAIVRALLRKPQLLVLDECTSAL 1228

Query: 614  DVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFA 672
            D +  G I   F +   S+S T + + H    +R    I+   N G+++E G F+ L++
Sbjct: 1229 DAQ-HGFIMSEFVR-QGSQSTTTLVLTHSEQMMRACNRILTFAN-GNIIEDGSFERLYS 1284

 Score =  156 bits (394), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 146/595 (24%), Positives = 261/595 (43%), Gaps = 47/595 (7%)

Query: 102 KPDWKLLVIAITLLTVSCGIGMTIPKVI-GMILDVLKTGLETNEGKDGPISMADVPPIFM 160
           K DW LLV+ IT+ +V+ G+   +  ++ G + ++L+       G    +          
Sbjct: 19  KQDWSLLVV-ITVCSVAYGLVPAVTSILTGTVFNLLQQPAAREFGSVNAL---------- 67

Query: 161 GYSIYEFLGGFAALMVFGIVA---NYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFD 217
              ++E      A++  GI +    +  +     L ER   RLR  +++  + +   ++D
Sbjct: 68  ---MHELALRSMAILATGIASIPLCWLSVSAWMSLGERQAFRLRRKMLQSYLDKSMAWYD 124

Query: 218 RHK--VGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFT 275
            ++   GD  ++L      +  S  +  +  F+ ++            S  L+ +++  +
Sbjct: 125 ANEQISGDF-TQLNRCVEELRSSSAESSAIVFQNVVTVAALLGSALYYSWSLTLIIMANS 183

Query: 276 PPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIR 335
           P V+  A  F RK+   +      T          L   + V+    + +E+ R+   ++
Sbjct: 184 PLVIGFAVFFSRKVEKYAKRENSETSSAADAMAWSLDAAKMVRLLGTQDRELARFEACVQ 243

Query: 336 DIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDL-TAFMLYTEYT 394
                  + +  ++  ++    L    F+    YG+  +  G L  GD+ T F       
Sbjct: 244 KCRQHFNKMSLFSSLNYSVLRFLTLCMFVQGFWYGNSRINIGKLKPGDVVTCF------- 296

Query: 395 GSSVFGLTSFYSELMQGV---GAATRLFELTDRVPSIKPTTGKK-----------FVPGK 440
            S V   ++  S L Q +     A  L ++   V S   +  +K               +
Sbjct: 297 SSCVLLASTLNSTLHQIIILQKGAVGLQKIMAFVNSRDASESQKNKVEISFRRLPLCWER 356

Query: 441 GEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSG 500
             I F++V F+YPTRP + + + + +  P+G    V+G SG GKSTI  LLL FY   SG
Sbjct: 357 ASITFQNVHFAYPTRPDDFVLKGVSLDFPSGETTFVIGKSGSGKSTIGNLLLGFYGIGSG 416

Query: 501 QIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKE-EIRMVAKQC 559
            I ++GQD+ ++N   L R+I LV+Q   L + TL +N+T G       E  ++   +  
Sbjct: 417 TINVNGQDVKEINQSELARNIMLVEQTTSLFTETLANNVTIGEAGVDDDEIRLKQACQMA 476

Query: 560 FCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEG 619
              N I     G +T IG  G  LSGG++QR+A+ARA  +   IL+LDEA SA D   + 
Sbjct: 477 MLGNIIRDLAKGLETTIGCSGLDLSGGEQQRVALARAYFRNAPILILDEALSAQDRIHKS 536

Query: 620 AINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADP 674
            +     +    K+  I++  H LS I  ++ + V+ +DG + E G    L ++P
Sbjct: 537 LLMEAIRKWRADKTTIILT--HELSDILDTDYVYVM-SDGQIREHGYKSGLLSNP 588

>TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_4.52
            YLL015W
          Length = 1535

 Score =  164 bits (416), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 150/542 (27%), Positives = 246/542 (45%), Gaps = 63/542 (11%)

Query: 164  IYEFLGGFAALMVFGIVANYGR-IVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVG 222
            +++F+G +AA+ VF    N  R IVLL   + R  A+L   + K  +     FF+   VG
Sbjct: 993  VWKFVGIYAAIGVFSAAFNNLRTIVLLLFCTIRGAAQLHDTMAKTVLRSPMSFFETTPVG 1052

Query: 223  DLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQL----SGLLLLFTPPV 278
             +I+R  SD   V  ++    +  F++++             P      + LL+++    
Sbjct: 1053 RIINRFSSDVQAVDSTLQWVFAFFFRSILNYAVTVILISYNMPWFLIVNAVLLIIYIYYQ 1112

Query: 279  LFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIF 338
             F  ++     R TS     +T  +  +  E L G   + +F    K   R+     D  
Sbjct: 1113 AFYITLSRELKRLTSV----STSPIMSLFSETLGGHAVINAF----KHFDRF-----DFI 1159

Query: 339  NVGKRAAYINAQF-FTATSSLGDISFLVVLAYGSYLVLQGGL----TI--------GDLT 385
            N       IN  F F +T+    +    +   G+++VL   L    TI        G + 
Sbjct: 1160 NFNNVQFNINCSFNFRSTNRWLSVRLQTI---GAFIVLATALLALSTINSERRLSPGMVG 1216

Query: 386  AFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPS----IKPTTGKKFVPGKG 441
              M Y     SS+  +     ++   + +  R++E  +  P     I+    KK  P +G
Sbjct: 1217 LLMSYALQVTSSLMWIVRMSVQIETNIVSVERIYEYCNLTPEAPEVIESCRPKKTWPSEG 1276

Query: 442  EIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQ 501
            EI+FK+ +  Y T+ G++  + +++ I     + VVG +G GKST++L L R    + G 
Sbjct: 1277 EIIFKNYSTKYKTK-GDLALKGINLSIKPQEKIGVVGRTGAGKSTLSLALFRLLEATEGT 1335

Query: 502  IFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFC 561
            I IDG DISK+ +K LR H+G++ Q+     GT+R N+     E  S EE+    +    
Sbjct: 1336 IEIDGLDISKMGLKDLRSHLGIIPQDAQAFEGTVRSNL--DPFEQYSTEELWASIELSHL 1393

Query: 562  HNFIVKF-------------PHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDE 608
               IV+                  D  I   G  LS GQ+Q + ++RAL+    +LVLDE
Sbjct: 1394 KPHIVEMFRKEDNSELPASKEKMLDVKISENGGNLSVGQRQLLCLSRALLNTSKVLVLDE 1453

Query: 609  ATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFK 668
            AT+A+D+E++  I  T    +K K  TI++IAHR+ T+  S+ IIVL       + G+ K
Sbjct: 1454 ATAAVDMETDKIIQETIRSELKEK--TILTIAHRIDTVLDSDKIIVL-------DAGQVK 1504

Query: 669  EL 670
            E 
Sbjct: 1505 EF 1506

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 67/210 (31%), Positives = 110/210 (52%), Gaps = 18/210 (8%)

Query: 471 GSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRH--IGLVQQEP 528
           G   C+VG  G GKST+   +L       GQ+      +  L  K L R   +    QEP
Sbjct: 649 GELTCIVGRVGSGKSTMLRAIL-------GQLPCVNASVGGLEPKVLIRASTVAYCPQEP 701

Query: 529 VLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQK 588
            +M+ +++DNIT+G     +     + A Q      I+  P   +T++G +G  LSGGQK
Sbjct: 702 WIMNASIKDNITFGFRYDETYYNATIKACQLLPDLDIL--PERDNTLVGEKGISLSGGQK 759

Query: 589 QRIAIARALIKKPTILVLDEATSALDVE-SEGAINYTFGQ---LMKSKSVTIVSIAHRLS 644
            RI++ARA+  +  + +LD+  SA+D E S+  +     +   L+++K+V + + A  +S
Sbjct: 760 ARISLARAVYSRADLFLLDDILSAVDAEVSKNIVEMVLDKKMGLLRNKTVVLTTNA--IS 817

Query: 645 TIRRSENIIVLGNDGSVVETGKFKELFADP 674
            + RS+ I +L   GS+VE G F E+ + P
Sbjct: 818 VLNRSQKIYML-EGGSIVEEGSFTEVTSSP 846

>KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON}
           similar to uniprot|P12866 Saccharomyces cerevisiae
           YKL209C STE6 ATP-binding cassette (ABC) transporter
           required for the export of a-factor catalyzes ATP
           hydrolysis coupled to a-factor transport contains 12
           transmembrane domains and two ATP binding domains
           expressed only in MATa cells
          Length = 1271

 Score =  163 bits (412), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 86/234 (36%), Positives = 143/234 (61%), Gaps = 4/234 (1%)

Query: 441 GEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSG 500
           G+I F+DV+F+YPTRP + + +++ IKI +G+   +VG SG GKST+A LLL+ Y   +G
Sbjct: 355 GDIEFRDVSFAYPTRPDDYVLKNVSIKIKSGATCFIVGKSGSGKSTLASLLLKMYGEYTG 414

Query: 501 QIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCF 560
           +I     +I  L+   L  +I LV+Q   L +GTL+DN+T  + +  S  E++   +   
Sbjct: 415 EIKFGEYEIDSLDDSWLVENITLVEQRCTLFNGTLKDNLTI-VNKYASCTEVKQACQFAL 473

Query: 561 CHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGA 620
            +  ++  P+G DT++G  G  LSGGQ+QR+A+ARA ++   +L+LDE+ SALD+ S   
Sbjct: 474 LNTVLLNLPNGIDTLLGRHGVTLSGGQQQRVALARAYLRNTPVLILDESLSALDIMSREL 533

Query: 621 INYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADP 674
           I        K K+  I++  H  + I+  E + ++ ++G+VVE+G   +L  +P
Sbjct: 534 IVEAIRHWRKGKTTIILT--HEYTQIKDDEYVYLM-SEGTVVESGFKYDLLENP 584

 Score =  160 bits (404), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 140/524 (26%), Positives = 252/524 (48%), Gaps = 59/524 (11%)

Query: 180  VANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFD--------------------RH 219
            ++ + +  +L   SE  + RLR + + K   +  ++F                     R 
Sbjct: 760  ISTFLKDFILGYCSEVWIERLRVDAMAKISSKSLDWFKLPTNNSSELNSLMMNDLRDLRG 819

Query: 220  KVGDLISRLGSDAYVVSRSMTQKVSDGFK-ALICXXXXXXXXXSISPQLSGLLLLFTPPV 278
               + +S + +  +V S  +   +  G+K +L+C                    LF   +
Sbjct: 820  LASEFLSAITTLVFVASIGLIWALVSGWKLSLVCIS------------------LFPAFI 861

Query: 279  LFSASIFGRKIRDTSTDLQEATGQL-TRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDI 337
            LFS  I+G  ++   T  +    +L TRV E  +S ++T++    +Q     +   +  +
Sbjct: 862  LFSG-IYGSLLQVYETAYKTEIAELETRVHELVIS-MKTIKLLQLQQHFEGSFKTQLAKV 919

Query: 338  FNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSS 397
              V K+ +         T++L  +   ++  +G  LV+QG  ++  +        ++  +
Sbjct: 920  RIVCKKRSVAVGFGIAVTNALAMVVQAILFFFGIKLVIQGEYSVAQMFETFTLLLFSIMT 979

Query: 398  VFGLTSFYSELMQGVGAATRLFELTDRVPSIK-----PTTGKKFVPGKGE---IVFKDVT 449
               L +   E+ +G  AAT +F++ +   S+      P+  + F    G    I   +++
Sbjct: 980  CVSLINQVPEISRGQRAATYIFKVLEDSGSVDTSKPDPSQNQSFFSTAGNRETIKISNLS 1039

Query: 450  FSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDI 509
            F++ + P N IF  +  +I     V +VG SG GKST++LLL R Y   SG+++I G DI
Sbjct: 1040 FAFSSAPMNKIFNSLSCEICLNETVGIVGESGSGKSTLSLLLTRLYPVPSGKVYIGGIDI 1099

Query: 510  SKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFP 569
            +K +  +LRR I +V+Q+P    GT+R+N+ YGL    S  E+R V K     +F+   P
Sbjct: 1100 NKWDEYALRRTISIVEQKPKFFDGTVRENLVYGLKRNVSNSELRSVLKSVDLLSFVQTLP 1159

Query: 570  HGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLM 629
            +  +T +     L+SGGQ QR++IAR L+++P I++LDE TSALD  +  AI     +L+
Sbjct: 1160 NDLNTRV--HDGLMSGGQAQRLSIARTLLRQPKIIILDECTSALDAANSFAI----AELI 1213

Query: 630  KS--KSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELF 671
            ++  K+VT++ I H    ++  + ++VL   G V E G + ELF
Sbjct: 1214 RTVLKNVTVIVITHSEQLMQICDRVLVL-KKGKVKEEGSYAELF 1256

>CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {ON}
           similar to uniprot|P12866 Saccharomyces cerevisiae
           YKL209c STE6
          Length = 1227

 Score =  162 bits (409), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 145/522 (27%), Positives = 225/522 (43%), Gaps = 48/522 (9%)

Query: 177 FGIVANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFDRHK---VGDL------ISR 227
           F  +A YG +    +L ER    +R  +  +  +    +FD+++   +G+       I  
Sbjct: 87  FNWLAIYGWM----MLGERQSYIIRKKLFHEYFNLPCSWFDKYRSDIMGEFTQLHRCIEE 142

Query: 228 LGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIFGR 287
           + S +   S  M+Q       +L+            S  L+ ++   TP ++  A IF +
Sbjct: 143 VRSSSAEASAIMSQ-------SLVAVIALIGTAFYFSWSLTLIIFCSTPFIIICAVIFSK 195

Query: 288 KIRD-TSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAY 346
            I   T  +  E+     R++   L  +  V+    +  EI  Y+H I           Y
Sbjct: 196 YIHKYTEKENTESECAAERLAW-MLKNIEFVRLHNGDDFEISMYTHYIAQ-----ANEYY 249

Query: 347 INAQFFTATSSLGDIS-----FLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGL 401
           I A  F + +           F+    +GS ++ QG L I  +          GS +   
Sbjct: 250 IKASLFISANISILRLLSLLMFVQGFWFGSSMIKQGKLNIDSVITSFHCCLMLGSIINSA 309

Query: 402 TSFYSELMQGVGAATRLFELTDRVPS-----IKPTTGKKFVPGKGEIVFKDVTFSYPTRP 456
                 L +G  A  RL ++ DR P      I   +G   +P    IVF +V+F YP R 
Sbjct: 310 LGQAVVLQKGDVAMKRLLKMIDRTPRESLAFIDAISGIDLLP----IVFNNVSFCYPERK 365

Query: 457 GNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKS 516
            + +F  M+  I       V+GPSG GKST+  L+L  Y+   G I +   DI  +N   
Sbjct: 366 TDKVFDKMNFIIKPNKMTYVIGPSGSGKSTLFDLILLHYDNYHGSIMLGDLDIRSINRNI 425

Query: 517 LRRHIGLVQQEPVLMSGTLRDNI--TYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDT 574
           +  +I LV Q P L + T+R+NI      T  PSK E+  + K     N I + P G DT
Sbjct: 426 ILENITLVSQTPTLFNDTIRNNILACSNWTNLPSKLEMECICKFALLENLIAELPDGLDT 485

Query: 575 VIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSV 634
            IG  G  LSGGQ Q++A+ARA  +  +IL+LDE  SA+D+     +     +    K  
Sbjct: 486 RIGSGGIKLSGGQAQKVALARAFARNTSILLLDEPLSAVDMRQRIVLMENIKRWRNGK-- 543

Query: 635 TIVSIAHRLSTIRRSENIIVLGND---GSVVETGKFKELFAD 673
           T V I H L  IR ++NI+ +       S + T K +E   D
Sbjct: 544 TTVIITHDLEFIRNTDNILNISERKILSSALNTEKTQEFKWD 585

 Score =  157 bits (398), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 117/419 (27%), Positives = 208/419 (49%), Gaps = 12/419 (2%)

Query: 262  SISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFV 321
            +I  +LS + +   P V+    ++G  +  T    + +   L  +  E + G++T+QS  
Sbjct: 804  AIGWKLSLVCIAIIPLVVVLTGLYGTILIKTENRYKTSVANLESIVYEAIIGMKTIQSLC 863

Query: 322  AEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTI 381
             +Q    +++  I+ +   G   A         T+ L  +   ++  YG  LVL G  T 
Sbjct: 864  LQQYITKKFNCKIKLLEKNGTYRAVATGLGIALTNMLVLLFQSILFYYGFKLVLTGEYTH 923

Query: 382  GDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELT--DRVPSIKP-----TTGK 434
              L   +    +T  +V  L +   ++ +G  + + + ++   D   +I+P     TT  
Sbjct: 924  SKLFETIALLLFTIVTVASLVTQLPDITRGQRSISWIDQILKGDNQQTIEPPSNLSTTKG 983

Query: 435  KFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRF 494
             + P +  I   +++F+Y          ++++++ +     +VG SG GKST+  L+   
Sbjct: 984  IWNPNQPVIEVSNLSFTYAQVHNKKTLTNINMQLYSNQIYGIVGKSGSGKSTLINLICGL 1043

Query: 495  YNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRM 554
            Y+ S G I I   DI+K + K L + + L+QQ PVL   T+R+N+ YGLTET   E +  
Sbjct: 1044 YSLSEGSINICSCDINKWSTKELHKTVALLQQNPVLQFDTIRNNLLYGLTETVGDEHLLN 1103

Query: 555  VAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALD 614
            V +     +FI+   +G D+ +    +LLSGGQ QR+ +AR +++ P +L+LDE TSALD
Sbjct: 1104 VLEYVGLKSFIISLNNGLDSKL--DDSLLSGGQSQRLCMAREMLRNPKVLILDECTSALD 1161

Query: 615  VESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFAD 673
            V S   IN   G   +S +   + ++H+  TI+  + I  L  DG+V   G ++EL  +
Sbjct: 1162 VTSAKKINDIIGS--RSLAPVTIIVSHQKETIKLCDKIFFLV-DGTVAMMGTYEELMEN 1217

>Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL209C
            (STE6) - ABC transporter, glycoprotein, component of
            a-factor secretory pathway [contig 290] FULL
          Length = 1297

 Score =  155 bits (391), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 125/410 (30%), Positives = 201/410 (49%), Gaps = 31/410 (7%)

Query: 278  VLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDI 337
            VLFS  I+G  +++     +    +L     + +  ++T++    E K    Y   + ++
Sbjct: 888  VLFSG-IYGGLLQNYEARYKTCIAELENELYKAIRCMKTIKCLQMENKVARSYE--MLEV 944

Query: 338  FNVGK-RAAYINAQFFTATS-SLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTG 395
             + G  R   +   F  A+S +L  I+  ++L +G  LV+ G  T G +   +    +T 
Sbjct: 945  TSKGAARKRAMGTGFGVASSNALTFITQSILLYFGMKLVITGEYTPGKMLETLTLLLFTI 1004

Query: 396  SSVFGLTSFYSELMQGVGAATRLFEL------------TDRVPSIKPTTGKKFVPGKGEI 443
             +   L S   E+ +G  AAT LF+L             +R   I  T  K+ +     I
Sbjct: 1005 MTCMTLMSQVPEISRGQRAATYLFKLFGNEHEEGASVLKERHAPIIKTCSKQTL-----I 1059

Query: 444  VFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIF 503
              K + FSY      ++++++ +K+  G  V ++G SG GKST+  LL R Y   +G I 
Sbjct: 1060 SIKHLKFSYSNINNPMVYKNLSLKVDRGEIVGLIGTSGSGKSTLWSLLTRLYPVENGSIS 1119

Query: 504  IDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHN 563
            IDG DI++ + K+LR  I +V+Q+P+  SG++ +N+TYGL    S EE+  +        
Sbjct: 1120 IDGTDINQWDRKALRSCIAVVEQKPLFFSGSIIENLTYGLMRKVSDEEVNELLLTLGMLE 1179

Query: 564  FIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINY 623
            F+   P    +VI  Q  LLSGGQ QR+AI RAL++KP +LVLDE TSALD       ++
Sbjct: 1180 FVNSTPKRLHSVIDTQ--LLSGGQVQRLAIVRALLRKPQLLVLDECTSALDARH----SF 1233

Query: 624  TFGQLMKSK--SVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELF 671
               + +K      T + + H    +R    I+   N G +VE G    LF
Sbjct: 1234 IMSEFVKHHLYHTTTLVVTHSEQMMRSCHRILTF-NKGEIVEEGSIDNLF 1282

 Score =  145 bits (366), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 141/588 (23%), Positives = 262/588 (44%), Gaps = 43/588 (7%)

Query: 104 DWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGLETNEGKDGPI--SMADVPPIFMG 161
           DW LL+I I++ +V+ GI   +P V  +++  +   L+       P+      V  +   
Sbjct: 25  DWWLLMI-ISICSVAYGI---VPAVTSILMGAVFNLLQK------PVIQQFDSVNTLMRD 74

Query: 162 YSIYEFLGGFAALMVFGIVA---NYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFD- 217
            +I        A+++ GI +    +  I     L ER   RLR  +++    +   ++D 
Sbjct: 75  LTIRTM-----AILITGIASIPFCWLSIYAWMSLGERQGFRLRRKLLRSYFEKSMAWYDI 129

Query: 218 RHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPP 277
             ++    ++L      +  S  +  +  F+ L+            S  L+ +++  +P 
Sbjct: 130 NEQISGEYTQLNRCVEELRSSSAEASAIIFQNLVTVIALLGTALYYSWSLTLVIMANSPL 189

Query: 278 VLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDI 337
           V+  A    R +          T     +    L+  + V+    +  EI ++  ++   
Sbjct: 190 VIGFAIYCSRNVEKYGKIENSETSVAADIMAWSLNAAKMVRLLGTQDYEIAKFRASVLKC 249

Query: 338 FNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGD-LTAFMLYTEYTGS 396
                + +  ++  ++    L    F+    YG+  +  G L  GD +T F        S
Sbjct: 250 RMNFNKMSLFSSLNYSILRFLTLCMFVQGFWYGNVRIKSGNLKPGDVMTCF-------SS 302

Query: 397 SVFGLTSFYSELMQGV----GAA----TRLFELTDRVPSIKPTTGKKFVP---GKGEIVF 445
            +   ++  S L Q V    GA      + F  +D V   +       +P    + +I F
Sbjct: 303 CILLASTLNSTLHQVVTLQKGAVGLKKIQEFLTSDVVQGKECVVNSMHLPLLWEQAQISF 362

Query: 446 KDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFID 505
           ++V+F+YP+R  + + +++++K+P G    +VG SG GKSTI+ LLL+ Y P SG I ++
Sbjct: 363 ENVSFAYPSRSKHPVIKNLNLKVPGGRFTFIVGKSGSGKSTISNLLLKLYRPCSGLIKVN 422

Query: 506 GQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFI 565
             DI ++N + L R I LV+Q   L   ++++NI     E      +    +       I
Sbjct: 423 DVDIREINQQDLFRSITLVEQNSPLFEDSIKNNIQLTSDEHRDDGRLSQACQAAMLEGVI 482

Query: 566 VKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTF 625
                G DT+IG  G  LSGG++QR+A+ARA ++   IL+LDEA SA D   +  +    
Sbjct: 483 RDLAKGLDTIIGSSGVDLSGGEQQRVALARAFVRDSPILILDEALSAQDRMHKDLLMEAI 542

Query: 626 GQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFAD 673
               K ++  I++  H L+ I   ++ ++L  DG+V+E G+  +L +D
Sbjct: 543 RFWRKGRTTIILT--HELNDILE-DDFVLLMEDGNVIERGQKSDLLSD 587

>Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar to
            Ashbya gossypii AGR047W
          Length = 1505

 Score =  154 bits (389), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 145/511 (28%), Positives = 234/511 (45%), Gaps = 22/511 (4%)

Query: 164  IYEFLGGFAALMVFGIVANYGR-IVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVG 222
            I+++LG +  L     ++   R I L    + +  ARL   + K  +     FF+   VG
Sbjct: 980  IWKYLGIYFLLCFSASLSTLLRSITLCMFCTIKASARLHDAMAKAVLRAPMSFFETTPVG 1039

Query: 223  DLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSA 282
             +++R  +D Y V   + +  S  F  +           SI+ Q    +L  +   LF  
Sbjct: 1040 RILNRFSNDIYKVDELLGRSFSQFFIHVTKVVFTMIVICSITWQFIFFILPLSVLYLFYQ 1099

Query: 283  SIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGK 342
              + R  R+           +    +E L+GV TV+SF    K+  R+ H  +   N   
Sbjct: 1100 QYYLRTSRELRRLASVTKSPVYAHFQETLTGVTTVRSF----KKQDRFIHINQSRINTYM 1155

Query: 343  RAAY--INAQFFTA--TSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSV 398
             A Y  INA  + A     +G I  L       + + QG LT G L   + Y      S+
Sbjct: 1156 CAYYLSINANRWLAFRLEFMGSIVILAAAVLSVFRLKQGKLTAGMLGLGLSYALQITQSL 1215

Query: 399  FGLTSFYSELMQGVGAATRLFELTD---RVPSIKPTTGK-KFVPGKGEIVFKDVTFSYPT 454
              +     E+   + +  R+ E TD     P I PT+   K  P  G+I F+   FS   
Sbjct: 1216 NWIVRMTVEVETNIVSVERIKEYTDLKPEAPMIIPTSRPPKNWPANGDIKFEH--FSTRY 1273

Query: 455  RPG-NVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLN 513
            RP  ++I  D+++ I     V +VG +G GKS++ + L R    ++G+I ID   I  + 
Sbjct: 1274 RPELDLILEDINLHIHPREKVGIVGRTGAGKSSLTVSLFRLIEAAAGRILIDDLPIDSIG 1333

Query: 514  IKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKF-PHGY 572
            +  LR  + ++ Q+  +  GT R+NI        + +EI    +       ++     G 
Sbjct: 1334 LNDLRSSLSIIPQDSEVFEGTFRENI--DPCNKFTDDEIWNALELAHLKQHVMTLGTEGL 1391

Query: 573  DTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSK 632
            +T +   G+ LS GQ+Q + +ARAL+    ILVLDEAT+A+DVE++  I  T     K +
Sbjct: 1392 NTSLKEGGSNLSVGQRQLMCLARALLVPSKILVLDEATAAIDVETDKLIQRTIRTAFKDR 1451

Query: 633  SVTIVSIAHRLSTIRRSENIIVLGNDGSVVE 663
              TI++IAHRL+TI  S+ I+VL + G + E
Sbjct: 1452 --TILTIAHRLNTIMDSDKIVVL-DKGRIAE 1479

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/227 (26%), Positives = 108/227 (47%), Gaps = 20/227 (8%)

Query: 447 DVTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIF-I 504
           D T+ +  +P   V  ++++ +   G   C+VG  G GKS +   +L       G +F +
Sbjct: 619 DATYLWQRQPEYKVALKNINFQARKGELSCIVGKVGTGKSALIQAML-------GDLFRV 671

Query: 505 DGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNF 564
            G         +L   +  V Q   +M+GT++DNI +G       E      K C     
Sbjct: 672 KGS-------ATLHGSVAYVSQVSWIMNGTIKDNILFGYKY--DAEFYEKTIKACALSLD 722

Query: 565 IVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVE-SEGAINY 623
           +   P G  T +G +G  LSGGQK R+A+ARA+  K  +  LD+  +A+D   S+  + Y
Sbjct: 723 LNTLPDGDQTFVGERGISLSGGQKARLALARAVYAKADVYFLDDPLAAVDEHVSKHLVKY 782

Query: 624 TFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKEL 670
             G     K+ T +   +++  +  +++I +L N G +V+ G + ++
Sbjct: 783 VIGPTGLLKTKTRILTTNKIHVLSVADSITLLDN-GVIVQQGSYDQV 828

>SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} similar
            to uniprot|P39109 Saccharomyces cerevisiae YDR135C
          Length = 1499

 Score =  145 bits (367), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 135/475 (28%), Positives = 226/475 (47%), Gaps = 31/475 (6%)

Query: 215  FFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLF 274
            FF+   +G +++R  +D Y V   + +  S  F  ++          + + Q     +L 
Sbjct: 1025 FFETTPIGRILNRFSNDIYKVDELLGRTFSQFFVNVVKVTFTIVVICTSTWQF----ILV 1080

Query: 275  TPPVLFSASIFGRKIRDTSTDLQEATGQLTRVS-----EEQLSGVRTVQSFVAEQKEIHR 329
              P+      + +    TS +L+     +TR       +E L GV T++ +  +QK   R
Sbjct: 1081 VLPLSVLYIYYQQYYLRTSRELRR-LDSVTRSPIYAHFQETLGGVSTIRGY-GQQK---R 1135

Query: 330  YSHAIRDIFNVGKRAAY--INAQFFTA--TSSLGDISFLVVLAYGSYLVLQGGLTIGDLT 385
            ++H  +   +    A Y  +NA  + A     LG I  L       + + QG LT G + 
Sbjct: 1136 FAHINQARIDNNMSAFYPAVNANRWLAFRLEFLGSIIILGAATLSVFRLKQGTLTAGMIG 1195

Query: 386  AFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPS----IKPTTGKKFVPGKG 441
              + Y      S+  +     E+   + +  R+ E  +  P     I+ +   K  P +G
Sbjct: 1196 LSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYAELKPEAPAIIESSRPPKGWPSQG 1255

Query: 442  EIVFKDVTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSG 500
            +I F+  +  Y  RP   +I RD+++ I A   V +VG +G GKS++ L L R    + G
Sbjct: 1256 DIRFEHYSTRY--RPELQLILRDVNLHIKAREKVGIVGRTGAGKSSLTLALFRIIEAAEG 1313

Query: 501  QIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCF 560
             IFIDG     + +  LR  + ++ Q+  + +GTLR+N+    TE  + EEI    +   
Sbjct: 1314 HIFIDGLSTDTIGLADLRHKLSIIPQDSQVFAGTLRENV--DPTEEFTDEEIWHALELSH 1371

Query: 561  CHNFIVKFPH-GYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEG 619
                ++   + G  T++   G+ LS GQ+Q + +ARAL+    ILVLDEAT+A+DVE++ 
Sbjct: 1372 LKEHVMSMGNDGLQTMLTECGSNLSVGQRQLLCLARALLIPSKILVLDEATAAVDVETDR 1431

Query: 620  AINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADP 674
             I  T     K++  TI++IAHR++TI  S+ IIVL N+G V E    + L   P
Sbjct: 1432 VIQETIRTAFKNR--TILTIAHRINTIMDSDKIIVL-NEGQVAEFDTPENLLQRP 1483

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 94/382 (24%), Positives = 174/382 (45%), Gaps = 33/382 (8%)

Query: 304 TRVSEEQLSGVRTVQSFVAE---QKEIH--RYSHAIRDIFNVGKRAAYINAQFFTATSSL 358
           TRV  E L+ +++++ +  E   +K++   R    ++++  +G   A  + QF      +
Sbjct: 475 TRVISEILNNIKSLKLYAWEVPYKKKLDYVRNEKELKNLTKMGCTLALASFQFNIVPFLV 534

Query: 359 GDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRL 418
              +F V +       L   L    LT F L +         +TSF    ++   +  RL
Sbjct: 535 SCSTFAVFVMTQKGRALTTDLVFPALTLFNLLSFPLAVVPNAITSF----IEASVSVNRL 590

Query: 419 FE-LTDRVPSIKPTTGKKFVPGKGEIVFK---DVTFSYPTRPG-NVIFRDMDIKIPAGSN 473
              LT+        + +  V  KG+I  K   D TF +  +P   V  ++++ +   G  
Sbjct: 591 HSFLTNEELQKDSVSREPSVTSKGDIAVKVGGDATFLWQRKPEYKVALKNINFQAKKGEL 650

Query: 474 VCVVGPSGRGKSTIALLLLRFYNPSSGQIF-IDGQDISKLNIKSLRRHIGLVQQEPVLMS 532
            C+VG  G GKS +   +L       G +F + G         ++   +  V Q P +M+
Sbjct: 651 TCIVGRVGSGKSALIQSIL-------GDLFRVKG-------FATIHGSVAYVSQIPWIMN 696

Query: 533 GTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIA 592
           GT+++NI +G    PS  E     K C  +  +   P G  T++G +G  LSGGQK R++
Sbjct: 697 GTVKENILFGHKYDPSFYE--KTVKACALNVDLSILPQGDQTLVGEKGISLSGGQKARLS 754

Query: 593 IARALIKKPTILVLDEATSALDVE-SEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSEN 651
           +ARA+  +    +LD+  +A+D   ++  ++   G      S T V   ++++ +  +++
Sbjct: 755 LARAVYSRADTYLLDDPLAAVDEHVAKHLVDNVLGVTGLLHSKTKVLATNKITVLSIADS 814

Query: 652 IIVLGNDGSVVETGKFKELFAD 673
           I +L N G +V+ G + E+  D
Sbjct: 815 IALLEN-GEIVQQGSYDEVVRD 835

>CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1 or uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1
          Length = 1535

 Score =  144 bits (362), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 154/568 (27%), Positives = 257/568 (45%), Gaps = 70/568 (12%)

Query: 136  LKTGLETNEGKDGPISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGR-IVLLRILSE 194
            LK   E+N+  +G             Y++  FLG +AA+ + G   N  R + +L   S 
Sbjct: 975  LKHWSESNQKANG------------NYNLLWFLGVYAAIGLGGAFCNNMRSLTMLLYGSL 1022

Query: 195  RVVARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXX 254
            R   +L   + K  +     FF+    G +I+R  SD   V  ++    S  F++++   
Sbjct: 1023 RGSRKLHNKMAKTIMRSPMSFFETTPTGRIINRFSSDMDSVDTTLQNVFSLFFRSILDYI 1082

Query: 255  XXXXXXXSISPQL----SGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQ 310
                      P      +GLL+++    L+  S +    R+       +   +  +  E 
Sbjct: 1083 ITVILVTFNMPLFFLLNAGLLVIY----LYYQSFYIVLSRELKRLTSISYSPIMSLMGES 1138

Query: 311  LSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSS-------LGDISF 363
            LSG  T+ ++    ++I R+SH      N  +    IN  FF   SS       L  I  
Sbjct: 1139 LSGHFTISAY----EQIRRFSH-----LNYERIQFSINC-FFNYRSSNRWLSVRLQSIGA 1188

Query: 364  LVVLAYG----SYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLF 419
            L+VL+ G    S L     L+ G +   M Y     SS+  +      +   + +  R+ 
Sbjct: 1189 LIVLSTGLLALSSLGTDHQLSSGLVGLLMSYALQVTSSLIWIIRSSVLIETNIVSVERIV 1248

Query: 420  ELTDRVPSIKPTTGKKF-----VPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNV 474
            E  D  P   P   ++       P +G+I FK+ + SY      V+ + +++ I  G  +
Sbjct: 1249 EYCDISPE-APEVKEEHRLDDNWPNQGQIEFKNYSTSYRENLDPVL-KHINLVISPGEKI 1306

Query: 475  CVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGT 534
             VVG +G GKST+++ L R   P++G I ID  DI+ + ++ LR HI ++ Q+     GT
Sbjct: 1307 GVVGRTGAGKSTLSMALFRLLEPTAGTISIDNIDITSIGLRDLRSHIAIIPQDAQAFEGT 1366

Query: 535  LR-----------DNITYGLTETPSKEEIRMVAKQC-----FCHNFIVKFPHGYDTVIGP 578
            +R           D++ + +  +  K  +  +AK+      +     ++ P   D  +  
Sbjct: 1367 IRSNLDPFEKFSDDDLWHAIELSHLKFHLETIAKEINDDSEYSDRSRLESP--LDIPVRE 1424

Query: 579  QGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVS 638
             G+ LS GQKQ + +ARAL+ K  ILVLDEAT+++DVE++  I  T  +    +  TI++
Sbjct: 1425 AGSNLSVGQKQLLCLARALLNKSKILVLDEATASVDVETDKIIQETIRKEFADR--TILT 1482

Query: 639  IAHRLSTIRRSENIIVLGNDGSVVETGK 666
            IAHRL T+  S+ IIVL + G V E  K
Sbjct: 1483 IAHRLDTVFDSDRIIVL-DGGEVKEFDK 1509

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 61/219 (27%), Positives = 111/219 (50%), Gaps = 26/219 (11%)

Query: 465 DIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI-FIDGQDIS-----KLNIKSLR 518
           + ++P  S +CVVG  G GKSTI   +L       GQ+  I G +       ++N  +  
Sbjct: 639 NFEVPKSSLICVVGRVGAGKSTILKCIL-------GQLPCISGNNDHLSPQFQINATT-- 689

Query: 519 RHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGP 578
             +    QE  +M+ +++DNI +G      +   +   K C     I   P G +T++G 
Sbjct: 690 --VAYCPQEAWIMNASVKDNILFG--HKYDEAFYKATIKACQLLPDIKVLPDGDETMVGE 745

Query: 579 QGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVE-SEGAINYTFGQ---LMKSKSV 634
           +G +LSGGQK R+++ARA+  +  + +LD+  SA+D E  +  I     +   L+K KS+
Sbjct: 746 KGIVLSGGQKTRLSLARAVYSRADLYLLDDILSAVDTEVCKTIIKEVLDEKTGLLKDKSI 805

Query: 635 TIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFAD 673
            + +  + +S ++ S  I +L N  S+ + G + ++  +
Sbjct: 806 VLAT--NTISVLKHSTKIYLLEN-KSIAQEGNYDDIMNN 841

>TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8.303
            YDR135C
          Length = 1523

 Score =  143 bits (361), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 130/475 (27%), Positives = 219/475 (46%), Gaps = 33/475 (6%)

Query: 215  FFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLF 274
            FF+   +G +++R  +D Y +   + +  S  F+  I          S + Q   L++  
Sbjct: 1034 FFETTPIGRILNRFSNDVYKIDEILGRSFSQFFQNTIRVSFTIVVICSTTWQFIFLIIPM 1093

Query: 275  TPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAI 334
                ++    F R  R+           L    +E L GV T++ F  + + IH     +
Sbjct: 1094 AFLYIYYQQYFLRTSRELRRLDSTTRSPLYAHFQETLCGVSTIRGFAQQDRFIHINQSRV 1153

Query: 335  RDIFNVGKRAAYINAQFFTA--TSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTE 392
                N+      IN+  + A     LG +  L       + +  G LT G +   M Y  
Sbjct: 1154 DS--NMMAYYPSINSNRWLAFRLEFLGSLIILGAATLSIFRLKNGSLTAGMIGLSMSYAL 1211

Query: 393  YTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPS-----IKPTTGKKFVPGKGEIVFKD 447
                S+  +     ++   + +  R+ E +  +PS     I+     +  P KG I FK+
Sbjct: 1212 QVTQSLNWIVRMTVDVESNIVSVERIEEYS-HLPSEAPLIIENNRPSEEWPSKGAIEFKN 1270

Query: 448  VTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDG 506
             +  Y  RP  +++ +++++KI     V +VG +G GKS++ L L R    SSG I IDG
Sbjct: 1271 YSTRY--RPELDLVLKNINLKILPKEKVGIVGRTGAGKSSLTLALFRIIEASSGSIEIDG 1328

Query: 507  QDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIV 566
             +I++L +  LR  + ++ Q+  +  G++R+NI    T+  S++EI    +       I+
Sbjct: 1329 VNINELGLYDLRHKLSIIPQDSQVFEGSIRENI--DPTQQFSEQEIWNALEMAHLKPHIL 1386

Query: 567  KF---------------PHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATS 611
            K                 +  D  I   G+ LS GQ+Q I +ARAL+    +L+LDEAT+
Sbjct: 1387 KMNEISPESENSDTNQSSNPLDAKITEGGSNLSVGQRQLICLARALLVPSNVLILDEATA 1446

Query: 612  ALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGK 666
            A+DVE++  I +T     K +  TI++IAHR++TI  S+ IIVL N G V E  K
Sbjct: 1447 AVDVETDELIQHTIRTAFKDR--TILTIAHRINTIMDSDKIIVLDN-GEVAEFDK 1498

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 70/245 (28%), Positives = 118/245 (48%), Gaps = 27/245 (11%)

Query: 436 FVPGKGEIVFK---DVTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLL 491
           FV   GE   K   + TF +  +P   V  ++++ +   G   C+VG  G GKS     +
Sbjct: 605 FVKQNGETTVKIGDNATFLWKRKPEYKVALKNINFEARKGELACIVGKVGSGKSAFIQSI 664

Query: 492 LRFYNPSSGQIF-IDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKE 550
           L       G +F + G         S+  ++  V Q   +M+GT++DNI +G    P  E
Sbjct: 665 L-------GDLFRVKG-------FASIHGNVAYVSQLAWIMNGTVKDNIIFGHRYDP--E 708

Query: 551 EIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEAT 610
                 K C     +   P G  T++G +G  LSGGQK R+++ARA+  +  I +LD+  
Sbjct: 709 FYEKTIKACALTIDLSILPDGDQTLVGEKGISLSGGQKARLSLARAVYARADIYLLDDPL 768

Query: 611 SALDVE-SEGAINYTFGQ--LMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKF 667
           +A+D   S+  I    G   L+KSK  T +   +++  +  +++I +L N G + E G +
Sbjct: 769 AAVDEHVSKHLIQNVLGAKGLLKSK--TRILTTNKIPVLSIADSITLLEN-GEITEQGTY 825

Query: 668 KELFA 672
            ++ A
Sbjct: 826 FDVMA 830

>CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1659

 Score =  143 bits (360), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 137/507 (27%), Positives = 234/507 (46%), Gaps = 53/507 (10%)

Query: 199  RLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXX 258
            R+   ++ K +H    F D   +G +++R   D   V + +T  +   F  L+       
Sbjct: 1141 RIFKKLLSKVLHSRLRFIDSTPIGRIMNRFSKDIEAVDQELTPFLEAAFFCLVQCISTII 1200

Query: 259  XXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQE----ATGQLTRVSEEQLSGV 314
                I+PQ   L +     VL+   + G    +TS +L+         + +   E L+GV
Sbjct: 1201 LITFITPQF--LFVAVLVCVLYY--LVGYFYINTSRELKRIESITKSPIYQHFSETLTGV 1256

Query: 315  RTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLV 374
             T+++F     EI    H +  I    K   Y+          +  I  L++   G +++
Sbjct: 1257 ATIRAF---GDEIRFIMHNLEKIDENNKPFFYLWVANRWLAFRIDMIGALIIFGSGVFIL 1313

Query: 375  LQ-----GGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIK 429
            L       G+    LT  + +TE        L  FYS +   + +  RL E  D VP  +
Sbjct: 1314 LNLNRIDSGMAGISLTYAISFTE----GALWLVRFYSTVEMNMNSVERLKEYMD-VPQ-E 1367

Query: 430  P------TTGKKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRG 483
            P      TT   + P +G+I  KD++  Y      VI +++   I   + V +VG +G G
Sbjct: 1368 PYNEGTITTSTNW-PTEGKIEVKDLSLRYAENLPRVI-KEVSFDIEPHNMVGIVGRTGAG 1425

Query: 484  KSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNIT-YG 542
            KSTI   L RF  P +G I IDG DI+ +++++LRR I ++ Q+P L +GT+R N+  +G
Sbjct: 1426 KSTIITALFRFLEPETGSIKIDGIDITSIDLQTLRRSITIIPQDPTLFTGTIRSNLDPFG 1485

Query: 543  LTETPSKEEIRMVAKQCFCHN----------------FIVKFPHGYDTVIGPQGALLSGG 586
              + P +E  R++ +     +                 + KF +  +  I   G  LS G
Sbjct: 1486 --KYPDEEIFRVLHRVNLIDDDEMTAQSSDNNSLSSDNVNKFLN-LENEITEGGNNLSQG 1542

Query: 587  QKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTI 646
            QKQ + +ARAL++ P +++LDEAT+++D  S+  I  T   +      T+++IAHRL ++
Sbjct: 1543 QKQLMCLARALLRNPKVILLDEATASIDYASDAKIQQTIRNVFDKS--TVLTIAHRLRSV 1600

Query: 647  RRSENIIVLGNDGSVVETGKFKELFAD 673
               + I+V+ + G V+E  +   L  D
Sbjct: 1601 IDYDKILVM-DAGEVIEYDQPYTLLLD 1626

 Score = 98.2 bits (243), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 69/237 (29%), Positives = 116/237 (48%), Gaps = 11/237 (4%)

Query: 435 KFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRF 494
           K  P   ++ F++ T ++     +   +D+DI    G    V+GP+G GK+++ L LL  
Sbjct: 705 KVAPDGNKLAFENATIAWSNNNQDFKLKDLDINFKIGKLNVVIGPTGSGKTSLLLALLGE 764

Query: 495 YNPSSGQIFI---DGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEE 551
               SG+I +   D +    ++   +   I    Q   L++ T+R+NI   L  +P  E+
Sbjct: 765 MQLLSGRIVVPSLDARHEMLIDSDGMTNSIAYCSQSAWLLNDTVRNNI---LFYSPYNED 821

Query: 552 -IRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEAT 610
             + V   C        F  G  T IG +G  LSGGQKQRI++ARAL      L+LD+  
Sbjct: 822 RYKEVIIACGLKRDFELFDAGDQTEIGEKGITLSGGQKQRISLARALYSNCRHLLLDDCL 881

Query: 611 SALDVESEGAI--NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETG 665
           SA+D  +   I  N   G LM+ ++  +VS  H ++   ++  ++V+  +G +   G
Sbjct: 882 SAVDSHTAAWIYDNCITGPLMEGRTCVLVS--HNIALTLKNAELVVMLENGRITNRG 936

>YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}
            VMR1Vacuolar membrane protein involved in multiple drug
            resistance and metal sensitivity; ATP-binding cassette
            (ABC) family member involved in drug transport; potential
            Cdc28p substrate; induced under respiratory conditions
          Length = 1592

 Score =  142 bits (357), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 155/588 (26%), Positives = 265/588 (45%), Gaps = 86/588 (14%)

Query: 130  GMILDVLKTGLETNEGKDGPISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLL 189
            G  +D L     T+  K+   +   +   F+   I   LGGF  +M F            
Sbjct: 1017 GFAMDTLPLKGMTDSSKNKHNAFYYLTVYFLIGIIQAMLGGFKTMMTF------------ 1064

Query: 190  RILSERVVARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKA 249
             +   R   ++  N++   +H    FFD   VG +++R   D   V + +   +      
Sbjct: 1065 -LSGMRASRKIFNNLLDLVLHAQIRFFDVTPVGRIMNRFSKDIEGVDQELIPYLEVTIFC 1123

Query: 250  LICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVS-- 307
            LI           I+P+      L    ++F    F  K   T++   +    +T+    
Sbjct: 1124 LIQCASIIFLITVITPRF-----LTVAVIVFVLYFFVGKWYLTASRELKRLDSITKSPIF 1178

Query: 308  ---EEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAY---INAQFFTATSSLGDI 361
                E L GV T+++F  E++ I    + I    +   RA +   +  ++F+    +  I
Sbjct: 1179 QHFSETLVGVCTIRAFGDERRFILENMNKI----DQNNRAFFYLSVTVKWFSFRVDM--I 1232

Query: 362  SFLVVLAYGSYLVLQ-----GGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAAT 416
               +VLA GS+++L       GL    LT  +L+T+        L   YS     + +  
Sbjct: 1233 GAFIVLASGSFILLNIANIDSGLAGISLTYAILFTD----GALWLVRLYSTFEMNMNSVE 1288

Query: 417  RLFELT--DRVPSIKPTTGKKFV------PGKGEIVFKDVTFSY-PTRPGNVIFRDMDIK 467
            RL E +  ++   +    G+  +      P  GEI  ++++  Y P  P   + R++  K
Sbjct: 1289 RLKEYSSIEQENYLGHDEGRILLLNEPSWPKDGEIEIENLSLRYAPNLPP--VIRNVSFK 1346

Query: 468  IPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQE 527
            +   S + +VG +G GKSTI   L R   P +G I IDGQDISK+++ +LRR I ++ Q+
Sbjct: 1347 VDPQSKIGIVGRTGAGKSTIITALFRLLEPITGCIKIDGQDISKIDLVTLRRSITIIPQD 1406

Query: 528  PVLMSGTLRDNI----------------TYGLTETPSKEEIRMVAKQCF--CHNFIVKFP 569
            P+L +GT++ N+                   L  +   EE+ + +++ F   HN   KF 
Sbjct: 1407 PILFAGTIKSNVDPYDEYDEKKIFKALSQVNLISSHEFEEV-LNSEERFNSTHN---KFL 1462

Query: 570  HGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVES----EGAINYTF 625
            + + T I   G  LS G++Q + IAR+L+++P I++LDEATS++D +S    +G I   F
Sbjct: 1463 NLH-TEIAEGGLNLSQGERQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRSEF 1521

Query: 626  GQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFAD 673
             +       TI++IAHRL ++   + IIV+ + G V E  +  EL  D
Sbjct: 1522 NK------STILTIAHRLRSVIDYDRIIVM-DAGEVKEYDRPSELLKD 1562

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 74/243 (30%), Positives = 118/243 (48%), Gaps = 16/243 (6%)

Query: 438 PGKGEIVFKDVTFSYPTRPGNV-IFR--DMDIKIPAGSNVCVVGPSGRGKSTIALLLLRF 494
           P K +I FK+ T ++     ++  F+   ++IK   G    ++G +G GKS + L LL  
Sbjct: 659 PDKNKIEFKNATLTWNENDSDMNAFKLCGLNIKFQIGKLNLILGSTGSGKSALLLGLLGE 718

Query: 495 YNPSSGQIFIDG----QDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKE 550
            N  SG I +       D+   + + L        Q   L++ T+++NI +      +++
Sbjct: 719 LNLISGSIIVPSLEPKHDLIP-DCEGLTNSFAYCSQSAWLLNDTVKNNIIFD--NFYNED 775

Query: 551 EIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEAT 610
               V   C     +   P G  T IG +G  LSGGQKQRI++ARA+      ++LD+  
Sbjct: 776 RYNKVIDACGLKRDLEILPAGDLTEIGEKGITLSGGQKQRISLARAVYSSAKHVLLDDCL 835

Query: 611 SALDVESEGAI--NYTFGQLMKSKSVTIVSIAHRLS-TIRRSENIIVLGNDGSVVETGKF 667
           SA+D  +   I  N   G LMK+++  +V+  H +S T+R +   IVL N G V   G  
Sbjct: 836 SAVDSHTAVWIYENCITGPLMKNRTCILVT--HNVSLTLRNAHFAIVLEN-GKVKNQGTI 892

Query: 668 KEL 670
            EL
Sbjct: 893 TEL 895

>Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015W
            (REAL)
          Length = 1557

 Score =  142 bits (357), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 138/527 (26%), Positives = 241/527 (45%), Gaps = 34/527 (6%)

Query: 158  IFMGYSIYEFLG-GFAALMVFGIVANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFF 216
            ++M   +Y  +G G AA        N   I++L   S R   +L  ++ K  I     FF
Sbjct: 1017 VWMFVGVYSLIGVGSAAF------NNLRSIMMLLYCSIRGSKKLHESMAKSVIKSPMIFF 1070

Query: 217  DRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTP 276
            +   VG +I+R  SD   V  S+    S  FK+++             P      +    
Sbjct: 1071 ETTPVGRIINRFSSDMDAVDSSLQYIFSFFFKSILTYLVTVILVGYNMPWFLVFNMFLLG 1130

Query: 277  PVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIH----RYSH 332
              ++  + +    R+    +  +   +  +  E L+G   + ++   ++ I+    +  +
Sbjct: 1131 IYIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQY 1190

Query: 333  AIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLA-YGSYLVLQGGLTIGDLTAFMLYT 391
             I  +FN      +++ +  T  +++   + ++ LA   +   L  G+ +G L ++ L  
Sbjct: 1191 NIDFVFNFRSTNRWLSVRLQTIGATIVLATAMLTLATMNTKKQLSSGM-VGLLMSYSL-- 1247

Query: 392  EYTGSSVFGL--TSFYSELMQGVGAATRLFELTDRVPSIKPTTG-KKFVPGKGEIVFKDV 448
            E TGS  + +  T      +  V       EL     SI P     K  P +G I FKD 
Sbjct: 1248 EVTGSLTWIVRTTVMIETNIVSVERIVEYCELPSEAQSINPEKRPDKNWPSRGSIEFKDY 1307

Query: 449  TFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQD 508
            +  Y      V+ +D+++KI     V +VG +G GKST++L L R   P+ G+I IDG +
Sbjct: 1308 STKYRENLDPVL-KDINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDGIN 1366

Query: 509  ISKLNIKSLRRHIGLVQQEPVLMSGTLRDNIT--YGLTETPSKEEIRMVAKQCFCHNFIV 566
            IS L +  LR H+ ++ Q+     GT++ N+      +E   K+ + +   +      + 
Sbjct: 1367 ISDLGLFDLRSHLAIIPQDAQAFEGTVKTNLDPFNRYSEDELKKAVELAHLKPHLEKMLE 1426

Query: 567  KFPHG----------YDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVE 616
              P             D  I   G+ LS GQ+Q + +ARAL+ +  ILVLDEAT+++D+E
Sbjct: 1427 NEPSDSEESCDIKDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATASIDME 1486

Query: 617  SEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVE 663
            ++  I  T  +  K +  TI++IAHR+ T+  S+ IIVL ++GSV E
Sbjct: 1487 TDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DEGSVKE 1530

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 97/433 (22%), Positives = 184/433 (42%), Gaps = 76/433 (17%)

Query: 283 SIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGK 342
           +   RK++  S           +   E L+ +++++ +  E+  + R +H   D+     
Sbjct: 451 AFLSRKVKKLSKTQMRYKDMRIKTITELLNAIKSIKLYAWEEPMMKRLNHVRNDMELKNF 510

Query: 343 RAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAF-------------ML 389
           R              +G +S L+  A+    ++    T G  + F             + 
Sbjct: 511 R-------------KIGIVSNLIYFAWNCVPLMVACSTFGLFSLFNDSPLSPAIVFPSLS 557

Query: 390 YTEYTGSSVFGLTSFYSELMQGVGAATRL--FELTDRVPS-----IKPTTGKKFVPGKGE 442
                 S+++ + S  + +++   +  RL  F L+D +       I P+  ++ +P    
Sbjct: 558 LFNILNSAIYSVPSMINTIIETSVSMKRLKSFLLSDEIDDSFIERIDPSVDERTLPV--- 614

Query: 443 IVFKDVTFSYPTRPG---------------------NVIFRDMD-IKIPAGSNVCVVGPS 480
           I   ++TF + ++                        +  +++D  +   G+ VC+VG  
Sbjct: 615 IEMNNITFLWKSKEALASSQLENNSRADEESAMGSSQIALKNIDHFEAKRGNLVCIVGRV 674

Query: 481 GRGKSTIALLLLRFYNPSSGQI-FIDGQDIS---KLNIKSLRRHIGLVQQEPVLMSGTLR 536
           G GKST    +L       GQ+  + G   S   KL I+S    +    QE  +M+ +++
Sbjct: 675 GAGKSTFLKAIL-------GQLPCMSGSKESIPPKLIIRS--SSLAYCSQESWIMNASVK 725

Query: 537 DNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARA 596
           +NI +G      K    +  K C     +   P G +T++G +G  LSGGQK R+++ARA
Sbjct: 726 ENILFG--HKFDKAYYDLTIKACQLLPDLRILPDGDETLVGEKGISLSGGQKARLSLARA 783

Query: 597 LIKKPTILVLDEATSALDVE-SEGAINYTF-GQLMKSKSVTIVSIAHRLSTIRRSENIIV 654
           +  +  I +LD+  SA+D E S+  I Y   G+    K+ TI+   + +S ++ S+ I  
Sbjct: 784 VYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKKALLKNKTIILTTNTVSILKHSQMIYA 843

Query: 655 LGNDGSVVETGKF 667
           L N G +VE G +
Sbjct: 844 LEN-GEIVEQGNY 855

>NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10
          Length = 1491

 Score =  141 bits (356), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 147/553 (26%), Positives = 239/553 (43%), Gaps = 81/553 (14%)

Query: 167  FLGGFAALMVF-GIVANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVGDLI 225
            F  G  +  VF G +    +  LL  +  R    L    + + +H    + D   +G ++
Sbjct: 950  FYMGLYSFFVFAGYLFTSSQFTLLCAIGIRASKWLNLKAVHRILHTPMSYLDTTPLGRIL 1009

Query: 226  SRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIF 285
            +R   D   +   +T+ +      L+           +   +         P LF     
Sbjct: 1010 NRFTKDTDSLDNELTESIR-----LMLFQTANIVGVCVMCIIYLPWFAIAIPFLFIGFTL 1064

Query: 286  GRKIRDTSTDLQEATGQLTRVSE------------EQLSGVRTVQSFVAEQKEIHRYSHA 333
                    TD  ++TG+  +  E            E L G+ T++S+ +E++ + +  + 
Sbjct: 1065 -------ITDHYQSTGREVKRLEAIQRSFVYNNFNEILGGMDTIKSYGSEERFLAKSDYL 1117

Query: 334  IRDIFNVG------KRAAYINAQFFTATSSLGDISFLVVLAYG----------SYLVLQG 377
            I  +   G      +R   I         +L      V  A+           +Y++   
Sbjct: 1118 INKMNEAGYLSVALQRWVAIFLDLVAVCFALIITLLCVTRAFHISAVSVGVLLTYVLQLP 1177

Query: 378  GLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFV 437
            GL  G L A +  TE   +S   L S+ +EL           E   R P + P       
Sbjct: 1178 GLLNGVLRA-LTQTENDMNSAERLVSYATELP---------LEAAYRRPEVSPPEN---W 1224

Query: 438  PGKGEIVFKDVTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYN 496
            P +G+I FK V FSY  RPG  ++ +D+D+ I +G  + + G +G GKSTI   L R   
Sbjct: 1225 PSEGKIEFKHVDFSY--RPGLPIVLKDLDLDIKSGEKIGICGRTGAGKSTIMSALYRLNE 1282

Query: 497  PSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDN----------------IT 540
             S G+I ID  DISKL +  LRR + ++ Q+PVL  GT+R N                + 
Sbjct: 1283 ISQGEILIDNVDISKLGLYDLRRKLAIIPQDPVLFRGTIRKNLDPFNEHDDDLLWDSLVR 1342

Query: 541  YGLTETPSKEEIR-MVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIK 599
             G  E  +  +I+     +   H  + KF    D ++  +GA  S G++Q +A+ RAL++
Sbjct: 1343 GGAIERAALNKIKNQKVDKDGTHADMFKF--HLDQLVEEEGANFSLGERQLLALTRALVR 1400

Query: 600  KPTILVLDEATSALDVESEGAINYTFGQLMKS-KSVTIVSIAHRLSTIRRSENIIVLGND 658
            +  +L+LDEATS++D E++G I     +++K     TI+ IAHRL+TI   + I+VL   
Sbjct: 1401 QAKVLILDEATSSVDYETDGKIQ---ARIVKEFGDCTILCIAHRLNTILNYDRILVL-EK 1456

Query: 659  GSVVETGKFKELF 671
            G V E  K K LF
Sbjct: 1457 GEVAEFEKPKVLF 1469

 Score = 93.6 bits (231), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 106/202 (52%), Gaps = 21/202 (10%)

Query: 461 FRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRH 520
           F D+ + I  G  + +VGP G GK++    L  F N + G+I ++G D+           
Sbjct: 627 FHDITLDIKKGEFIIMVGPIGTGKTSFLNALAGFMNKTEGRIQVNG-DL----------- 674

Query: 521 IGLVQQEPVLMSGTLRDNITYGLTETP-SKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQ 579
             L+   P + + T+RDNI +G   +P  K++   V + C     +   P G  T IG +
Sbjct: 675 --LLCGYPWIQNATVRDNILFG---SPYDKKKYEEVLRCCSLEADLDILPAGDSTEIGER 729

Query: 580 GALLSGGQKQRIAIARALIKKPTILVLDEATSALDVE-SEGAINYTFGQLMKSKSVTIVS 638
           G  LSGGQK RI +AR + KK  I + D+  SA+D    +  ++  F  L+K+++  + +
Sbjct: 730 GITLSGGQKARINLARCVYKKKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKNETRILAT 789

Query: 639 IAHRLSTIRRSENIIVLGNDGS 660
             H+LS + R+  +IVLG DGS
Sbjct: 790 --HQLSLLERASRVIVLGTDGS 809

>SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar to
            uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1439

 Score =  140 bits (353), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 146/547 (26%), Positives = 242/547 (44%), Gaps = 70/547 (12%)

Query: 169  GGFAALMVFGIVANYG----RIVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVGDL 224
            G +  L +F +  NY     +  +L  +       L    +K+ +H    F D   +G +
Sbjct: 893  GFYIGLYIFFVFVNYFFMSLQFTILCYIGLAASKWLNLKAVKRLLHTPMSFMDTTPLGRV 952

Query: 225  ISRLGSDAYVVSRSMTQKV------SDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPV 278
            ++R   D   +   +T+ V      +     +I          +I+    GL+ +     
Sbjct: 953  LNRFTKDTDTLDNELTESVRLFVYQTANIAGVIIMCIIYLPWFAIAVPFLGLIFIIVADH 1012

Query: 279  LFSASIFGRKIRDTSTDLQEATGQ--LTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRD 336
              S+   GR+I+       EA  +  +     E LSG+ T++++ +E + + +    I  
Sbjct: 1013 YQSS---GREIKRL-----EAVQRSFVYNNFNEVLSGMDTIKAYKSENRFLMKSDFLINR 1064

Query: 337  IFNVG------KRAAYINAQFFTATSSL----------GDISFLVVLAYGSYLVLQGGLT 380
            +   G      +R   I+        +L           DIS   V    +Y++   GL 
Sbjct: 1065 MSEAGYLVVAVQRWVSISLDMIAVAFALIITLLCVTRQFDISAASVGVLLTYVLQLPGLL 1124

Query: 381  IGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGK 440
             G L A M   E   +SV  + ++ +EL Q   AA R  E+T + P           P  
Sbjct: 1125 NGLLRA-MTQAENDMNSVERIVNYATELPQE--AAYRKPEMTPQEP----------WPSN 1171

Query: 441  GEIVFKDVTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSS 499
            GE+VF +V+ SY  RPG  ++ + + + I  G  + + G +G GKSTI   L R    + 
Sbjct: 1172 GEVVFDNVSLSY--RPGLPLVLKGVSLNIKGGEKIGICGRTGAGKSTIMSALYRLCELNE 1229

Query: 500  GQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNIT-YGLTE------------T 546
            G++ IDG D SKL +  LRR + ++ Q+PVL  G++R N+  +G  E            T
Sbjct: 1230 GRVLIDGVDTSKLGLYDLRRKLSIIPQDPVLFKGSIRKNLDPFGEREDEELWSALVRSGT 1289

Query: 547  PSKEEIRMVAKQCFCHNFIVKFPHGY--DTVIGPQGALLSGGQKQRIAIARALIKKPTIL 604
               EE+  V  Q    +      H +  D  +   G   S G++Q +A+ RAL+++  IL
Sbjct: 1290 IEAEEVEKVKNQHRDESGSSTGLHKFHLDQEVEDDGTNFSLGERQLLALTRALVRQSKIL 1349

Query: 605  VLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVET 664
            +LDEATS++D E++  I     Q  +    TI+ IAHRL TI   + ++VL N G+V E 
Sbjct: 1350 ILDEATSSVDHETDAKIQSLIAQ--EFNRCTILCIAHRLKTILNYDRLVVLDN-GTVKEF 1406

Query: 665  GKFKELF 671
               + LF
Sbjct: 1407 DTPRSLF 1413

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 67/213 (31%), Positives = 104/213 (48%), Gaps = 24/213 (11%)

Query: 461 FRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRH 520
           F++++ +I  G  V + G  G GKS++   L  F   + G IF +G         SL   
Sbjct: 571 FKNLNFQIQKGELVIITGSIGTGKSSLLNALAGFMKKTEGDIFKNG---------SL--- 618

Query: 521 IGLVQQEPVLMSGTLRDNITYG--LTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGP 578
             L+   P + + T+RDNI +G    +   KE IR+ A Q          P G  T IG 
Sbjct: 619 --LLCGYPWIQNTTVRDNILFGSSFDDVRYKEVIRVCALQADLD----ILPAGDFTEIGE 672

Query: 579 QGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVE-SEGAINYTFGQLMKSKSVTIV 637
           +G  LSGGQK RI +AR++ K   I + D+  SA+D    +  ++     ++  K+  + 
Sbjct: 673 RGITLSGGQKARINLARSVYKSMDIYLFDDVLSAVDARVGKHIMDECLMGMLDGKTRILA 732

Query: 638 SIAHRLSTIRRSENIIVLGNDGSVVETGKFKEL 670
           +  H+LS I R+  +I LG  GS  + G  +EL
Sbjct: 733 T--HQLSLIERASRVIFLGAGGS-FDIGTVEEL 762

>KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4.6
            YHL035C
          Length = 1717

 Score =  140 bits (353), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 136/506 (26%), Positives = 226/506 (44%), Gaps = 65/506 (12%)

Query: 199  RLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXX 258
            ++ A ++ K IH    FFD   +G +++R   D   V + +T  ++  F + +       
Sbjct: 1193 KIFAMLLNKVIHSKLRFFDTTPIGRIMNRFSKDIESVDQELTPYLTGAFYSFVECFSTII 1252

Query: 259  XXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQ 318
                I+PQ   + +L +         +    R+           + +   E L GV T++
Sbjct: 1253 LISWITPQFFVVAILISIMYYLVGYFYMAGSRELKRLDSITKSPIYQHFSETLVGVTTIR 1312

Query: 319  SFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGG 378
            +F  E + +        ++F + +     N  FF    +   +SF + +  GS++V   G
Sbjct: 1313 AFGDEMRFLKE------NLFKIDEN----NKPFFYLWVANRWLSFRIDMI-GSFVVFGAG 1361

Query: 379  LTI-GD------------LTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRL------- 418
            + I  D            LT  + +TE        L  FYSE+   + +  R+       
Sbjct: 1362 VFILADIKNIDSGMAGISLTYAISFTE----GALWLVRFYSEVEMNMNSVERIKEYMSVE 1417

Query: 419  ---FELTDRVPSIKPTTGKKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVC 475
               +++ D +    PT      P +G+I   D++  Y      VI +++   +   S V 
Sbjct: 1418 QEPYDIKDEIVRTPPTVW----PDEGKIEVNDLSLRYAANLPRVI-KNVSFTVEPNSKVG 1472

Query: 476  VVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTL 535
            VVG +G GKSTI   L RF +P SG I ID  DI+ + +  LRR I ++ Q+P L +GTL
Sbjct: 1473 VVGRTGAGKSTIITALFRFLDPESGYIKIDNMDITTIPLTRLRRAITIIPQDPTLFAGTL 1532

Query: 536  RDN-----------ITYGLTETP--SKEEIR----MVAKQCFCHNFIVKFPHGYDTVIGP 578
            + N           I   LT     S EE+      V+ Q   H+            I  
Sbjct: 1533 KFNLDPYDEYNDKDIFAALTRVNLVSGEELNGETTAVSDQGSMHSNNENRFLDLSNEITE 1592

Query: 579  QGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTF-GQLMKSKSVTIV 637
             G  LS GQ+Q I +AR+L++ P IL+LDEAT+++D ES+  +  T  G+   S   TI+
Sbjct: 1593 GGGNLSQGQRQLICLARSLLRNPKILLLDEATASIDYESDARLQATIRGEFGNS---TIL 1649

Query: 638  SIAHRLSTIRRSENIIVLGNDGSVVE 663
            +IAHRL ++   + I+V+ + G V+E
Sbjct: 1650 TIAHRLRSVIDYDKILVM-DAGEVIE 1674

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 109/235 (46%), Gaps = 9/235 (3%)

Query: 442 EIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQ 501
           ++ F + T S+ T       R+++I    G    V+G +G GK+++ + LL   +   G+
Sbjct: 758 KLAFDNSTTSWDTNGSGFKLRNLNIDFKVGKLNVVIGATGSGKTSLLMALLGEMHICQGR 817

Query: 502 IFI---DGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQ 558
           I +   + +     N       I    Q   L++ T+R+NI +    +  +     V + 
Sbjct: 818 IIVPSLEPRSSLTANSDGFTNSIAYCSQAAWLLNDTVRNNILFN--SSFDENRYHKVVEA 875

Query: 559 CFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESE 618
           C           G  T IG +G  LSGGQKQRI++ARAL      L+LD+  SA+D  + 
Sbjct: 876 CGLKRDFDILKAGDLTEIGEKGITLSGGQKQRISLARALYSDSKHLLLDDCLSAVDSHTA 935

Query: 619 GAI--NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELF 671
             I  N   G LM  ++  +VS  H ++   R+  ++V+  DG V + G    LF
Sbjct: 936 SWIYDNCITGPLMVGRTCILVS--HNIALTLRNAELVVILEDGRVKDQGDPLNLF 988

>KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] {ON} 
          Length = 1537

 Score =  139 bits (350), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 133/533 (24%), Positives = 235/533 (44%), Gaps = 36/533 (6%)

Query: 164  IYEFLGGFAALMVFGIVANYGR-IVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVG 222
            +++F+G +A + +     N  R I+LL   + R   +L  N+    ++   +FF+   +G
Sbjct: 1003 VWKFVGIYALIGIASAAFNNLRTIILLVYCTIRGAKKLHDNMAHAIVYSSMQFFETTPIG 1062

Query: 223  DLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSA 282
             +++R  +D   V  ++       FK++              P      L      ++  
Sbjct: 1063 RILNRFSADIDTVDSTLQMVFMVFFKSIFSYLITVILITISMPLFLVFCLFLMVIYIYYQ 1122

Query: 283  SIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGK 342
             +F  + R+       +   +  +  E L G+  ++++  +   + +Y +  R  FN+  
Sbjct: 1123 KLFIVQSRELKRMTSISYSPIMSLVGESLGGLAVIRAY--KHFSMFKYLNNERVQFNINC 1180

Query: 343  RAAYINAQFFTATSSLGDISFLVVLAYG----SYLVLQGGLTIGDLTAFMLYTEYTGSSV 398
               Y +   + +   L  I  L+VL  G    S +     LT G +   M Y     +S+
Sbjct: 1181 VFDYRSTNRWLSIR-LQTIGALMVLITGMLSLSTISSSKPLTAGMVGLLMSYVLQVTTSL 1239

Query: 399  FGLTSFYSELMQGVGAATRLFELTDR-------VPSIKPTTGKKFVPGKGEIVFKDVTFS 451
              +      +  G+ +  R+ E  +        V   +P +     P KG I FK+ +  
Sbjct: 1240 MWIVRSSVMIETGIVSVERIMEYCELPSEAEQIVDDYRPASNW---PSKGAIQFKNYSTR 1296

Query: 452  YPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISK 511
            Y      V+ +++ I I  G  V +VG +G GKST+ L L R   P  G I IDG DISK
Sbjct: 1297 YRANLDPVL-KNISININPGEKVGIVGRTGAGKSTLTLALFRLLEPIEGTIIIDGMDISK 1355

Query: 512  LNIKSLRRHIGLVQQEPVLMSGTLRDN-----------ITYGLTETPSKEEIRMVAKQCF 560
            + I  LR H+ ++ Q+     GT+R N           +   +T +  K  ++ + ++  
Sbjct: 1356 IGISDLRSHLAIIPQDAQAFEGTVRSNLDPFNMFSDKELDTAITLSHLKPHLKKLMEESG 1415

Query: 561  CHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGA 620
                 +      +  I   G+ LS GQ+Q + +ARAL+ +  ILVLDEAT+++DVE++  
Sbjct: 1416 SE---LPLNDYLELGIKESGSSLSVGQRQLLCLARALLNRSKILVLDEATASVDVETDKI 1472

Query: 621  INYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFAD 673
            I  T  +    +  TI++IAHR+ T+  S+ I+VL   G V E      L AD
Sbjct: 1473 IQATIRESFSDR--TIITIAHRIDTVLDSDRILVL-EQGEVKEFNSPASLLAD 1522

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 109/228 (47%), Gaps = 31/228 (13%)

Query: 459 VIFRDMDIKIPAGSNV--CVVGPSGRGKSTIALLLLRFYNPSSG-------QIFIDGQDI 509
           V  +D+D    A  NV  CVVG  G GK+T+   +L     +SG       ++ I G+ +
Sbjct: 646 VALKDIDF-FRAKKNVLTCVVGRVGSGKTTLLKSILGQLPCTSGSQKAIPPKLIIRGESV 704

Query: 510 SKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFP 569
           +               QE  +M+ ++++NI +G      +    +  K C         P
Sbjct: 705 A------------YCPQEAWIMNDSIKENILFG--HRYDETFYNLTVKACELRPDFKILP 750

Query: 570 HGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQ-- 627
            G +T++G +G  LSGGQK R+++ARA+  +  I +LD+  SA+D     +I +      
Sbjct: 751 DGDNTLVGEKGITLSGGQKARLSLARAVYSRSDIYLLDDVLSAVDAGVRKSIIHRVLDSD 810

Query: 628 --LMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFAD 673
             L+K+K++ + +  + +S +  S+ I VL  DG ++E   + E   D
Sbjct: 811 TGLLKNKAIILTT--NDISVLEHSDRIYVL-QDGRIIEESTYAEAIED 855

>ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1695

 Score =  139 bits (349), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 146/553 (26%), Positives = 248/553 (44%), Gaps = 75/553 (13%)

Query: 148  GPISMADVPPIFMGYSIYEFLGGFA--ALMVFGIVANYGRIVLLRILSERVVARLRAN-- 203
            GP SM      F   +IY FL GFA   L  F  + ++             VA L A+  
Sbjct: 1138 GPHSM------FYYLAIY-FLIGFAQSVLSAFKTILSF-------------VAGLNASKK 1177

Query: 204  ----VIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXX 259
                +++K +H    FFD   +G +++R   D   V + +T      F +L+        
Sbjct: 1178 IFNLLLQKVLHAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFFEGAFYSLVTCLSTVVL 1237

Query: 260  XXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQS 319
               I+PQ   + ++      F    +    R+       +   + +   E L GV T+++
Sbjct: 1238 ITFITPQFLIVAVIVAVLYYFIGYFYLAGSRELKRLDSISRSPIYQHFSETLVGVTTIRA 1297

Query: 320  FVAE----QKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVL 375
            F  E    Q+ +H+     R  F +     ++  ++      L  I  LVV   G +++L
Sbjct: 1298 FGDESRFIQENLHKIDENNRPFFYL-----WVANRWLAMRIDL--IGSLVVFGAGVFILL 1350

Query: 376  Q-----GGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFE--LTDRVPSI 428
                   G+    LT  + +TE        L   YS +   + +  RL E  + ++ P  
Sbjct: 1351 NIDHIDAGMAGISLTYAITFTE----GALWLVRLYSNVEMNMNSVERLKEYMVVEQEPYN 1406

Query: 429  KP-TTGKKFVPGKGEIVFKDVTFSY-PTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKST 486
            +P  T     P  G +   DV+  Y P  P   + +++   +   S V VVG +G GKST
Sbjct: 1407 QPIMTPPSDWPQHGRVEMSDVSLRYAPGLPR--VIKNVSFTVEPKSKVGVVGRTGAGKST 1464

Query: 487  IALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTET 546
            I   L RF +P +G I ID  DIS ++++ LRR I ++ Q+P L +GT++ N+     + 
Sbjct: 1465 IITALFRFLDPETGHIKIDNVDISLIDLQMLRRSITIIPQDPTLFTGTIKSNL--DPYDE 1522

Query: 547  PSKEEI-------RMVAKQCFCHNFIVKFPHGYDTV---------IGPQGALLSGGQKQR 590
             S E+I        +V+++    + I     G + V         I   G  LS GQ+Q 
Sbjct: 1523 YSDEDIFAALKRVNLVSQEELDRSNIDAASVGSENVNKFLDLNSEINEGGGNLSQGQRQL 1582

Query: 591  IAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSE 650
            + +AR+L++ P I++LDEAT+++D +S+  I  T  +  +    TI++IAHRL ++   +
Sbjct: 1583 VCLARSLLRSPKIILLDEATASIDYQSDAKIQETIRKEFQGN--TILTIAHRLRSVIDYD 1640

Query: 651  NIIVLGNDGSVVE 663
             I+V+ + G V E
Sbjct: 1641 KILVM-DQGEVKE 1652

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 74/255 (29%), Positives = 124/255 (48%), Gaps = 17/255 (6%)

Query: 423 DRVPSI--KPTTGK----KFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCV 476
           DR+     +P T K       PG  ++ F++ T S+ +   +   R+++I    G    V
Sbjct: 720 DRIQEFLEEPDTDKYNQLSVAPGGQKLGFENATISWDSEKQDFKLRNLNIDFKVGKLNVV 779

Query: 477 VGPSGRGKSTIALLLLRFYNPSSGQIFI---DGQDISKLNIKSLRRHIGLVQQEPVLMSG 533
           +GP+G GK++I + LL      +G I +   D + +  ++   +   I    Q   L++ 
Sbjct: 780 IGPTGSGKTSILMALLGEMKLLNGNIVVPSLDPRALLPIDADGMTNSIAYCSQAAWLLND 839

Query: 534 TLRDNITYGLTETP-SKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIA 592
           T+R+NI +    +P S+     V + C           G  T IG +G  LSGGQKQRI+
Sbjct: 840 TVRNNILFN---SPYSEARYNDVIEACGLKRDFEILSAGDMTEIGERGITLSGGQKQRIS 896

Query: 593 IARALIKKPTILVLDEATSALDVESEGAI--NYTFGQLMKSKSVTIVSIAHRLSTIRRSE 650
           +AR+L      L+LD+  SA+D  +   I  N   G LM+ +  T + I+H ++   R+ 
Sbjct: 897 LARSLYSNSRHLLLDDCLSAVDSHTASWIYDNCITGPLMQGR--TCILISHNIALTLRNA 954

Query: 651 NIIVLGNDGSVVETG 665
            ++VL  +G V E G
Sbjct: 955 ELVVLLENGQVKEQG 969

>Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL015W
            (BPT1) - ABC-type transmembrane transporter; highly
            homologous to human MRP1 and to C. elegans mrp-1 [contig
            184] FULL
          Length = 1538

 Score =  139 bits (349), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 163/563 (28%), Positives = 247/563 (43%), Gaps = 54/563 (9%)

Query: 136  LKTGLETNEGKDGPISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSER 195
            LK   E NE   G  ++      ++G  IY F+   AAL+     +N   IVLL + S +
Sbjct: 988  LKHWSEDNERNGGNSNVL----FYVG--IYVFISLSAALL-----SNARTIVLLLVCSIK 1036

Query: 196  VVARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXX 255
               +L   +    I     FF+   VG +I+R  SD   +  S+ Q V   F  L+    
Sbjct: 1037 ASRKLHDTMALAVIRSPMSFFETTPVGRIINRFSSDMNSLDDSV-QYVMSFF--LVSILD 1093

Query: 256  XXXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVR 315
                   I  Q+   L L    VL     + +    T       + +L R+     S + 
Sbjct: 1094 YLVVVIIIGYQVP--LFLIVNAVLLVIYFYYQVYYVT------LSRELKRLMSTSFSPIM 1145

Query: 316  TVQS-FVAEQKEIHRYSHAIR-DIFNVGKRAAYINAQF-FTATS-----SLGDISFLVVL 367
            ++ S  +A    I  + H+ R D  NV      IN  F F +T+      L  I  L++L
Sbjct: 1146 SMLSETLAGHMIIDAFRHSDRFDYLNVENVQFNINCLFNFRSTNRWLSIRLESIGALMIL 1205

Query: 368  --AYGSYLVLQGG--LTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTD 423
              A  S     GG  L+ G +   M Y     + +  +     +L   + +  R+ E  D
Sbjct: 1206 TTALLSLATKNGGHALSTGMVGLLMSYALQVTNKLMWIVRMSVQLETNIVSVERIVEYCD 1265

Query: 424  RVPSIKPTTGK----KFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGP 479
              P   P        K  P +G I FK+ +  Y      V+ R +D++I     + +VG 
Sbjct: 1266 LPPEAPPVIEDSRPPKNWPSQGLIRFKNYSTRYRANLDPVL-RHLDLEIKPQEKIGIVGR 1324

Query: 480  SGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNI 539
            +G GKST++L L R   PS G I IDG DISK+ +K LR ++ ++ Q+     GT+R N+
Sbjct: 1325 TGAGKSTLSLALFRILEPSEGTIDIDGVDISKIGLKDLRSNLSIIPQDAQAFEGTVRTNL 1384

Query: 540  TYGLTETPSKEEIRMVAKQCFCHNFIVKFPHG----------YDTVIGPQGALLSGGQKQ 589
                 E  S EEI    +       I+K                T I   G+ LS GQ+Q
Sbjct: 1385 --DPFEQYSDEEIWKALELSHLKPHILKMAKDDADPEKKEDLLQTKISENGSNLSVGQRQ 1442

Query: 590  RIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRS 649
             + ++RAL+ +  ILVLDEAT+A+D E++  I  T     K +  TI++IAHR+ T+  S
Sbjct: 1443 LLCLSRALLNRSRILVLDEATAAVDSETDRLIQETIRAEFKDR--TILTIAHRIDTVMDS 1500

Query: 650  ENIIVLGNDGSVVETGKFKELFA 672
            + I+VL + G V E      L A
Sbjct: 1501 DKIMVL-DKGEVKEFDSPSNLLA 1522

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/220 (28%), Positives = 114/220 (51%), Gaps = 21/220 (9%)

Query: 459 VIFRDMD-IKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLN--IK 515
           V  +++D  ++  G  VCVVG  G GKST    LL       GQ+       S  +  + 
Sbjct: 641 VALKNIDGFQVFKGQLVCVVGRVGAGKSTFLQALL-------GQLPCISNSPSHASPTVH 693

Query: 516 SLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTV 575
                + L  Q+  +M+ +++DN+ +G     +  +  + A Q      I+    G +T+
Sbjct: 694 FRANSVALCSQQSWIMNASVKDNVLFGHRFDEATYKATLEACQLVPDLEIL--ADGDETL 751

Query: 576 IGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVES-----EGAINYTFGQLMK 630
           +G +G  LSGGQK R+++ARA+  +  + +LD+  SA+D E      E  ++   G L+K
Sbjct: 752 VGEKGISLSGGQKARLSLARAVYSRSDVYLLDDILSAVDAEVCKRIIEQVLSKKTG-LLK 810

Query: 631 SKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKEL 670
           +K+V + +  + +S ++ S++I  L  DG +VE+G F ++
Sbjct: 811 NKTVILTT--NSISVLKHSQSIYAL-EDGEIVESGSFNDI 847

>CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {ON}
            highly similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281w YOR1 ATP-binding cassette transporter protein
          Length = 1477

 Score =  139 bits (349), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 91/254 (35%), Positives = 139/254 (54%), Gaps = 25/254 (9%)

Query: 438  PGKGEIVFKDVTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYN 496
            P  GE++F+DV+F+Y  RPG   + +++++ I  G  + + G +G GKSTI   L R   
Sbjct: 1209 PTNGEVIFEDVSFAY--RPGLPTVLKNVNLSIAGGEKIGICGRTGAGKSTIMTALYRLNE 1266

Query: 497  PSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDN----------------IT 540
             +SG+IFIDG D  KL +  LRR + ++ Q+PVL  GT+R N                I 
Sbjct: 1267 LTSGRIFIDGIDTFKLGLYDLRRKLSIIPQDPVLFRGTIRKNLDPFNEFSDDSLWNSLIR 1326

Query: 541  YGLTETPSKEEIRMVA-KQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIK 599
             G  E    E+I+     +   +N + KF    D ++   GA  S G++Q +A+ RAL++
Sbjct: 1327 GGAIEKDDLEDIKHQKPDKNGSYNNMHKF--HLDQIVEEDGANFSLGERQVLALTRALVR 1384

Query: 600  KPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDG 659
            +  IL+LDEATS++D E++G I        + +  TI+ IAHRL TI   + I+VL   G
Sbjct: 1385 QSKILILDEATSSVDYETDGKIQTRIAT--EFQDCTILCIAHRLKTILNYDRILVL-EKG 1441

Query: 660  SVVETGKFKELFAD 673
             V E  K + LF +
Sbjct: 1442 EVAEFDKPEILFNN 1455

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 66/212 (31%), Positives = 114/212 (53%), Gaps = 22/212 (10%)

Query: 461 FRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRH 520
           F +++ +I  G  + + GP G GKS++   +  F   ++G++ I+G             H
Sbjct: 617 FSNLNFEIKKGEFIMITGPIGTGKSSLLNAMAGFMPQTTGELDING-------------H 663

Query: 521 IGLVQQEPVLMSGTLRDNITYGLTETP-SKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQ 579
           + L+   P + + T+RDNI +G   +P  +E+ + V + C     I   P G  T IG +
Sbjct: 664 M-LLCGYPWIQNATVRDNIIFG---SPYDREKYKEVIRVCSLQADIDILPAGDMTEIGER 719

Query: 580 GALLSGGQKQRIAIARALIKKPTILVLDEATSALDVE-SEGAINYTFGQLMKSKSVTIVS 638
           G  LSGGQK RI +AR++ K   I + D+  SA+D    +  ++  F Q ++SK+  + +
Sbjct: 720 GITLSGGQKARINLARSVYKNKDIYLFDDVLSAVDSRVGKHIMDECFLQTLQSKTRILAT 779

Query: 639 IAHRLSTIRRSENIIVLGNDGSVVETGKFKEL 670
             H+LS I +++ +IVL  +GS V+ G  +EL
Sbjct: 780 --HQLSLIEKADRVIVLSTNGS-VDIGTVEEL 808

>KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1442

 Score =  138 bits (348), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 101/285 (35%), Positives = 149/285 (52%), Gaps = 37/285 (12%)

Query: 412  VGAATRL-FELTDRVPSIKPTTGKKFVPGKGEIVFKDVTFSYPTRPG-NVIFRDMDIKIP 469
            V  AT L  E   R P + P       P KG+I F DV F+Y  RPG  V+ ++M++KI 
Sbjct: 1150 VTYATELPLEAAYRKPEVSPPES---WPEKGDIDFIDVNFAY--RPGLPVVLKNMNLKIN 1204

Query: 470  AGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPV 529
             G  + + G +G GKSTI   L R    S G+I IDG DI K+ +  LR+ + ++ Q+PV
Sbjct: 1205 NGEKIGICGRTGAGKSTIMSALYRLNELSDGKIVIDGVDIRKIGLYDLRKKLTIIPQDPV 1264

Query: 530  LMSGTLRDN----------------ITYGLTETPSKEEIRMVA-KQCFCHNFIVKFPHGY 572
            L  GT+R N                I  G+ E  +  +I++    +   ++ + KF    
Sbjct: 1265 LFRGTIRKNLDPFKECSDDLLWDALIRTGVVERENLNDIKLEKPDENNSYSNMHKF--HL 1322

Query: 573  DTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAIN----YTFGQL 628
            D ++  +G+  S G++Q +A+ RAL++   IL+LDEATS++D E++G I       FG  
Sbjct: 1323 DELVEEEGSNFSLGERQMLALTRALVRNSKILILDEATSSVDYETDGKIQSRIVSEFGD- 1381

Query: 629  MKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFAD 673
                  TI+ IAHRL TI   + I+VL   G + E  K  ELF D
Sbjct: 1382 -----CTILCIAHRLKTILSYDKILVL-EKGVIAEYEKPWELFND 1420

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 110/212 (51%), Gaps = 22/212 (10%)

Query: 461 FRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRH 520
           F D++++I  G  + V GP G GK+++   +  F   +SG++ ++G+             
Sbjct: 581 FTDLNLEIFKGEFIIVTGPIGTGKTSLLNAMAGFMKQTSGRVEVNGE------------- 627

Query: 521 IGLVQQEPVLMSGTLRDNITYGLTETPSKE-EIRMVAKQCFCHNFIVKFPHGYDTVIGPQ 579
             L+   P +++ T+RDNI +G   +P +E     + + C     +   P G  T IG +
Sbjct: 628 -LLLCGYPWILNATVRDNILFG---SPYEEARYNEIVEVCSLDADLKILPAGDRTEIGER 683

Query: 580 GALLSGGQKQRIAIARALIKKPTILVLDEATSALDVE-SEGAINYTFGQLMKSKSVTIVS 638
           G  LSGGQK RI +ARA+ K   I + D+  SA+D    +  ++     ++K K+  + +
Sbjct: 684 GITLSGGQKARINLARAVYKNKDIFLFDDVLSAVDSRVGKHIMDDCLLGILKGKTRILAT 743

Query: 639 IAHRLSTIRRSENIIVLGNDGSVVETGKFKEL 670
             H+LS I R++ IIV+G +GS  + G   EL
Sbjct: 744 --HQLSVIERADRIIVVGPNGS-FDFGTLDEL 772

>TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4.6
            YHL035C
          Length = 1691

 Score =  137 bits (345), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 127/508 (25%), Positives = 225/508 (44%), Gaps = 72/508 (14%)

Query: 199  RLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXX 258
            ++  +++K ++H    FFD   +G +++R   D   V + +   +   F  L+       
Sbjct: 1169 KMFNSLLKNSLHAKLRFFDSTPLGRIMNRFSKDIEAVDQEVPMYLGGTFACLVECFSIIV 1228

Query: 259  XXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQ 318
                I+PQ  G+ +       F  +++    R+           + +   E L+G+ TV+
Sbjct: 1229 LITLITPQFLGVAIFIAVFYWFVGAVYISGSRELKRFDSITKSPIYQHFSETLAGITTVR 1288

Query: 319  SFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVL-QG 377
            ++  E + +      I +           N  FF    S   +SF   +  G++++L  G
Sbjct: 1289 AYGDESRFMRENLEKIDEN----------NKPFFYMWVSNRWLSFRTQII-GAFVILGAG 1337

Query: 378  GLTIGDLTAF--------MLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELT--DRVP- 426
            G +I ++           + Y      +   L  FY +    + +  R+ E    D+ P 
Sbjct: 1338 GFSIWNINKIDSGLAGISLTYALTFSDAALWLVRFYGDTEMNMNSTERIQEYMNIDQEPY 1397

Query: 427  ---SIKPTTGKKFVPGKGEIVFKDVTFSY-PTRPGNVIFRDMDIKIPAGSNVCVVGPSGR 482
               +++P       P  G+I   DV+  Y P  P   + +++   + + S V +VG +G 
Sbjct: 1398 NEGTVEPPAD---WPENGKIEINDVSLRYAPNLPR--VIKNVSFTVDSKSKVGIVGRTGA 1452

Query: 483  GKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYG 542
            GKSTI   L RF  P +G I ID  DI  ++++ LRR I ++ Q+P L +GT+R N+   
Sbjct: 1453 GKSTIITALFRFLEPETGNIKIDNIDIVSIDLQKLRRSISIIPQDPTLFTGTIRSNLD-P 1511

Query: 543  LTETPSKEEIRMVAKQCFCHNFI-------VKFPHGYDTV----------------IGPQ 579
             T+   KE    +     C N +       V+ P   DT                 +   
Sbjct: 1512 YTQYSDKE----IFDSLICVNLVSREELAQVQSPSSNDTSSIVSENFNHFLDLEYNVSEG 1567

Query: 580  GALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYT----FGQLMKSKSVT 635
            G+ +S GQ+Q + +AR+L+ KP I++LDEAT+++D ES+  I  T    FG      + T
Sbjct: 1568 GSNISQGQRQLLCLARSLLGKPKIILLDEATASIDYESDKKIQETIRNEFG------NST 1621

Query: 636  IVSIAHRLSTIRRSENIIVLGNDGSVVE 663
            I++IAHRL ++   + I+V+  D   VE
Sbjct: 1622 ILTIAHRLRSVIDYDKILVM--DAGEVE 1647

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 78/255 (30%), Positives = 127/255 (49%), Gaps = 17/255 (6%)

Query: 423 DRVPSI--KPTTGKKF----VP-GKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVC 475
           DRV +   +P T KK+    VP  K ++ FK+ T S+     +   R++DI    G    
Sbjct: 732 DRVQTFLDEPDT-KKYEQLTVPVEKNKLSFKNATMSWGNDNDSFKLRNLDIDFKIGQLNV 790

Query: 476 VVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRH---IGLVQQEPVLMS 532
           V+GP+G GK+++ + LL     + GQI I   D     I     H   I    Q   L++
Sbjct: 791 VIGPTGSGKTSLLMALLGEMTLTEGQINIPSLDPRHDLIIESDGHTNSIAYCSQAAWLLN 850

Query: 533 GTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIA 592
            T+R+NI +       + +  +VA      +F +    G  T IG +G  LSGGQKQRI+
Sbjct: 851 DTVRNNILFNSPYNKDRYDAAIVAAG-LKRDFEI-LAAGDLTEIGERGITLSGGQKQRIS 908

Query: 593 IARALIKKPTILVLDEATSALDVESEGAI--NYTFGQLMKSKSVTIVSIAHRLSTIRRSE 650
           +ARAL      ++LD+  SA+D  +   I  N   G LM+ ++  +VS  H ++   ++ 
Sbjct: 909 LARALYSNARHVLLDDCLSAVDAHTAAWIYDNCISGPLMEGRTCVLVS--HNIALTLKNA 966

Query: 651 NIIVLGNDGSVVETG 665
           +++V+  +G V + G
Sbjct: 967 SLVVMLKNGRVADQG 981

>KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_5.10
            YGR281W
          Length = 1457

 Score =  136 bits (343), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 99/282 (35%), Positives = 153/282 (54%), Gaps = 31/282 (10%)

Query: 412  VGAATRL-FELTDRVPSIKPTTGKKFVPGKGEIVFKDVTFSYPTRPG-NVIFRDMDIKIP 469
            V  AT+L  E   + P + P       P KGEI F DV F+Y  R G  V+ + +++ I 
Sbjct: 1164 VNYATKLPLEAAYKKPELSPPES---WPSKGEIRFLDVDFAY--RSGLPVVLKGLNLDIK 1218

Query: 470  AGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPV 529
            +G  + + G +G GKSTI   L R    +SG+I ID  DIS L +  LRR + ++ Q+PV
Sbjct: 1219 SGEKIGICGRTGAGKSTIMSALYRLNELTSGKILIDDVDISTLGLYDLRRKLSIIPQDPV 1278

Query: 530  LMSGTLRDN----------------ITYGLTETPSKEEIR--MVAKQCFCHNFIVKFPHG 571
            L  GT+R N                I  G  E  S E+++  MV ++   H  + KF   
Sbjct: 1279 LFKGTIRKNLDPFSNYDDSLLWDALIRSGAIEKESVEKVKSEMVNEEG-THTDMHKF--H 1335

Query: 572  YDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKS 631
             D ++  +G+  S G++Q +A+ RAL+++  IL+LDEATS++D E++G I     +  + 
Sbjct: 1336 LDQLVEEEGSNFSLGERQVLALTRALVRQSKILILDEATSSVDYETDGKIQKRIVE--EF 1393

Query: 632  KSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFAD 673
             + TI+ IAHRL TI + + I+VL   G + E  +  +LF+D
Sbjct: 1394 DNCTILCIAHRLKTILQYDRILVL-EKGVIAEFDQPFKLFSD 1434

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 67/212 (31%), Positives = 108/212 (50%), Gaps = 22/212 (10%)

Query: 461 FRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRH 520
           F ++D +I  G  + + GP G GKS++      F N + G+I ++G D+           
Sbjct: 588 FSNLDFEIRKGEFIMITGPIGTGKSSLLNAFAGFMNKTEGRIQVNG-DL----------- 635

Query: 521 IGLVQQEPVLMSGTLRDNITYGLTETPS-KEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQ 579
             L    P + + T++DNI +G   +P  KE+   V + C     +   P G  T IG +
Sbjct: 636 --LFCGYPWIQNATVKDNILFG---SPFIKEKYENVLRVCSLDADLKVLPAGDKTEIGER 690

Query: 580 GALLSGGQKQRIAIARALIKKPTILVLDEATSALDVE-SEGAINYTFGQLMKSKSVTIVS 638
           G  LSGGQK RI +ARA+ K   I + D+  SA+D    +  ++     L++ K+  + +
Sbjct: 691 GINLSGGQKARINLARAVYKTKDIFLFDDVLSAVDSRVGKHIMDECLLDLLEGKTRILAT 750

Query: 639 IAHRLSTIRRSENIIVLGNDGSVVETGKFKEL 670
             H+LS I +++ +IVLG DGS  + G   EL
Sbjct: 751 --HQLSLIEKADRVIVLGTDGS-FDIGTVDEL 779

>NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {ON}
            Anc_8.303
          Length = 1512

 Score =  136 bits (343), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 126/471 (26%), Positives = 223/471 (47%), Gaps = 23/471 (4%)

Query: 215  FFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLF 274
            FF+   +G +++R  +D Y V   + +  S  F   +            + Q   +++  
Sbjct: 1038 FFETTPIGRILNRFSNDVYKVDSVLGRTFSQFFVNAVKVSFTIIVICFTTWQFIFIIIPL 1097

Query: 275  TPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAI 334
                ++    F R  R+           +    +E L G+ T++ +    ++ HR++H  
Sbjct: 1098 GVFYIYYQQYFLRTSRELRRLDSITKSPIFSHFQETLGGITTIRGY----QQQHRFTHIN 1153

Query: 335  RDIFNVGKRAAY--INAQFFTATSSLGDISFLVVLAYGSYLVL---QGGLTIGDLTAFML 389
            +   +    A Y  +NA  + A   L  I  L++L   +  V    QG LT G +   + 
Sbjct: 1154 QCRVDNNMSAFYPSVNANRWLA-YRLETIGSLIILGAATLSVFRLRQGTLTAGMVGLSLS 1212

Query: 390  YTEYTGSSVFGLTSFYSELMQGVGAATRLFELTD---RVPS-IKPTTGKKFVPGKGEIVF 445
            Y      S+  +     E+   + +  R+ E +D     P+ I+     +  P +G+I F
Sbjct: 1213 YALQITQSLNWIVRMTVEVETNIVSVERIKEYSDLKSEAPAVIEDHRPAETWPDEGDIKF 1272

Query: 446  KDVTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFI 504
            +  +  Y  RP  ++I +D+++ I     V +VG +G GKS++ L L R    SSG+I I
Sbjct: 1273 EHYSTRY--RPELDLILKDINVHIKPKEKVGIVGRTGAGKSSLTLALFRIIEASSGRIVI 1330

Query: 505  DGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNF 564
            D   I+++ +  LR  + ++ Q+  +  GT+R+NI    T   + E+I  V       + 
Sbjct: 1331 DNVPINEIGLYDLRHKLSIIPQDSQVFEGTVRENI--DPTNEYTDEQIWNVLALSHLKDH 1388

Query: 565  IVKF-PHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINY 623
            I+     G +  +   G  LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++  I  
Sbjct: 1389 IISMGDEGLNNQLTEGGNNLSVGQRQLLCLARALLVPSKILLLDEATAAVDVETDKVIQE 1448

Query: 624  TFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADP 674
            T     K +  TI++IAHR++TI  S+ IIVL N G++ E    ++L  +P
Sbjct: 1449 TIRTAFKDR--TILTIAHRINTIMDSDRIIVLDN-GTIKEFDSPEKLLENP 1496

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 58/239 (24%), Positives = 111/239 (46%), Gaps = 38/239 (15%)

Query: 447 DVTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIF-I 504
           D TF +  +P   V  ++++ +   G   C+VG  G GKS +   +L       G +F +
Sbjct: 628 DATFLWQRKPEYKVALKNINFQAKKGELTCIVGKVGSGKSAMIQSIL-------GDLFRV 680

Query: 505 DGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNF 564
            G         ++  ++  V Q   +M+GT+++NI +G      ++  +   K C     
Sbjct: 681 KG-------FATIHGNVAYVSQVAWIMNGTVKENILFG--HKYDEDFYQKTIKACALTID 731

Query: 565 IVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALD---------- 614
           +     G  T++G +G  LSGGQK R+++ARA+  +    +LD+  +A+D          
Sbjct: 732 LAVLMDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLVEH 791

Query: 615 VESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFAD 673
           V     + +T  +++ +  V+++SIA  +S          L  +G +V+ G + E+  D
Sbjct: 792 VLGPNGLLHTKTKVLATNKVSVLSIADSVS----------LLENGEIVQQGTYDEIMKD 840

>KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1546

 Score =  136 bits (342), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 144/536 (26%), Positives = 235/536 (43%), Gaps = 49/536 (9%)

Query: 167  FLGGFAALMVFGIVANYGR-IVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVGDLI 225
            F+G +  + +     N  R IVLL + S R   +L  ++    +     FF+   VG +I
Sbjct: 1016 FVGIYVLISLGAAFFNSARSIVLLLVCSIRASRKLHDSMAVAVLRSPMSFFETTPVGRII 1075

Query: 226  SRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGL---LLLFTPPVLFSA 282
            +R  SD           V D  + +I           +   + G    L L     L   
Sbjct: 1076 NRFSSD--------MNSVDDNVQYVISFFLISILDYVVVVVIIGYQVPLFLLVNAALLGI 1127

Query: 283  SIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQS-FVAEQKEIHRYSHAIR-DIFNV 340
             ++ +    T       + +L R+     S + ++ S  +A    I+ ++H  R D  N+
Sbjct: 1128 YLYYQVFYVT------LSRELKRLMSTSFSPIMSMLSETLAGHMVINAFNHFSRFDYLNI 1181

Query: 341  GKRAAYINAQF-FTATSS-----LGDISFLVVL--AYGSYLVLQG--GLTIGDLTAFMLY 390
                  IN  F F +T+      L  I  L++L  A  S     G   L+ G +   M Y
Sbjct: 1182 EAVQFNINCVFNFRSTNRWLSIRLESIGALMILTTALLSLATTTGDKALSTGMVGLLMSY 1241

Query: 391  TEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTG----KKFVPGKGEIVFK 446
                 + +  +     +L   V +  R+ E  D  P   P       +K  P +G +VFK
Sbjct: 1242 ALQVTNKLMWIVRMSVQLETNVVSVERIVEYCDLPPEAPPVIEDCRPEKNWPAQGHVVFK 1301

Query: 447  DVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDG 506
            D +  Y      V+ + ++++I     + +VG +G GKST++L L R   P  G I IDG
Sbjct: 1302 DYSARYRENLDPVL-KKLNVEINPQEKIGIVGRTGAGKSTLSLALFRILEPCGGTIVIDG 1360

Query: 507  QDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIV 566
             DI+K+ +  LR H+ ++ Q+     G++R N+     E  S +EI    +       I+
Sbjct: 1361 VDITKIGLADLRSHLSIIPQDAQAFEGSVRSNL--DPFEQYSDDEIWRALELSHLKPHIL 1418

Query: 567  KFPHG---------YDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVES 617
            K  +           +T I   G+ LS GQ+Q + ++RAL+ +  ILVLDEAT+A+D E+
Sbjct: 1419 KMANEEGPEKTKNLLETKISENGSNLSVGQRQLLCLSRALLNRSRILVLDEATAAVDSET 1478

Query: 618  EGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFAD 673
            +  I  T     K +  TI++IAHR+ T+  S+ I+VL + G V E      L AD
Sbjct: 1479 DRLIQETIRAEFKDR--TILTIAHRIDTVMDSDKIMVL-DQGEVKEFDSPSNLLAD 1531

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 109/210 (51%), Gaps = 22/210 (10%)

Query: 471 GSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFI----DGQDISKLNIKSLRRHIGLVQQ 526
           G  VCVVG  G GKST    LL       GQ+        Q   K++ +     + L  Q
Sbjct: 663 GQLVCVVGRVGAGKSTFLHALL-------GQLPCISSSHDQATPKMHFRC--DSVALCSQ 713

Query: 527 EPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGG 586
           +  +++ +++ N+ +G     +  +  + A Q      I+    G +T++G +G  LSGG
Sbjct: 714 QAWILNASVKYNVLFGHKYDEASYKATIEACQLLPDLGIL--ADGDETLVGEKGISLSGG 771

Query: 587 QKQRIAIARALIKKPTILVLDEATSALDVE-SEGAINYTFGQ---LMKSKSVTIVSIAHR 642
           QK RI++ARA+  +  + +LD+  SA+D E  +  I++   +   L+K+K+V + +  + 
Sbjct: 772 QKARISLARAVYSRSDVYLLDDILSAVDAEVCKRIIDHVLSRKTGLLKNKTVILTT--NS 829

Query: 643 LSTIRRSENIIVLGNDGSVVETGKFKELFA 672
           +S ++ S++I  L N G +VE G F E+ +
Sbjct: 830 ISVLKHSQSIYALEN-GEIVERGSFDEIMS 858

>NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {ON} 
          Length = 1654

 Score =  135 bits (340), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 131/527 (24%), Positives = 238/527 (45%), Gaps = 49/527 (9%)

Query: 163  SIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVG 222
            SIY FL G A  ++  +     ++++   L  +   ++  +++KK +H    FFD   +G
Sbjct: 1110 SIY-FLIGIAQALLGSL-----KVLINFFLGVKASRKIFIDLLKKVMHSKLRFFDSTPIG 1163

Query: 223  DLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSA 282
             +++R   D   + + +   V   F +L+           I+PQ   + +L T       
Sbjct: 1164 RIMNRFSKDIEAIDQELAPVVQGAFYSLVSCVTTILLITFITPQFLSVAILVTGLYYLIG 1223

Query: 283  SIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAE----QKEIHRYSHAIRDIF 338
              +    R+           + +   E L GV T+++F  E    Q+ + +     R  F
Sbjct: 1224 YFYLAASREFKRFDSITKSPIYQHFSETLVGVTTIRAFGDEGRFMQENLSKIDENNRPFF 1283

Query: 339  NVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLV-----LQGGLTIGDLTAFMLYTEY 393
             +     +++ +       +  +  LVV   GS+++     +  G+    LT  + +TE 
Sbjct: 1284 YLWVANRWLSFR-------IDMVGALVVFGSGSFIIWNIKNIDAGMAGISLTYAISFTE- 1335

Query: 394  TGSSVFGLTSFYSELMQGVGAATRLFELT--DRVPSIKPT-TGKKFVPGKGEIVFKDVTF 450
                   L   YS +   + +  RL E    ++ P    T T     P +G+I   D++ 
Sbjct: 1336 ---GALWLVRLYSNVEMNMNSVERLKEYMKIEQEPYEDATCTPPPEWPQEGKIEVCDLSL 1392

Query: 451  SYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDIS 510
             Y      VI +++   +   + + +VG +G GKSTI   L RF +P +G I ID  DI+
Sbjct: 1393 RYAEGLPRVI-KNVTFTVAPKAKIGIVGRTGAGKSTIITALFRFLDPETGYIKIDNIDIT 1451

Query: 511  KLNIKSLRRHIGLVQQEPVLMSGTLRDNIT-YG-------------LTETPSKEEIRMVA 556
             +N+  LRR I ++ Q+P L +GT++ N+  YG             +   P      +  
Sbjct: 1452 SINLNKLRRSINIIPQDPTLFTGTIKSNLDPYGEYSDEDMFTALRRVNLVPEDVSSNIET 1511

Query: 557  KQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVE 616
            +     N + KF +  +  I   G+ LS GQ+Q + +AR+L++ P I++LDEAT+++D  
Sbjct: 1512 ESISSQN-VNKFLN-LNNEISEGGSNLSQGQRQLVCLARSLLRSPKIMLLDEATASIDYN 1569

Query: 617  SEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVE 663
            S+  I  T  +   S   TI++IAHRL ++   + I+V+ + G V E
Sbjct: 1570 SDAKIQETIRKEFNSS--TILTIAHRLRSVIDYDKILVM-DAGEVKE 1613

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 66/240 (27%), Positives = 116/240 (48%), Gaps = 11/240 (4%)

Query: 438 PGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNP 497
           P   ++ FK+ T S+ +   +   +D++I    G    V+GP+G GK+++ + LL     
Sbjct: 704 PQGDQLEFKNTTVSWDSSAQDFKLKDLNIDFKIGKLNVVIGPTGSGKTSLLMALLGEMKI 763

Query: 498 SSGQIFI---DGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKE-EIR 553
             G+I +   D ++   ++       I    Q   L++ T+R+NI +    +P  E    
Sbjct: 764 MEGEIIVPSLDPREDLVVDENGTTNSIAYCSQAAWLLNDTVRNNILFN---SPYNEARYT 820

Query: 554 MVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSAL 613
            V + C           G  T IG +G  LSGGQKQR+++ARA+      ++LD+  SA+
Sbjct: 821 SVIEACGLKRDFEILKAGDMTEIGEKGITLSGGQKQRVSLARAMYSNSRHILLDDCLSAV 880

Query: 614 DVESEGAI--NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELF 671
           D  +   I  N   G LM  ++  +VS  H ++   ++ +++V+  DG V + G   EL 
Sbjct: 881 DSHTALWIYDNCITGPLMDGRTCILVS--HNIALTLKNADLVVILEDGKVKDQGDPMELL 938

>Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  134 bits (337), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 135/513 (26%), Positives = 241/513 (46%), Gaps = 32/513 (6%)

Query: 167  FLGGFAALMVFGIVANYGRIVLLRILSERVVARLRANVIKKTI-HQDSEFFDRHKVGDLI 225
            +LG + AL +   +A   + ++L +      ++   N++  ++      FF+   +G ++
Sbjct: 992  YLGIYFALGIGSALATLIQTIVLWVFCTIHASKYLHNLMTNSVLRAPMTFFETTPIGRIL 1051

Query: 226  SRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIF 285
            +R  +D Y V   + +  S  F   +            + Q    + +  P  +F     
Sbjct: 1052 NRFSNDIYKVDALLGRTFSQFFVNAVKVTFTITVICVTTWQF---IFIIVPLGVFYIYYQ 1108

Query: 286  GRKIRDTSTDLQEATGQLTRVS-----EEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNV 340
               +R TS +L+     +TR       +E L G+ TV+ + ++QK   R+SH  +   + 
Sbjct: 1109 QYYLR-TSRELRR-LDSITRSPIYSHFQETLGGLATVRGY-SQQK---RFSHINQCRIDN 1162

Query: 341  GKRAAY--INAQFFTAT--SSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGS 396
               A Y  +NA  + A     +G +  L       + + QG LT G +   + Y      
Sbjct: 1163 NMSAFYPSVNANRWLAYRLELIGSVIILGAATLSVFRLKQGTLTAGMVGLSLSYALQITQ 1222

Query: 397  SVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGK-----KFVPGKGEIVFKDVTFS 451
            ++  +     E+   + +  R+ E  D + S  P   +     K  PG+G+I F   +  
Sbjct: 1223 TLNWIVRMTVEVETNIVSVERIKEYAD-IKSEAPLVIEGHRPPKEWPGQGDIKFNQYSTR 1281

Query: 452  YPTRPG-NVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDIS 510
            Y  RP  +++ + +DI I     + +VG +G GKS++ L L R    S+G I IDG  I+
Sbjct: 1282 Y--RPELDLVLKQIDIHIKPKEKIGIVGRTGAGKSSLTLALFRIIEASAGNIVIDGIPIN 1339

Query: 511  KLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPH 570
            ++ +  LR  + ++ Q+  +  GT+R+NI   + +   +   R +       + +     
Sbjct: 1340 EIGLYDLRHKLSIIPQDSQVFEGTVRENID-PINQYTDEAMWRALELSHLKEHILSMSND 1398

Query: 571  GYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMK 630
            G D+ +   G+ LS GQ+Q + +ARA++ +  ILVLDEAT+A+DVE++  I  T     K
Sbjct: 1399 GLDSQLTEGGSNLSVGQRQLLCLARAMLVQSKILVLDEATAAVDVETDKVIQETIRTAFK 1458

Query: 631  SKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVE 663
             +  TI++IAHRL+TI  S+ IIVL N G V E
Sbjct: 1459 DR--TILTIAHRLNTIMDSDRIIVLDN-GKVAE 1488

 Score = 74.3 bits (181), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 91/385 (23%), Positives = 172/385 (44%), Gaps = 40/385 (10%)

Query: 304 TRVSEEQLSGVRTVQSFVAEQK-----EIHRYSHAIRDIFNVGKRAAYINAQFFTATSSL 358
           TRV  E L+ +++++ +  E+      E  R +  + ++  +G   A  + QF      +
Sbjct: 485 TRVISEILNNIKSLKLYAWEKPYREKLEDVRNNKELNNLTKLGCYMAVTSFQFNIVPFLV 544

Query: 359 GDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRL 418
              +F  V  Y     L   L    LT F L +         L SF    ++   +  RL
Sbjct: 545 SCCTF-AVFVYTEDRALTTDLVFPALTLFNLLSFPLMIIPMVLNSF----IEASVSIGRL 599

Query: 419 FELTDRVPSIKPTTGKKF--VPGKGEIVFK---DVTFSYPTRPG-NVIFRDMDIKIPAGS 472
           F        ++P + ++   V   G+I      D TF +  +P   V  ++++ +   G 
Sbjct: 600 FSFFTN-EELQPDSVQRLPKVENVGDIAINIGDDATFLWQRKPEYKVALKNINFQAKKGE 658

Query: 473 NVCVVGPSGRGKSTIALLLLRFYNPSSGQIF-IDGQDISKLNIKSLRRHIGLVQQEPVLM 531
             CVVG  G GK+  ALL     + + G +F + G         S+   +  V Q P +M
Sbjct: 659 LTCVVGKVGSGKT--ALL-----SSTLGDLFRVKG-------FASVHGSVAYVSQVPWIM 704

Query: 532 SGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRI 591
           +GT+++NI +G       E      K C     +     G  T++G +G  LSGGQK R+
Sbjct: 705 NGTVKENILFG--HKYDAEFYEKTIKACALTIDLAILMDGDQTLVGEKGISLSGGQKARL 762

Query: 592 AIARALIKKPTILVLDEATSALDVE-SEGAINYTFGQ--LMKSKSVTIVSIAHRLSTIRR 648
           ++ARA+  +    +LD+  +A+D   +   + +  G   L+ +K+  + +  +++S +  
Sbjct: 763 SLARAVYSRADTYLLDDPLAAVDEHVARHLVEHVLGSNGLLHTKTKLLAT--NKVSALSV 820

Query: 649 SENIIVLGNDGSVVETGKFKELFAD 673
           +++I +L N G +++ G + ++  D
Sbjct: 821 ADSIALLDN-GEIIQQGTYDDITKD 844

>NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10
          Length = 1506

 Score =  134 bits (337), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 150/563 (26%), Positives = 249/563 (44%), Gaps = 86/563 (15%)

Query: 156  PPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRANVIKKTIHQDSEF 215
            P  +MG  +Y F   F+ ++     + +  +  + +LS + +  LRA  +K+ +H    +
Sbjct: 963  PSFYMG--LYSFFVFFSYILT---TSQFTLLCCIGVLSSKWL-NLRA--VKRILHTPMSY 1014

Query: 216  FDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFK--------ALICXXXXXXXXXSISPQL 267
             D   +G +++R   D   +   +T+ V              ++C         +I    
Sbjct: 1015 LDTTPLGRILNRFTKDTDSLDNELTESVRMLLYQFANIVGVCIMCIIYLPWFAIAIPFLF 1074

Query: 268  SGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEI 327
             G +L+      + +S  GR+I+     +Q +   +     E L G+ T++S+ +E + I
Sbjct: 1075 VGFVLIADH---YQSS--GREIKRLEA-IQRSF--VYNNFNEVLGGMDTIKSYRSENRFI 1126

Query: 328  HRYSHAIRDIFNVG------KRAAYINAQFFTATSSLGDISFLVVLAYG----------S 371
             +    I  +   G      +R   I         +L      V  A+           +
Sbjct: 1127 AKSDFLIDKMNEAGYLVVAVQRWVAIFLDVIAVCFALIITLLCVTRAFPISAASVGVLLT 1186

Query: 372  YLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPT 431
            Y++   GL  G L + +  TE   +S   L ++ +EL           E   R P + P 
Sbjct: 1187 YVLQLPGLLNGVLRS-LTQTENDMNSAERLVTYATELP---------LEADYRKPEVSPP 1236

Query: 432  TGKKFVPGKGEIVFKDVTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALL 490
                  P KGEI F++V FSY  RPG   + +++ + I +G  + + G +G GKSTI   
Sbjct: 1237 EE---WPTKGEIHFENVDFSY--RPGLPTVLKNLSLDIKSGEKIGICGRTGAGKSTIMSA 1291

Query: 491  LLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDN------------ 538
            L R    SSG++ ID  DIS + +  LRR + ++ Q+PVL  GT+R N            
Sbjct: 1292 LYRLNEISSGKMIIDDVDISTIGLYDLRRKLAIIPQDPVLFRGTIRKNLDPFNEHQDEHL 1351

Query: 539  ----ITYGLTETPSKEEIRMVA-KQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAI 593
                +  G  E     EI+     +   H+ + KF    D ++  +GA  S G++Q +A+
Sbjct: 1352 WNALVRGGAIEQKELNEIKAQKPDEKGNHSEMYKF--HLDQLVEEEGANFSLGERQLLAL 1409

Query: 594  ARALIKKPTILVLDEATSALDVESEGAINY----TFGQLMKSKSVTIVSIAHRLSTIRRS 649
             RAL+++  IL+LDEATS++D E++G I       FG        TI+ IAHRL TI   
Sbjct: 1410 TRALVRQARILILDEATSSVDYETDGKIQARIVEEFGH------CTILCIAHRLKTILTY 1463

Query: 650  ENIIVLGNDGSVVETGKFKELFA 672
            + I+VL   G V E    K LFA
Sbjct: 1464 DRILVL-EKGEVAEFDTPKTLFA 1485

 Score = 94.0 bits (232), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 69/212 (32%), Positives = 114/212 (53%), Gaps = 22/212 (10%)

Query: 461 FRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRH 520
           F D++ +I  G  + +VGP G GK+++      F N  SG+I I+G D+           
Sbjct: 649 FHDLNFEIKKGEFIIMVGPIGTGKTSLLNAFAGFMNKVSGRIQING-DL----------- 696

Query: 521 IGLVQQEPVLMSGTLRDNITYGLTETP-SKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQ 579
             L+   P + + +++DNI +G   +P +K +   V + C   + +   P G  T IG +
Sbjct: 697 --LLCGYPWIQNASVKDNIIFG---SPYNKAKYDEVIRVCSLKSDLDILPAGDLTEIGER 751

Query: 580 GALLSGGQKQRIAIARALIKKPTILVLDEATSALDVE-SEGAINYTFGQLMKSKSVTIVS 638
           G  LSGGQK RI +AR++ K+  I + D+  SA+D    +  ++  F  L+K K+  + +
Sbjct: 752 GITLSGGQKARINLARSVYKQKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKDKTRILAT 811

Query: 639 IAHRLSTIRRSENIIVLGNDGSVVETGKFKEL 670
             H+LS + R+  +IVLGNDGS  + G  +EL
Sbjct: 812 --HQLSLLERASRVIVLGNDGS-FDIGTVEEL 840

>Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR281W
            (REAL)
          Length = 1477

 Score =  134 bits (336), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 95/269 (35%), Positives = 141/269 (52%), Gaps = 25/269 (9%)

Query: 412  VGAATRL-FELTDRVPSIKPTTGKKFVPGKGEIVFKDVTFSYPTRPG-NVIFRDMDIKIP 469
            V  AT L  E   R P + P       P KGEIV ++V FSY  RPG  V+ +++++ I 
Sbjct: 1184 VSYATELPLEADYRKPEMTPPES---WPSKGEIVLENVCFSY--RPGLPVVLKNLNLNIE 1238

Query: 470  AGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPV 529
            +G  + + G +G GKSTI   L R    S+G+I ID  DISKL +  LRR + ++ Q+PV
Sbjct: 1239 SGEKIGICGRTGAGKSTIMSALYRLNELSAGKILIDDVDISKLGLFDLRRKLAIIPQDPV 1298

Query: 530  LMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFP---------HG------YDT 574
            L  GT+R N+      T  +    +V       N + +           HG       D 
Sbjct: 1299 LFRGTIRKNLDPFDERTDDELWDALVRGGAIAKNDLSEAKLQKPDKNGTHGRMHKFHLDQ 1358

Query: 575  VIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSV 634
             +  +G+  S G++Q +A+ RAL+++  IL+LDEATS++D E++G I     +  +    
Sbjct: 1359 AVEEEGSNFSLGERQLLALTRALVRQSKILILDEATSSVDYETDGKIQARIVE--EFGDC 1416

Query: 635  TIVSIAHRLSTIRRSENIIVLGNDGSVVE 663
            TI+ IAHRL TI   + I+VL   G V E
Sbjct: 1417 TILCIAHRLQTIVNYDRILVL-EKGEVAE 1444

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 65/214 (30%), Positives = 109/214 (50%), Gaps = 22/214 (10%)

Query: 461 FRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRH 520
           F+D++ +I  G  + + GP G GKS++   +      + G+I ++G D+           
Sbjct: 604 FKDLNFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEVNG-DL----------- 651

Query: 521 IGLVQQEPVLMSGTLRDNITYGLTETPS-KEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQ 579
             L+   P + +  +RDNI +G   +P  KE+   V + C     +   P G  T IG +
Sbjct: 652 --LMCGYPWIQNAPVRDNIIFG---SPFIKEKYNEVIRVCSLKADLDILPAGDMTEIGER 706

Query: 580 GALLSGGQKQRIAIARALIKKPTILVLDEATSALDVE-SEGAINYTFGQLMKSKSVTIVS 638
           G  LSGGQK RI +AR++ K+  I + D+  SA+D    +  ++     ++ +K+  + +
Sbjct: 707 GITLSGGQKARINLARSVYKRKEIYLFDDVLSAVDSRVGKHIMDECLTGMLANKTRILAT 766

Query: 639 IAHRLSTIRRSENIIVLGNDGSVVETGKFKELFA 672
             H+LS I R+  +IVLG DG  V+ G   EL A
Sbjct: 767 --HQLSLIERASRVIVLGTDGQ-VDIGTVDELKA 797

>Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON}
            YGR281W (REAL)
          Length = 1477

 Score =  133 bits (335), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 96/281 (34%), Positives = 148/281 (52%), Gaps = 31/281 (11%)

Query: 412  VGAATRL-FELTDRVPSIKPTTGKKFVPGKGEIVFKDVTFSYPTRPG-NVIFRDMDIKIP 469
            V  AT+L  E   R P + P       P KG+IVF++V F+Y  RPG  ++ ++ ++ I 
Sbjct: 1184 VSYATKLPLEADYRKPEMTPPES---WPSKGKIVFENVDFAY--RPGLPIVLKNFNLDIK 1238

Query: 470  AGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPV 529
            +G  + + G +G GKSTI   L R    ++GQIFID  DIS+L +  LR+ + ++ Q+PV
Sbjct: 1239 SGEKIGICGRTGAGKSTIMSALYRLNELTAGQIFIDDVDISQLGLFDLRKKLAIIPQDPV 1298

Query: 530  LMSGTLRDNITYGLTETPSKE-----------------EIRMVA-KQCFCHNFIVKFPHG 571
            L  GT+R N+     E    E                 E+R+    +   H  + KF   
Sbjct: 1299 LFRGTIRKNLD-PFDERTDDELWDALVRGGAIAKNDLPEVRLQKPDENGTHGRMHKF--H 1355

Query: 572  YDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKS 631
             D  +  +G+  S G++Q +A+ RAL+++  IL+LDEATS++D E++G I     +  + 
Sbjct: 1356 LDQAVEEEGSNFSLGERQLLALTRALVRQSKILILDEATSSVDYETDGKIQTRIVE--EF 1413

Query: 632  KSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFA 672
               TI+ IAHRL TI   + I+VL   G V E      LF+
Sbjct: 1414 GDCTILCIAHRLKTIVNYDRILVL-EKGEVAEYDTPWALFS 1453

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 70/213 (32%), Positives = 105/213 (49%), Gaps = 20/213 (9%)

Query: 461 FRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRH 520
           F+D++  I  G  + + GP G GKS++   +        G+I ++G D+           
Sbjct: 604 FKDLNFDIQKGEFIMITGPIGTGKSSLLNAMAGSMRKVDGKIEVNG-DL----------- 651

Query: 521 IGLVQQEPVLMSGTLRDNITYGLTETP-SKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQ 579
             L+   P + + T+RDNI +G   +P +KE+   V   C     +   P G  T IG +
Sbjct: 652 --LMCGYPWIQNATVRDNIIFG---SPFNKEKYDEVIHVCSLKADLDILPAGDMTEIGER 706

Query: 580 GALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSI 639
           G  LSGGQK RI +AR++ KK  I + D+  SA+D      I       M S    I++ 
Sbjct: 707 GITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLSNKTRILA- 765

Query: 640 AHRLSTIRRSENIIVLGNDGSVVETGKFKELFA 672
            H+LS I R+  +IVLG DG  V+ G  +EL A
Sbjct: 766 THQLSLIERASRVIVLGTDGK-VDIGTVEELKA 797

>Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  133 bits (334), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 147/564 (26%), Positives = 248/564 (43%), Gaps = 46/564 (8%)

Query: 136  LKTGLETNEGKDGPISMADVPPIFMGYSIYEFLG-GFAALMVFGIVANYGRIVLLRILSE 194
            LK   E+NE K+G         ++M   +Y  +G G AA        N   IV+L   S 
Sbjct: 1001 LKYWSESNE-KNG-----SNERVWMFVGVYSLIGVGSAAF------NNLRSIVMLLYCSI 1048

Query: 195  RVVARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXX 254
            R   +L  N+ K  I     FF+   VG +I+R  SD   V  S+    S  FK+++   
Sbjct: 1049 RGSKKLHENMAKSVIRSPMVFFETTPVGRIINRFSSDMDAVDSSLQYIFSFFFKSILTYL 1108

Query: 255  XXXXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGV 314
                      P      +      ++  + +    R+    +  +   +  +  E L+G 
Sbjct: 1109 VTVILVGYNMPWFFVFNMFLLVIYIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGY 1168

Query: 315  RTVQSFVAEQKEIH----RYSHAIRDIFNVGKRAAYINAQFFT--ATSSLGDISFLVVLA 368
              + ++   ++ I+    +  + I  +FN      +++ +  T  AT  L   + L +  
Sbjct: 1169 SIIDAYDHFERFIYLNYEKIQYNIDFVFNFRSTNRWLSVRLQTIGATIVLAT-AMLALTT 1227

Query: 369  YGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGL--TSFYSELMQGVGAATRLFELTDRVP 426
              +   L  G+ +G L ++ L  E TGS  + +  T      +  V       EL     
Sbjct: 1228 MNTKKQLSSGM-VGLLMSYSL--EVTGSLTWIVRTTVMIETNIVSVERIVEYCELPSEAR 1284

Query: 427  SIKPTTG-KKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKS 485
            SI P     +  P KG I FK+ +  Y      V+ +D++++I     + +VG +G GKS
Sbjct: 1285 SINPENRPDESWPSKGSIEFKNYSTKYRENLDPVL-KDINVRIKPCEKIGIVGRTGAGKS 1343

Query: 486  TIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNIT--YGL 543
            T++L L R   P+ G I ID  +IS L +  LR H+ ++ Q+     GT+R N+      
Sbjct: 1344 TLSLALFRILEPTEGSIVIDDINISDLGLFDLRSHLAIIPQDAQAFEGTVRTNLDPFNRY 1403

Query: 544  TETPSKEEIRMVAKQCFCHNFIVKFPHGYDTV--------------IGPQGALLSGGQKQ 589
            +E   K+ + +          +     G D                I   G  LS GQ+Q
Sbjct: 1404 SEGELKKAVDLAHLGPHLEKMLDNEIRGADGAAEENGNVSDVLNVKINENGTNLSVGQRQ 1463

Query: 590  RIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRS 649
             + +ARAL+ +  ILVLDEAT+++D+E++  I  T  +  K +  TI++IAHR+ T+  S
Sbjct: 1464 LLCLARALLNRSKILVLDEATASVDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDS 1521

Query: 650  ENIIVLGNDGSVVETGKFKELFAD 673
            + IIVL ++G+V E     +L +D
Sbjct: 1522 DKIIVL-DEGTVKEFDSPSKLLSD 1544

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 97/428 (22%), Positives = 183/428 (42%), Gaps = 68/428 (15%)

Query: 285 FGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRA 344
             RK++  S    +      +   E L+ +++++ +  E+  + R +H   D+       
Sbjct: 453 LSRKVKKLSKTQMKYKDLRIKTITEILNAIKSIKLYAWEEPMMERLNHVRNDM------- 505

Query: 345 AYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAF-------------MLYT 391
                Q F     +G +S L+  A+    ++    T G  + F             +   
Sbjct: 506 ---ELQNF---RKIGIVSNLIYFAWNCVPLMVTCSTFGLFSLFSDTPLSPAIVFPSLSLF 559

Query: 392 EYTGSSVFGLTSFYSELMQGVGAATRL--FELTDRVPS-----IKPTTGKKFVPGKGEIV 444
               S+++ + S  + +++   +  RL  F L+D +       I P+  ++ +P    I 
Sbjct: 560 NILNSAIYSVPSMINTIIETSVSMERLKSFLLSDEIDDSFIERIDPSMSERTLP---VIE 616

Query: 445 FKDVTFSYPTRP--------GN-------------VIFRDMD-IKIPAGSNVCVVGPSGR 482
             ++TF + ++         GN             +  +++D  +   G  VCVVG  G 
Sbjct: 617 MNNITFLWKSKEALASGQFEGNSNADEESIIGSSQIALKNIDHFEAKRGDLVCVVGRVGA 676

Query: 483 GKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYG 542
           GKST    +L      SG     G    KL I++    +    QE  +M+ ++R+NI +G
Sbjct: 677 GKSTFLKGILGQLPCMSGS---KGSIPPKLIIRA--SSLAYCSQESWIMNSSVRENILFG 731

Query: 543 LTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPT 602
                 K    +  K C     +   P G +T++G +G  LSGGQK R+++ARA+  +  
Sbjct: 732 --HKFDKAYYDLTIKACQLLPDLKILPDGDETLVGEKGISLSGGQKARLSLARAVYSRAD 789

Query: 603 ILVLDEATSALDVE-SEGAINYTF-GQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGS 660
           I +LD+  SA+D E S+  + Y   G+    K+ TI+   + +  ++ S+ I  L N G 
Sbjct: 790 IYLLDDVLSAVDAEVSKNIVEYVLIGKAALLKNKTIILATNTVPILKHSQMIYALEN-GE 848

Query: 661 VVETGKFK 668
           ++E G ++
Sbjct: 849 IIEQGNYE 856

>Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR281W
            (REAL)
          Length = 1478

 Score =  132 bits (332), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 97/278 (34%), Positives = 144/278 (51%), Gaps = 25/278 (8%)

Query: 412  VGAATRL-FELTDRVPSIKPTTGKKFVPGKGEIVFKDVTFSYPTRPG-NVIFRDMDIKIP 469
            V  AT L  E   R P + P       P KGEI FK+V FSY  RPG  V+ +++++ I 
Sbjct: 1185 VSYATELPLEADYRKPEMAPPES---WPSKGEIAFKNVDFSY--RPGLPVVLKNLNLNIK 1239

Query: 470  AGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPV 529
            +G  + + G +G GKSTI   L R    S G+I ID  +IS++ +  LRR + ++ Q+PV
Sbjct: 1240 SGEKIGICGRTGAGKSTIMSALYRLNELSGGEILIDDVNISQIGLFDLRRKLAIIPQDPV 1299

Query: 530  LMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFI--VKF-------PHG------YDT 574
            L  GT+R N+      T  +    +V       N +  VK         HG       D 
Sbjct: 1300 LFRGTIRKNLDPFNERTEDELWDALVRGGAIAKNDLPEVKLQKPEENGTHGKMHKFHLDQ 1359

Query: 575  VIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSV 634
             +  +G+  S G++Q +A+ RAL+++  IL+LDEATS++D E++G I     +  +    
Sbjct: 1360 AVEEEGSNFSLGERQLLALTRALVRQSKILILDEATSSVDYETDGKIQVRIVE--EFGDC 1417

Query: 635  TIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFA 672
            TI+ IAHRL TI   + I+VL   G V E      LF+
Sbjct: 1418 TILCIAHRLKTIVNYDRILVL-EKGEVAEFDTPWALFS 1454

 Score = 87.4 bits (215), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 68/214 (31%), Positives = 110/214 (51%), Gaps = 22/214 (10%)

Query: 461 FRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRH 520
           F+D+D +I  G  + + GP G GKS++   +      + G+I ++G D+           
Sbjct: 604 FKDLDFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEVNG-DL----------- 651

Query: 521 IGLVQQEPVLMSGTLRDNITYGLTETP-SKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQ 579
             L+   P + + T++DNI +G   +P +KE+   V   C     +   P G  T IG +
Sbjct: 652 --LMCGYPWIQNATVKDNIIFG---SPFNKEKYDEVIHVCSLKADLDILPAGDMTEIGER 706

Query: 580 GALLSGGQKQRIAIARALIKKPTILVLDEATSALDVE-SEGAINYTFGQLMKSKSVTIVS 638
           G  LSGGQK RI +AR++ K+  I + D+  SA+D    +  ++     L+++K  T V 
Sbjct: 707 GITLSGGQKARINLARSVYKRKDIYLFDDVLSAVDSRVGKHIMDECLTGLLENK--TRVL 764

Query: 639 IAHRLSTIRRSENIIVLGNDGSVVETGKFKELFA 672
             H+LS I ++  +IVLG DG  V+ G   EL A
Sbjct: 765 ATHQLSLIEKASRVIVLGTDGD-VDIGTVDELKA 797

>NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_4.6
          Length = 1657

 Score =  132 bits (332), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 132/528 (25%), Positives = 235/528 (44%), Gaps = 42/528 (7%)

Query: 159  FMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFDR 218
            F   SIY  +G   +L+         + VL  +L  R   ++  +++ +T+H    FFD 
Sbjct: 1106 FYYLSIYFLIGLTQSLLA------ASKSVLNFVLGIRASRKIFESLLYRTLHAKLGFFDA 1159

Query: 219  HKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPV 278
              +G +++R   D   V + +T  +   F  L+           I+PQ   + +L     
Sbjct: 1160 TPIGRIMNRFSKDIESVDQELTPYLEAAFFCLVQCIATMALITFITPQFLSVAILVGCLY 1219

Query: 279  LFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIF 338
                  +    R+       +   + +   E L GV T++++  E + +    H I +  
Sbjct: 1220 YLVGYFYMAASRELKRFESISKSPIYQHFSETLVGVATIRAYGDESRFMLENLHKIDE-- 1277

Query: 339  NVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLV-----LQGGLTIGDLTAFMLYTEY 393
               K   Y+       +  +  I   V+   G +++     +  G+    LT  + +TE 
Sbjct: 1278 -NNKPFFYLWVFNRWLSFRIDMIGAFVIFGAGVFILTNIKNIDSGMAGISLTYAISFTE- 1335

Query: 394  TGSSVFGLTSFYSELMQGVGAATRLFELTD--RVP--SIKPTTGKKFVPGKGEIVFKDVT 449
                   L  FY+++   + +  RL E  +  + P    K T      P  G+I  KD++
Sbjct: 1336 ---GALWLVRFYADVEMNMNSVERLKEYMEIEQEPYDEYKDTLLHDEWPSNGKIEVKDLS 1392

Query: 450  FSY-PTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQD 508
              Y P  P   + +++   +   + + +VG +G GKSTI   + RF NP SG I ID  +
Sbjct: 1393 LRYAPNLPK--VIKNVSFVVEPKTKIGIVGRTGAGKSTIITAMFRFLNPESGYIKIDDVN 1450

Query: 509  ISKLNIKSLRRHIGLVQQEPVLMSGTLR-----------DNITYGLTETP--SKEEIRMV 555
            I+ +N+  LRR I ++ Q+P L +GT++           D I   L      ++EE++  
Sbjct: 1451 IASINLTKLRRSITIIPQDPTLFTGTIKLNLDPYNEFTDDAIFEALKRVNLVTEEELQNN 1510

Query: 556  AKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDV 615
              Q        KF +  +  I   G+ LS GQ+Q + +AR+L++ P I++LDEAT+++D 
Sbjct: 1511 GTQTGTSENANKFLN-LENEITEGGSNLSHGQRQLVCLARSLLRNPKIILLDEATASIDY 1569

Query: 616  ESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVE 663
             S+  I  T  +       TI++IAHRL ++   + IIV+ + G V E
Sbjct: 1570 ASDAKIQETIRKEFSQS--TILTIAHRLRSVIDYDKIIVM-DAGEVKE 1614

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/232 (29%), Positives = 114/232 (49%), Gaps = 13/232 (5%)

Query: 441 GEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSG 500
             I FK+VT ++     +   RD++I+   G+   V+GP+G GK+++ L LL       G
Sbjct: 709 NRIAFKNVTVTWDNGEEDFKLRDLNIEFKPGALNVVIGPTGSGKTSLLLALLGEMCLEKG 768

Query: 501 QIFIDG----QDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEE-IRMV 555
           +I +      QD+  ++   L   I    Q   L++ T+R+NI +    +P  EE    V
Sbjct: 769 EIIVPALNPRQDLV-IDKFGLTNSIAYCSQAAWLLNETVRNNILFN---SPYNEERYNAV 824

Query: 556 AKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDV 615
              C     +        T IG +G  LSGGQKQR+++ARAL      ++LD+  SA+D 
Sbjct: 825 IDACGLRRDLKILKASDMTEIGEKGITLSGGQKQRVSLARALYSNSKHVLLDDCLSAVDS 884

Query: 616 ESEGAI--NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETG 665
            +   I  N   G LM  ++  +VS  H ++   ++  ++V+  +G V + G
Sbjct: 885 HTALWIYDNCITGPLMSGRTCILVS--HNIALTLKNAELVVILENGRVKDQG 934

>KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {ON}
            Anc_4.52 YLL015W
          Length = 1536

 Score =  132 bits (331), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 141/544 (25%), Positives = 237/544 (43%), Gaps = 63/544 (11%)

Query: 163  SIYEFLG-GFAALMVFGIVANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKV 221
            ++Y  +G G AA  +F        I++L   S R    L  ++ K  I    +FF+   +
Sbjct: 1006 AVYALIGLGSAAFNIFR------TIIMLLYCSIRGSKTLHDSMAKAIIRSPVQFFETTPI 1059

Query: 222  GDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFS 281
            G +I+R  SD   V  ++    S  F++++             P      LLF   ++  
Sbjct: 1060 GRVINRFSSDIDSVDVNLQNVFSIFFRSILDYILTVILVSVAMPWF----LLFNALIMII 1115

Query: 282  ASIFGRKIRDTSTDLQEATG----QLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDI 337
               + +     S +L+  T      +  +  E L G          Q  I  Y+H+    
Sbjct: 1116 YFYYEKLYIVQSRELKRLTSIAYSPIISLMSETLGG----------QMVISAYNHSKMFK 1165

Query: 338  FNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTI------------GDLT 385
            F   +R  Y     FT  S+   +S + + + G++++L  GL              G + 
Sbjct: 1166 FMNIERVQYNLNVLFTFRSTNRWLS-IRLQSIGAFIILCTGLLALTTLRTSSPIGSGLIG 1224

Query: 386  AFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPS----IKPTTGKKFVPGKG 441
              M Y     S++  +     ++   + +  R+ E     P     I     ++  P +G
Sbjct: 1225 LLMSYVLQVTSALTWIVRSTVQIETNIVSVERILEYCHLPPEAEDIIDSNRVERDWPQRG 1284

Query: 442  EIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQ 501
             I FK+ T +Y      V+ +++ + I     V +VG +G GKST++L L R    + G 
Sbjct: 1285 SIEFKNYTTTYRANLSPVL-KNISVTINPSEKVGIVGRTGAGKSTLSLALFRILEAAEGT 1343

Query: 502  IFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNIT----------YGLTETPSKEE 551
            IFIDG DIS++ +  LR ++ ++ Q+     GT+R N+           + + E    + 
Sbjct: 1344 IFIDGVDISRIGLTDLRGNMAIIPQDAQAFEGTVRSNLDPFQKHTDVELWNVIELSHLKP 1403

Query: 552  --IRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEA 609
              +RM        N       G D  I   G+ LS GQ+Q + +ARAL+ +  +LVLDEA
Sbjct: 1404 HVLRMAEDDNLSGNL-----SGLDAKINENGSNLSVGQRQLLCLARALLNQSKVLVLDEA 1458

Query: 610  TSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKE 669
            T+A+DVE++  I  T     K +  TI++IAHRL TI  ++ I+VL + G V E    K 
Sbjct: 1459 TAAVDVETDKIIQETIRTQFKDR--TILTIAHRLDTIMDNDKILVL-DAGGVKEFDSPKN 1515

Query: 670  LFAD 673
            L +D
Sbjct: 1516 LLSD 1519

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 61/205 (29%), Positives = 107/205 (52%), Gaps = 24/205 (11%)

Query: 475 CVVGPSGRGKSTIALLLLRFYNPSSGQI-FIDGQDIS---KLNIKSLRRHIGLVQQEPVL 530
           CV+G  G GK+T+   +L       GQ+  I G   S   KL+I+     I    QE  +
Sbjct: 656 CVIGKVGSGKTTLLKAIL-------GQLPCISGSKESISPKLSIRG--ESIAYCPQEAWI 706

Query: 531 MSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQR 590
           M+ T+++NI +G     +   + + A +      I+  P G  T++G +G  LSGGQK R
Sbjct: 707 MNDTIKENILFGHKFDETYYTLTVAACELLADFDIL--PDGDQTLVGEKGISLSGGQKAR 764

Query: 591 IAIARALIKKPTILVLDEATSALDVE-----SEGAINYTFGQLMKSKSVTIVSIAHRLST 645
           +++ARA+  +  I +LD+  SA+D        E  ++   G L+++K+V + +  + +S 
Sbjct: 765 VSLARAVYSRADIYLLDDILSAVDAGVSKKIVENVLDSNSG-LLRNKTVILST--NTVSV 821

Query: 646 IRRSENIIVLGNDGSVVETGKFKEL 670
           ++ S+ I  L N G +VE G + ++
Sbjct: 822 LKHSQLIYALEN-GIIVERGNYNDI 845

>KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1500

 Score =  132 bits (331), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 110/376 (29%), Positives = 189/376 (50%), Gaps = 19/376 (5%)

Query: 308  EEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVL 367
            +E L G+ T++ +  +++ +H     + +  N+      +NA  + A   L  I  +++L
Sbjct: 1119 QETLGGISTIRGYNQQKRFVHINQARVDN--NMSAYYPSVNANRWLAFR-LEFIGSVIIL 1175

Query: 368  AYGSYLVL---QGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFE---L 421
            A  S  VL   QG LT G +   + Y      S+  +     E+   + +  R+ E   L
Sbjct: 1176 AASSLSVLRLKQGALTPGMIGLSVSYALQITQSLNWIVRMTVEVETNIVSVERIKEYANL 1235

Query: 422  TDRVPS-IKPTTGKKFVPGKGEIVFKDVTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGP 479
                P+ I+     +  P +G I F++ +  Y  RP   +  +D+++ I     + +VG 
Sbjct: 1236 ESEAPAVIESNRPSEDWPSQGSIKFENYSARY--RPELELSLKDINLDIKPQERIGIVGR 1293

Query: 480  SGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNI 539
            +G GKS++ L L R    +SG+I+IDG  I  + ++ LR H+ ++ Q+  L  GT+R+NI
Sbjct: 1294 TGAGKSSLTLALFRIIEAASGRIYIDGLPIDSIGLRDLRHHLSIIPQDSQLFEGTIRENI 1353

Query: 540  TYGLTETPSKEEIRMVAKQCFCHNFIVKF-PHGYDTVIGPQGALLSGGQKQRIAIARALI 598
                T   + E+I    +     + +        D  +   G+ LS GQ+Q + +ARAL+
Sbjct: 1354 --DPTNEYTDEQIWRALELSHLKDHVKGLGKEELDAPLTEGGSNLSVGQRQLMCLARALL 1411

Query: 599  KKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGND 658
                ILVLDEAT+A+DVE++  I  T     K++  TI++IAHR++TI  S+ I+VL + 
Sbjct: 1412 IPSKILVLDEATAAVDVETDQVIQETIRTAFKNR--TILTIAHRINTILDSDRILVL-DS 1468

Query: 659  GSVVETGKFKELFADP 674
            G V E      L  +P
Sbjct: 1469 GKVAEFDTPDNLLKNP 1484

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 99/389 (25%), Positives = 178/389 (45%), Gaps = 54/389 (13%)

Query: 304 TRVSEEQLSGVRTVQSFVAEQ--KEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDI 361
           TR+  E L+ +++++ +  E+  ++   Y    +++ N+ +R    NA    A+     I
Sbjct: 474 TRLISEILNNIKSLKLYAWEEPYRKKLDYVRNEKELKNL-RRMGITNA---CASFQFNVI 529

Query: 362 SFLVVLA-YGSYLVLQGG----------LTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQ 410
            FLV  + +G ++  Q            LT+ +L AF L    T  + F         ++
Sbjct: 530 PFLVSCSTFGVFIWTQDAPLTTDLVFPALTLFNLLAFPLAVIPTAITAF---------VE 580

Query: 411 GVGAATRLFE-LTDRVPSIKPTTGKKFVPGKGEI---VFKDVTFSYPTRPG-NVIFRDMD 465
              + TRL   LT+          K  V  KGE+   V  D TF +  +P   V  ++++
Sbjct: 581 ASVSITRLQSFLTNEELQRDSVQRKSKVTKKGEVAVNVGADATFLWQRKPEYKVALKNIN 640

Query: 466 IKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIF-IDGQDISKLNIKSLRRHIGLV 524
                G   CVVG  G GKS +   +L       G +F + G         S+   I  V
Sbjct: 641 FAAKKGKLTCVVGKVGSGKSALIQAIL-------GDLFRVKG-------FASVHGSIAYV 686

Query: 525 QQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLS 584
            Q P +M+GT++DNI +G      +    M  K C     +   P G  T++G +G  LS
Sbjct: 687 SQVPWIMNGTVKDNILFG--HKYDESFYTMTLKACALIVDLAVLPKGDQTLVGEKGISLS 744

Query: 585 GGQKQRIAIARALIKKPTILVLDEATSALDVE-SEGAINYTFGQ--LMKSKSVTIVSIAH 641
           GGQK R+++ARA+  +    +LD+  +A+D   ++  + +  G   L+ SK  T V   +
Sbjct: 745 GGQKARLSLARAVYARADTYLLDDPLAAVDEHVTKHLVEHVLGPNGLLASK--TKVLATN 802

Query: 642 RLSTIRRSENIIVLGNDGSVVETGKFKEL 670
           +++ +  +++I +L N G +++ G + ++
Sbjct: 803 KITVLSIADHIALLEN-GEIIQQGSYDDV 830

>KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1650

 Score =  131 bits (330), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 134/551 (24%), Positives = 255/551 (46%), Gaps = 60/551 (10%)

Query: 147  DGPISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRANVIK 206
            +G ++ A  P     Y +  +LG    + VF  + +  + ++  +   R   ++   ++K
Sbjct: 1083 NGSLTTATEPNHSNAYYLSIYLG----IGVFQALCSSSKAIINFVAGIRASRKIFNLLLK 1138

Query: 207  KTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQ 266
              ++    FFD   +G +++R   D   + + +T  +   F +LI           I+PQ
Sbjct: 1139 NVLYAKLRFFDSTPIGRIMNRFSKDIESIDQELTPYMEGAFGSLIQCVSTIIVIAYITPQ 1198

Query: 267  L----SGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVA 322
                 + ++LLF     F A  +    R+       +   + +   E L G+ T+++F  
Sbjct: 1199 FLIVAAIVMLLF----YFVAYFYMSGARELKRLESMSRSPIHQHFSETLVGITTIRAFSD 1254

Query: 323  EQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQ------ 376
            E++ +      I D  N      ++  ++ +    L  I  L+VLA GS+++L       
Sbjct: 1255 ERRFLVDNMKKIDD-NNRPFFYLWVCNRWLSYRIEL--IGALIVLAAGSFILLNIKSIDS 1311

Query: 377  --GGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELT--DRVPS----- 427
               G+++G         ++T  +++ +   YS +   + +  RL E T  ++ PS     
Sbjct: 1312 GLAGISLG------FAIQFTDGALW-VVRLYSNVEMNMNSVERLKEYTTIEQEPSNVGAL 1364

Query: 428  IKPTTGKKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTI 487
            + P       P  G+I  KD++  Y      VI +++   + +   V +VG +G GKSTI
Sbjct: 1365 VPPCEW----PQNGKIEVKDLSLRYAAGLPKVI-KNVTFTVDSKCKVGIVGRTGAGKSTI 1419

Query: 488  ALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNI----TYGL 543
               L RF +P +G I ID  DI+ + +K LR+ I ++ Q+P L +GTL+ N+     Y  
Sbjct: 1420 ITALFRFLDPETGYIKIDDVDITTIGLKRLRQSITIIPQDPTLFTGTLKTNLDPYNEYSE 1479

Query: 544  TET-PSKEEIRMVAKQCF----------CHNFIVKFPHGYDTVIGPQGALLSGGQKQRIA 592
             E   + + + +V+ +             H+  +      +  +   G+ LS GQ+Q I 
Sbjct: 1480 AEIFEALKRVNLVSSEELGNPSTSDSTSVHSANMNKFLDLENEVSEGGSNLSQGQRQLIC 1539

Query: 593  IARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENI 652
            +AR+L++ P +++LDEAT+++D  S+  I  T  +   +   TI++IAHRL +I   + I
Sbjct: 1540 LARSLLRCPKVILLDEATASIDYNSDSKIQATIREEFSNS--TILTIAHRLRSIIDYDKI 1597

Query: 653  IVLGNDGSVVE 663
            +V+ + G V E
Sbjct: 1598 LVM-DAGEVKE 1607

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 114/239 (47%), Gaps = 11/239 (4%)

Query: 439 GKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPS 498
            + ++  ++ TF++     +   +++ I    G    +VGP+G GK+++ + LL      
Sbjct: 695 SRNKLGLQNATFTWDKNNQDFKLKNLTIDFKIGKLNVIVGPTGSGKTSLLMGLLGEMELL 754

Query: 499 SGQIFIDGQDISK---LNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEE-IRM 554
           +G++F+   +  +   +    +   I    Q   L++ T+R+NI +     P  E     
Sbjct: 755 NGKVFVPSLNPREELVVEADGMTNSIAYCSQAAWLLNDTVRNNILFN---APYNENRYNA 811

Query: 555 VAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALD 614
           V   C           G  T IG +G  LSGGQKQR+++AR+L      L+LD+  SA+D
Sbjct: 812 VISACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARSLYSSSRHLLLDDCLSAVD 871

Query: 615 VESEGAI--NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELF 671
             +   I  N   G LM+ ++  +VS  H ++   ++ + +++  +G V E G+  EL 
Sbjct: 872 SHTALWIYENCITGPLMEGRTCVLVS--HNVALTLKNADWVIIMENGRVKEQGEPVELL 928

>Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  131 bits (329), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 129/498 (25%), Positives = 229/498 (45%), Gaps = 26/498 (5%)

Query: 187  VLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDG 246
            V   I + + +  L AN +   +     FF+   +G +++R  +D Y V   + +  S  
Sbjct: 1016 VFCTIHASKYLHNLMANSV---LRAPMAFFETTPIGRILNRFSNDIYKVDALLGRTFSQF 1072

Query: 247  FKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRV 306
            F   +          + + Q   +++      ++    + R  R+           +   
Sbjct: 1073 FVNAVKVIFTITVICATTWQFIFIIIPLGVCYIYYQQYYLRTSRELRRLDSITRSPIYSH 1132

Query: 307  SEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAY--INAQFFTAT--SSLGDIS 362
             +E L G+ TV+ + ++QK   R+SH  +   +    A Y  INA  + A     +G I 
Sbjct: 1133 FQETLGGLATVRGY-SQQK---RFSHINQCRIDNNMSAFYPSINANRWLAYRLELIGSII 1188

Query: 363  FLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELT 422
             L       + + QG LT G     + Y      ++  +     E+   + +  R+ E  
Sbjct: 1189 ILGAATLSVFRLKQGTLTAGMAGISLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYA 1248

Query: 423  DRVPSIKPTTGK-----KFVPGKGEIVFKDVTFSYPTRPG-NVIFRDMDIKIPAGSNVCV 476
            D + S  P T +     K  P +G+I F + +  Y  RP  +++ + ++I I     + +
Sbjct: 1249 D-LKSEAPLTIEGHMPPKEWPSQGDIKFNNYSTRY--RPELDLVLKHINIHIKPNEKIGI 1305

Query: 477  VGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLR 536
            VG +G GKS++ L L R    S+G I IDG  I+++ +  LR  + ++ Q+  +  G+LR
Sbjct: 1306 VGRTGAGKSSLTLALFRMIEASAGNIVIDGIAINEIGLYDLRHRLSIIPQDSQVFEGSLR 1365

Query: 537  DNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPH-GYDTVIGPQGALLSGGQKQRIAIAR 595
            +NI    T   + E I    +       ++   + G D  +   G  LS GQ+Q + +AR
Sbjct: 1366 ENI--DPTNQYTDEAIWRALELSHLKEHVLSMSNDGLDAQLTEGGGNLSVGQRQLLCLAR 1423

Query: 596  ALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVL 655
            A++    IL+LDEAT+A+DVE++  +  T     K +  TI++IAHRL+TI  S+ IIVL
Sbjct: 1424 AMLVPSKILILDEATAAVDVETDKVVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVL 1481

Query: 656  GNDGSVVETGKFKELFAD 673
             N G+V E     +L ++
Sbjct: 1482 DN-GTVAEFDSPSQLLSN 1498

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 88/385 (22%), Positives = 170/385 (44%), Gaps = 40/385 (10%)

Query: 304 TRVSEEQLSGVRTVQSFVAEQK-----EIHRYSHAIRDIFNVGKRAAYINAQFFTATSSL 358
           TRV  E L+ +++++ +  E+      E  R +  ++++  +G   A  + QF      +
Sbjct: 485 TRVISEILNNIKSLKLYAWEKPYREKLEDIRNNKELKNLTRLGCYMAVTSFQFNIVPFLV 544

Query: 359 GDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRL 418
              +F  V  Y     L   L    LT F L +         L SF    ++   +  RL
Sbjct: 545 SCCTF-AVFVYTEDRALTTDLVFPALTLFNLLSFPLMIIPMVLNSF----IEASVSIGRL 599

Query: 419 FELTDRVPSIKPTTGKKF--VPGKGEIVFK---DVTFSYPTRPG-NVIFRDMDIKIPAGS 472
           F        ++P + ++   V   G++      D TF +  +P   V  ++++ +   G 
Sbjct: 600 FTFFTN-EELQPDSVQRLPKVENFGDVAINVGDDATFLWQRKPEYKVALKNINFQAKKGE 658

Query: 473 NVCVVGPSGRGKSTIALLLLRFYNPSSGQIF-IDGQDISKLNIKSLRRHIGLVQQEPVLM 531
             CVVG  G GK+ +   +L       G +F + G         ++   +  V Q P +M
Sbjct: 659 LTCVVGKVGSGKTALLSCML-------GDLFRVKG-------FATVHGSVAYVSQVPWIM 704

Query: 532 SGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRI 591
           +GT+ +NI +G       E      K C     +     G  T++G +G  LSGGQK R+
Sbjct: 705 NGTVMENILFG--HKYDVEFYEKTIKACALTIDLAILMDGDKTLVGEKGISLSGGQKARL 762

Query: 592 AIARALIKKPTILVLDEATSALDVE-SEGAINYTFGQ--LMKSKSVTIVSIAHRLSTIRR 648
           ++ARA+  +    +LD+  +A+D   +   I +  G   L+ +K+  + +  +++S +  
Sbjct: 763 SLARAVYSRADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKTRLLAT--NKVSALSI 820

Query: 649 SENIIVLGNDGSVVETGKFKELFAD 673
           ++++ +L N G +++ G + E+  D
Sbjct: 821 ADSVALLDN-GEIIQKGTYDEITKD 844

>Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  131 bits (329), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 143/561 (25%), Positives = 248/561 (44%), Gaps = 40/561 (7%)

Query: 136  LKTGLETNEGKDGPISMADVPPIFMGYSIYEFLG-GFAALMVFGIVANYGRIVLLRILSE 194
            LK   E+NE K+G         ++M   +Y  LG G AA        N   I++L   S 
Sbjct: 1001 LKYWSESNE-KNGSNER-----VWMFVGVYSLLGVGSAAF------NNLRSIIMLLYCSI 1048

Query: 195  RVVARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXX 254
            R   +L  N+ K  I     FF+   VG +I+R  SD   V  S+    S  FK+++   
Sbjct: 1049 RGSKKLHENMAKSVIRSPMVFFETTPVGRIINRFSSDMDAVDSSLQYVFSFFFKSILTYL 1108

Query: 255  XXXXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGV 314
                      P      +      ++  + +    R+    +  +   +  +  E L+G 
Sbjct: 1109 VTIVLVGYNMPWFLVFNMFLLVIYIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGY 1168

Query: 315  RTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLG-DISFLVVLAYGSYL 373
              + ++   ++ I+     I+   ++      IN        ++G  I     L   + +
Sbjct: 1169 SIIDAYNHYERFIYLNYDKIQSNIDLVFNFRSINRWLSVRLQTIGATIVLATALLALATI 1228

Query: 374  VLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVP---SIKP 430
              +  L+ G +   M Y+    SS+  +      +   + +  R+ E  +  P   SI P
Sbjct: 1229 NTKNQLSSGMVGLLMAYSFEVTSSLTWIVRTTVMIETNIVSVERIVEYCELPPEAQSINP 1288

Query: 431  TTG-KKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIAL 489
                 +  P +G I FK+ +  Y      V+ +D+++ I     + +VG +G GKST++L
Sbjct: 1289 EKRPDENWPSEGRIEFKNYSTKYRENLDPVL-KDINVSIQPCEKIGIVGRTGAGKSTLSL 1347

Query: 490  LLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNIT----YGLTE 545
             L R   PS G+I ID  +IS+L +  LR ++ ++ Q+     GT+R N+     Y   E
Sbjct: 1348 ALFRILEPSEGEIIIDDVNISELGLFDLRSNLAIIPQDAQAFEGTVRTNLDPFNRYSEDE 1407

Query: 546  TPSKEEI--------RMVAKQCFCHNFIVKFPHG-----YDTVIGPQGALLSGGQKQRIA 592
                 E+        +M+  +   ++  V+   G      D  I   G+ LS GQ+Q + 
Sbjct: 1408 LKRAIELAHLKSHLEKMLGNEAENNDINVE-ERGNAKDILDVKINENGSNLSVGQRQLLC 1466

Query: 593  IARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENI 652
            +ARAL+    ILVLDEAT+++D+E++  I  T  +  K +  TI++IAHR+ T+  S+ I
Sbjct: 1467 LARALLSHSKILVLDEATASVDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKI 1524

Query: 653  IVLGNDGSVVETGKFKELFAD 673
            IVL + G+V E     +L +D
Sbjct: 1525 IVL-DKGNVKEFDSPSKLLSD 1544

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 65/204 (31%), Positives = 105/204 (51%), Gaps = 18/204 (8%)

Query: 471 GSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI-FIDGQDIS---KLNIKSLRRHIGLVQQ 526
           G  +CVVG  G GKST    +L       GQ+  + G   S   KL I++    +    Q
Sbjct: 665 GDLICVVGRVGAGKSTFLKAIL-------GQLPCMSGSKESLAPKLIIRA--SSLAYCSQ 715

Query: 527 EPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGG 586
           E  +M+ ++R+NI +G      K    +  K C     +   P G +T++G +G  LSGG
Sbjct: 716 ESWIMNASVRENILFG--HKFDKAYYDLTIKACQLLPDLKILPDGDETLVGEKGISLSGG 773

Query: 587 QKQRIAIARALIKKPTILVLDEATSALDVE-SEGAINYTF-GQLMKSKSVTIVSIAHRLS 644
           QK R+++ARA+  +  I +LD+  SA+D E S+  I +   G+    K+ TI+   + +S
Sbjct: 774 QKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKTALLKNKTIILTTNTVS 833

Query: 645 TIRRSENIIVLGNDGSVVETGKFK 668
            ++ S+ I  L N G +VE G ++
Sbjct: 834 ILKHSQMIYALEN-GEIVEQGNYE 856

>ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1525

 Score =  130 bits (328), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 145/581 (24%), Positives = 255/581 (43%), Gaps = 51/581 (8%)

Query: 118  SCGIGMTIP----KVIGMILDVLKTGLETNEGKDGPISMADVPPIFMGYSIYEFLGGFAA 173
            SCGI   +      ++ M L V+           G + +     +   Y      GG+ A
Sbjct: 952  SCGIRNVLIFMSFAILSMFLSVM-----------GSVWLKHWSEVNTKYGANPHAGGYLA 1000

Query: 174  L-MVFGIVANYGRIVLLRILSERVVAR----LRANVIKKTIHQDSEFFDRHKVGDLISRL 228
            + + FGI +    ++   +L           L A +          FF+   +G +++R 
Sbjct: 1001 VYLAFGIFSALSTLIQTVVLWVYCTIHGSKYLHAGMANSVFRAPMRFFETTPIGRILNRF 1060

Query: 229  GSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIFGRK 288
             +D + V   + +  S     +I            + Q +    LF  P+      + + 
Sbjct: 1061 SNDIFKVDELLGRTFSQFVNNVIKVSFTIIVICFTTWQFT----LFVIPLGILYVYYQQY 1116

Query: 289  IRDTSTDLQEATGQLTRVS-----EEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKR 343
               TS +L+      TR       +E L G+ T++ +  +++ IH     + +  N+   
Sbjct: 1117 YLRTSRELRRLDST-TRSPIYAHFQESLGGLSTIRGYNQQRRFIHINQSRMDN--NMSAY 1173

Query: 344  AAYINAQFFTATSSLGDISFLVVLAYGSYLVLQ---GGLTIGDLTAFMLYTEYTGSSVFG 400
               +NA  + A   L  I  +++    S  +L+   G LT G +   + Y      S+  
Sbjct: 1174 YPSVNANRWLAYR-LEFIGTIIIFGASSLSILRLKSGSLTPGMIGLSLSYALQITQSLNW 1232

Query: 401  LTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKK-----FVPGKGEIVFKDVTFSYPTR 455
            +     E+   + +  R+ E ++ +PS  P   +        P  G I F+  +  Y  R
Sbjct: 1233 IVRMTVEVETNIVSVERIKEYSE-IPSEAPYLIEDRRPSPNWPTDGAIQFQHYSTRY--R 1289

Query: 456  PG-NVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNI 514
            PG ++I +D+++ I     + +VG +G GKS++ L L R    + G+I IDG  I ++ +
Sbjct: 1290 PGLDLILKDINLDIKPKEKIGIVGRTGAGKSSLTLALFRLIEAAEGRIVIDGVPIDQMGL 1349

Query: 515  KSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPH-GYD 573
              LR  + ++ Q+  +  G++R+NI    TE  S EEI  V       N ++   + G  
Sbjct: 1350 YDLRHKLSIIPQDSQVFEGSVRENI--DPTEQYSDEEIWRVLDLSHLKNHVLNMGNDGLL 1407

Query: 574  TVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKS 633
            T +   G  LS GQ+Q + +ARAL+    ILVLDEAT+A+DVE++  +  T       + 
Sbjct: 1408 TQLSEGGGNLSVGQRQLMCLARALLVPTKILVLDEATAAVDVETDKVLQETIRTAFADR- 1466

Query: 634  VTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADP 674
             TI++IAHRL+TI  S+ I+VL + G V E    + L  +P
Sbjct: 1467 -TILTIAHRLNTIMDSDRILVL-DAGRVAEFDTPENLLKNP 1505

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 100/413 (24%), Positives = 179/413 (43%), Gaps = 98/413 (23%)

Query: 302 QLTRVSEEQLSGVRTVQSFVAEQK-----EIHRYSHAIRDIFNVGKRAAYINAQF----- 351
           Q TR+  E L+ +++++ +  E+      E  R    ++++  +G   A IN QF     
Sbjct: 486 QRTRLINEILNNMKSLKLYAWEKPYKEKLEYVRNEKELKNLTKIGVYNAIINFQFNIVPF 545

Query: 352 -----------------------FTATSSLGDISF---LVVLAYGSYLVLQGGLTIGDLT 385
                                  F A +  G +SF   +V L   SY+  +  ++IG L 
Sbjct: 546 FVSCSTFAVFVYTEDRPLTTDLVFPALTLFGLLSFPLAVVPLVLNSYI--EASVSIGRLY 603

Query: 386 AFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGKGEIVF 445
           +F+   E    SV                         R+P +K           G++  
Sbjct: 604 SFLTNEELQRDSV------------------------QRLPRVKNI---------GDVAM 630

Query: 446 K---DVTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQ 501
           K   + TF +  +P   V  ++++ +   G   CVVG  G GKS +   LL       G 
Sbjct: 631 KLGDNATFLWKRKPEYKVALKNVNFQAKKGELNCVVGRVGSGKSALIQSLL-------GD 683

Query: 502 IF-IDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCF 560
           +F + G         ++  +I  V Q   +M+GT++DNI +G    P  E      K C 
Sbjct: 684 LFRVKG-------FATVHGNIAYVSQVAWIMNGTVKDNILFGHKYDP--EFYEKTIKACA 734

Query: 561 CHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVE-SEG 619
               +   P G  T++G +G  LSGGQK R+++ARA+  +  I +LD+  +A+D   S  
Sbjct: 735 LTIDLAILPDGDKTIVGEKGISLSGGQKARLSLARAVYSRADIFLLDDPLAAVDEHVSTH 794

Query: 620 AINYTFGQ--LMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKEL 670
            I++  G   L+K+K+  + +  +++S +  ++++ +L N G +++ G F E+
Sbjct: 795 LIDHVLGPNGLLKTKTKILAT--NKISALSIADSVTLLEN-GEIIQQGTFCEI 844

>KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1515

 Score =  130 bits (328), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 123/470 (26%), Positives = 219/470 (46%), Gaps = 21/470 (4%)

Query: 215  FFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLF 274
            FF+   +G +++R  +D Y +   + +  S  F   +          + + Q   +++  
Sbjct: 1039 FFETTPIGRILNRFSNDIYKIDSILGRTFSQFFVNAVKVVFVMAVICATTWQFIFVIIPL 1098

Query: 275  TPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAI 334
                ++    + R  R+           +    +E L G+ T++ +  E+    R+ H  
Sbjct: 1099 GVFYIYYQQYYLRTSRELRRLDSITRSPVYSHFQETLGGITTIRGYNQEK----RFGHIN 1154

Query: 335  RDIFNVGKRAAY--INAQFFTA--TSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLY 390
            +   +    A Y  INA  + A     +G I  L       + + +G LT G +   + Y
Sbjct: 1155 QCRVDNNMSAFYPSINANRWLAFRLELIGSIIILGAATLSIFRLKEGTLTPGMVGLSLSY 1214

Query: 391  TEYTGSSVFGLTSFYSELMQGVGAATRLFE---LTDRVPSI-KPTTGKKFVPGKGEIVFK 446
                  ++  +     E+   + +  R+ E   L    P I +     +  P +G+I F+
Sbjct: 1215 ALQITQTLNWIVRMTVEVETNIVSVERVKEYAQLESEAPRIVEEKRPDEMWPTEGDIKFE 1274

Query: 447  DVTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFID 505
            + +  Y  RP  +++ +++++ I     V +VG +G GKS++ L L R    ++G I ID
Sbjct: 1275 NYSTRY--RPELDLVLKNINVHIRPTEKVGIVGRTGAGKSSLTLALFRIIEATAGNIIID 1332

Query: 506  GQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFI 565
            G  I+++ +  LR  + ++ Q+  +  GTLR+NI    T   + EEI  V +       +
Sbjct: 1333 GIPINEIGLYDLRHKLSIIPQDSQVFEGTLRENI--DPTNLFTDEEIWRVLELSHLKEHV 1390

Query: 566  VKF-PHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYT 624
            +     G D  +   G+ LS GQ+Q + +ARAL+    ILVLDEAT+A+DVE++  +  T
Sbjct: 1391 LSMGADGLDVQLTEGGSNLSVGQRQLMCLARALLIPSKILVLDEATAAVDVETDKIVQET 1450

Query: 625  FGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADP 674
                 K +  TI++IAHRL+TI  S+ IIVL + G +VE     EL A P
Sbjct: 1451 IRTAFKDR--TILTIAHRLNTIMDSDRIIVL-DKGEIVEFDTPDELLAKP 1497

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 119/243 (48%), Gaps = 23/243 (9%)

Query: 437 VPGKGEIVFK---DVTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLL 492
           V  KG++      + TF +  +P   V  ++++ +   G   C+VG  G GKS +   +L
Sbjct: 615 VENKGDVAINLGDNATFLWKRKPEYKVALKNINFQAKKGDLTCIVGKVGSGKSALIQSIL 674

Query: 493 RFYNPSSGQIF-IDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEE 551
                  G +F + G         ++  ++  V Q P +M+GT+++NI +G      +E 
Sbjct: 675 -------GDLFRVKG-------FATVHGNVAYVSQVPWIMNGTVKENILFG--HKYDQEF 718

Query: 552 IRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATS 611
                K C     +     G  T++G +G  LSGGQK R+++ARA+  +    +LD+  +
Sbjct: 719 YEKTIKACALTIDLGILVDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLA 778

Query: 612 ALDVE-SEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKEL 670
           A+D   S+  + +  G      S T V   +++S +  +++I +L N G +V+ G ++E+
Sbjct: 779 AVDEHVSKHLVEHVLGPTGLLHSKTKVLCTNKISVLSIADSITLLEN-GEIVQQGSYEEV 837

Query: 671 FAD 673
            +D
Sbjct: 838 NSD 840

>KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8.303
            YDR135C
          Length = 1535

 Score =  130 bits (328), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 108/364 (29%), Positives = 181/364 (49%), Gaps = 17/364 (4%)

Query: 308  EEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTA--TSSLGDISFLV 365
            +E L G+ T++ +  +Q+     +H   D  N+      INA  + A    S+G +  L 
Sbjct: 1138 QETLGGMSTIRGY-NQQRRFDHINHCRIDN-NMSAFYPSINANRWLAFRLESIGSVIILG 1195

Query: 366  VLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRL---FELT 422
                  Y + QG LT G +   + Y      ++  +     E+   + +  R+    EL 
Sbjct: 1196 AATLSIYRLGQGTLTAGMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYSELK 1255

Query: 423  DRVP-SIKPTTGKKFVPGKGEIVFKDVTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGPS 480
               P  I+        P  G+I F   +  Y  RP  +++ RD+++ I     + +VG +
Sbjct: 1256 SEAPLVIEEKRPAAHWPDSGDIRFDHYSTRY--RPELDLVLRDVNLHIKPREKIGIVGRT 1313

Query: 481  GRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNIT 540
            G GKS++ L L R    SSG I IDG  I ++ +  LR ++ ++ Q+  +  GT+R+N+ 
Sbjct: 1314 GAGKSSLTLALFRIVEASSGGIVIDGVRIDEIGLHDLRHNLSIIPQDSQVFQGTIRENV- 1372

Query: 541  YGLTETPSKEEIRMVAKQCFCHNFIVKF-PHGYDTVIGPQGALLSGGQKQRIAIARALIK 599
               TET + +EI  V +    +  +    P G    +   G+ LS GQ+Q + +ARAL+ 
Sbjct: 1373 -DPTETYTDDEIWRVLELSHLNRHVESMGPRGLLNEVNEGGSNLSVGQRQLMCLARALLV 1431

Query: 600  KPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDG 659
               IL+LDEAT+A+DVE++  I  T     + +  TI++IAHR++TI  S+ I+VL + G
Sbjct: 1432 PSKILILDEATAAVDVETDQVIQETIRSAFRDR--TILTIAHRINTIMDSDRIVVL-DGG 1488

Query: 660  SVVE 663
             V E
Sbjct: 1489 RVTE 1492

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 99/415 (23%), Positives = 182/415 (43%), Gaps = 36/415 (8%)

Query: 270 LLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHR 329
           +LL+ TP   F A I  ++++ +    ++   + T V  E L+ +++++ +  E+    +
Sbjct: 453 ILLVMTPLNTFLAKI-QKRLQKSQMGFKD---ERTSVISEILNNIKSLKLYAWEEPYKKK 508

Query: 330 YSHAIRD--IFNVGKRAAY--INAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLT 385
             H   D  + N+ K   +  I +  F     L       V  Y     L   L    LT
Sbjct: 509 LEHVRNDKELKNLTKLGCFMAITSFQFNVVPFLVSCCTFAVFVYTEDRALTVDLVFPALT 568

Query: 386 AFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFE-LTDRVPSIKPTTGKKFVPGKGEIV 444
            F L +      +F + +  +  ++   + TRLF  LT+             V   G++ 
Sbjct: 569 LFNLLS----FPLFVIPNVMTSFIEASVSVTRLFNFLTNEELQKDSVQRLPKVTNVGDVA 624

Query: 445 FK---DVTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSG 500
            K   D TF +  +P   V  ++++ +   G   CVVG  G GKS +   L       SG
Sbjct: 625 VKVGDDATFLWRRKPEYKVALKNINFEAKKGQLTCVVGRVGSGKSALIQSL-------SG 677

Query: 501 QIF-IDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQC 559
            +F + G         ++   +  V Q   +M+GT+++NI +G    P  E      K C
Sbjct: 678 DLFRVKG-------FATVHGSVAYVSQVAWIMNGTVKENILFGHRYDP--EFYDKTIKAC 728

Query: 560 FCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVE-SE 618
                +     G +T++G +G  LSGGQK R+++ARA+  +    +LD+  +A+D    +
Sbjct: 729 ALTIDLAVLVDGDETLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVGK 788

Query: 619 GAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFAD 673
             + +  G     ++ T +   +++S +  ++ I +L N G +VE G + E+ AD
Sbjct: 789 HLLEHVLGPTGLLRTKTKILATNKISVLSIADRIALLEN-GEIVEQGSYDEVTAD 842

>NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] {ON}
            Anc_8.303
          Length = 1517

 Score =  130 bits (326), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 111/375 (29%), Positives = 189/375 (50%), Gaps = 19/375 (5%)

Query: 308  EEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVL 367
            +E L G+ T++ +  +QK   + +    D  N+      +NA  + A   L  I  +++L
Sbjct: 1136 QETLGGIVTIRGY-GQQKRFSQINQCRVD-NNMSAFYPSVNANRWLAYR-LELIGSIIIL 1192

Query: 368  AYGSYLVL---QGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTD- 423
               +  V+   QG LT G +   + Y      S+  +     E+   + +  R+ E  D 
Sbjct: 1193 GAATLSVMRLKQGTLTAGMVGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYADL 1252

Query: 424  --RVPSI-KPTTGKKFVPGKGEIVFKDVTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGP 479
                P I +    ++  P +G+I F+  +  Y  RP  +++ +D++  I     + +VG 
Sbjct: 1253 KSEAPEIIEDHRPQETWPEEGDIKFEHYSTRY--RPELDLVLKDINFHIKPKEKIGIVGR 1310

Query: 480  SGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNI 539
            +G GKS++ L L R    S G I ID  DIS + +  LR  + ++ Q+  +  GT+R+NI
Sbjct: 1311 TGAGKSSLTLALFRIIEASEGNIIIDNVDISDIGLYDLRHKLSIIPQDSQVFEGTIRENI 1370

Query: 540  TYGLTETPSKEEIRMVAKQCFCHNFIVKF-PHGYDTVIGPQGALLSGGQKQRIAIARALI 598
                T   + E+I  V +     + I      G DT +   G+ LS GQ+Q + +ARAL+
Sbjct: 1371 --DPTNQYTDEQIWRVLELSHLRDHIATMGGDGLDTKLNEGGSNLSVGQRQLMCLARALL 1428

Query: 599  KKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGND 658
                ILVLDEAT+A+DVE++  +  T     K +  TI++IAHR++TI  ++ I+VL N 
Sbjct: 1429 VPSKILVLDEATAAVDVETDKVLQETIRTSFKDR--TILTIAHRINTIMDNDRIMVLDN- 1485

Query: 659  GSVVETGKFKELFAD 673
            GS+ E  + K+L  +
Sbjct: 1486 GSIKEFDEPKKLLEN 1500

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 96/402 (23%), Positives = 175/402 (43%), Gaps = 46/402 (11%)

Query: 292 TSTDLQEATGQL----TRVSEEQLSGVRTVQSFVAE-----QKEIHRYSHAIRDIFNVGK 342
           T   LQ++  Q     TRV  E L+ +++++ +  E     + E  R +  ++++  +G 
Sbjct: 467 TQKKLQKSQMQFKDERTRVISEILNNIKSLKLYAWETPYKAKLENVRNNKELKNLTKLGC 526

Query: 343 RAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLT 402
             A ++ QF      L   S   V  Y     L   L    LT F L        +  + 
Sbjct: 527 YMALMSFQF-NVVPFLVSCSTFAVFVYTEDRPLTTDLVFPALTLFNL----LHFPLMVIP 581

Query: 403 SFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGKGEI------VFKDVTFSYPTRP 456
           +  + L++   +  RLF         K +  +  +P   EI      V  D TF +  +P
Sbjct: 582 NVLTALIECSVSVGRLFSFLTNEELQKDSVQR--LPKVTEIGDVAINVGDDATFLWQRKP 639

Query: 457 G-NVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIF-IDGQDISKLNI 514
              V  ++++ +   G   C+VG  G GKS +   +L       G +F + G        
Sbjct: 640 EYKVALKNVNFQAKKGELTCIVGRVGSGKSALIQSIL-------GDLFRVKG-------F 685

Query: 515 KSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDT 574
            ++  ++  V Q   +M+GT++DNI +G       E      K C     +     G  T
Sbjct: 686 ATIHGNVAYVSQVAWIMNGTVKDNILFG--HKYDAEFYEKTIKACALTIDLSVLVDGDQT 743

Query: 575 VIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVE-SEGAINYTFGQ--LMKS 631
           ++G +G  LSGGQK R+++ARA+  +    +LD+  +A+D   +   I +  G   L+ +
Sbjct: 744 LVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHT 803

Query: 632 KSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFAD 673
           K  T V   +++S +  ++++ +L N G +V+ G + E+  D
Sbjct: 804 K--TKVLATNKVSVLSVADSVSLLEN-GEIVQQGSYDEIMKD 842

>YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Plasma
            membrane ATP-binding cassette (ABC) transporter,
            multidrug transporter mediates export of many different
            organic anions including oligomycin; similar to human
            cystic fibrosis transmembrane receptor (CFTR)
          Length = 1477

 Score =  130 bits (326), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 91/269 (33%), Positives = 144/269 (53%), Gaps = 25/269 (9%)

Query: 412  VGAATRL-FELTDRVPSIKPTTGKKFVPGKGEIVFKDVTFSYPTRPG-NVIFRDMDIKIP 469
            V  AT L  E + R P + P       P  GEI+F++V F+Y  RPG  ++ +++++ I 
Sbjct: 1184 VTYATELPLEASYRKPEMTPPES---WPSMGEIIFENVDFAY--RPGLPIVLKNLNLNIK 1238

Query: 470  AGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPV 529
            +G  + + G +G GKSTI   L R    ++G+I ID  DIS+L +  LRR + ++ Q+PV
Sbjct: 1239 SGEKIGICGRTGAGKSTIMSALYRLNELTAGKILIDNVDISQLGLFDLRRKLAIIPQDPV 1298

Query: 530  LMSGTLRDNITYGLTETP-------------SKEEIRMVAKQCFCHNFIVKFPHGY--DT 574
            L  GT+R N+      T              +K+++  V  Q    N      H +  D 
Sbjct: 1299 LFRGTIRKNLDPFNERTDDELWDALVRGGAIAKDDLPEVKLQKPDENGTHGKMHKFHLDQ 1358

Query: 575  VIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSV 634
             +  +G+  S G++Q +A+ RAL+++  IL+LDEATS++D E++G I     +  +    
Sbjct: 1359 AVEEEGSNFSLGERQLLALTRALVRQSKILILDEATSSVDYETDGKIQTRIVE--EFGDC 1416

Query: 635  TIVSIAHRLSTIRRSENIIVLGNDGSVVE 663
            TI+ IAHRL TI   + I+VL   G V E
Sbjct: 1417 TILCIAHRLKTIVNYDRILVL-EKGEVAE 1444

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 65/214 (30%), Positives = 110/214 (51%), Gaps = 22/214 (10%)

Query: 461 FRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRH 520
           F+D++  I  G  + + GP G GKS++   +      + G++ ++G D+           
Sbjct: 604 FKDLNFDIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKVEVNG-DL----------- 651

Query: 521 IGLVQQEPVLMSGTLRDNITYGLTETP-SKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQ 579
             L+   P + + ++RDNI +G   +P +KE+   V + C     +   P G  T IG +
Sbjct: 652 --LMCGYPWIQNASVRDNIIFG---SPFNKEKYDEVVRVCSLKADLDILPAGDMTEIGER 706

Query: 580 GALLSGGQKQRIAIARALIKKPTILVLDEATSALDVE-SEGAINYTFGQLMKSKSVTIVS 638
           G  LSGGQK RI +AR++ KK  I + D+  SA+D    +  ++     ++ +K+  + +
Sbjct: 707 GITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLANKTRILAT 766

Query: 639 IAHRLSTIRRSENIIVLGNDGSVVETGKFKELFA 672
             H+LS I R+  +IVLG DG  V+ G   EL A
Sbjct: 767 --HQLSLIERASRVIVLGTDGQ-VDIGTVDELKA 797

>Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W
           (REAL)
          Length = 990

 Score =  129 bits (325), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 142/560 (25%), Positives = 247/560 (44%), Gaps = 38/560 (6%)

Query: 136 LKTGLETNEGKDGPISMADVPPIFMGYSIYEFLG-GFAALMVFGIVANYGRIVLLRILSE 194
           LK   E+NE K+G         ++M   +Y  LG G AA        N   I++L   S 
Sbjct: 430 LKYWSESNE-KNGS-----NERVWMFVGVYSLLGVGSAAF------NNLRSIIMLLYCSI 477

Query: 195 RVVARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXX 254
           R   +L  N+ K  I     FF+   VG +I+R  SD   V  S+    S  FK+++   
Sbjct: 478 RGSKKLHENMAKSVIRSPMVFFETTPVGRIINRFSSDMDAVDSSLQYVFSFFFKSILTYL 537

Query: 255 XXXXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGV 314
                     P      +      ++  + +    R+    +  +   +  +  E L+G 
Sbjct: 538 VTIVLVGYNMPWFLVFNMFLLVIYIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGY 597

Query: 315 RTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLG-DISFLVVLAYGSYL 373
             + ++   ++ I+     I+   ++      IN        ++G  I     L   + +
Sbjct: 598 SIIDAYNHYERFIYLNYDKIQSNIDLVFNFRSINRWLSVRLQTIGATIVLATALLALATI 657

Query: 374 VLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVP---SIKP 430
             +  L+ G +   M Y+    SS+  +      +   + +  R+ E  +  P   SI P
Sbjct: 658 NTKNQLSSGMVGLLMAYSFEVTSSLTWIVRTTVMIETNIVSVERIVEYCELPPEAQSINP 717

Query: 431 TTG-KKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIAL 489
                +  P +G I FK+ +  Y      V+ +D+++ I     + +VG +G GKST++L
Sbjct: 718 EKRPDENWPSEGRIEFKNYSTKYRENLDPVL-KDINVSIQPCEKIGIVGRTGAGKSTLSL 776

Query: 490 LLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNIT----YGLTE 545
            L R   PS G+I ID  +IS+L +  LR ++ ++ Q+     GT+R N+     Y   E
Sbjct: 777 ALFRILEPSEGEIIIDDVNISELGLFDLRSNLAIIPQDAQAFEGTVRTNLDPFNRYSEDE 836

Query: 546 TPSKEEI--------RMVAKQCFCHNFIVKFPHG----YDTVIGPQGALLSGGQKQRIAI 593
                E+        +M+  +   ++  V+         D  I   G+ LS GQ+Q + +
Sbjct: 837 LKRAIELAHLKSHLEKMLGNEAENNDINVEERGNAKDILDVKINENGSNLSVGQRQLLCL 896

Query: 594 ARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENII 653
           ARAL+    ILVLDEAT+++D+E++  I  T  +  K +  TI++IAHR+ T+  S+ II
Sbjct: 897 ARALLSHSKILVLDEATASVDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKII 954

Query: 654 VLGNDGSVVETGKFKELFAD 673
           VL + G+V E     +L +D
Sbjct: 955 VL-DKGNVKEFDSPSKLLSD 973

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 65/204 (31%), Positives = 105/204 (51%), Gaps = 18/204 (8%)

Query: 471 GSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI-FIDGQDIS---KLNIKSLRRHIGLVQQ 526
           G  +CVVG  G GKST    +L       GQ+  + G   S   KL I++    +    Q
Sbjct: 94  GDLICVVGRVGAGKSTFLKAIL-------GQLPCMSGSKESLAPKLIIRA--SSLAYCSQ 144

Query: 527 EPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGG 586
           E  +M+ ++R+NI +G      K    +  K C     +   P G +T++G +G  LSGG
Sbjct: 145 ESWIMNASVRENILFG--HKFDKAYYDLTIKACQLLPDLKILPDGDETLVGEKGISLSGG 202

Query: 587 QKQRIAIARALIKKPTILVLDEATSALDVE-SEGAINYTF-GQLMKSKSVTIVSIAHRLS 644
           QK R+++ARA+  +  I +LD+  SA+D E S+  I +   G+    K+ TI+   + +S
Sbjct: 203 QKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKTALLKNKTIILTTNTVS 262

Query: 645 TIRRSENIIVLGNDGSVVETGKFK 668
            ++ S+ I  L N G +VE G ++
Sbjct: 263 ILKHSQMIYALEN-GEIVEQGNYE 285

>YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}
            YBT1Transporter of the ATP-binding cassette (ABC) family
            involved in bile acid transport; similar to mammalian
            bile transporters
          Length = 1661

 Score =  130 bits (326), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 123/495 (24%), Positives = 222/495 (44%), Gaps = 54/495 (10%)

Query: 204  VIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSI 263
            ++ K +H    FFD    G +++R   D   + + +T  +   F +LI           I
Sbjct: 1141 ILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFI 1200

Query: 264  SPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAE 323
            +PQ   + ++ +    F    +    R+       +   + +   E L GV T+++F  E
Sbjct: 1201 TPQFLSVAIVVSILYYFVGYFYMAGSRELKRFESISRSPIYQHFSETLVGVTTIRAFGDE 1260

Query: 324  ----QKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLV----- 374
                Q+ +H+     +  F +     ++  +       +  I  LV+   G +++     
Sbjct: 1261 GRFMQENLHKIDENNKPFFYLWVANRWLAFR-------IDMIGSLVIFGAGLFILFNINN 1313

Query: 375  LQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGK 434
            L  G+    LT  + +TE        L   YSE+   + +  R+ E  +     +P    
Sbjct: 1314 LDSGMAGISLTYAISFTE----GALWLVRLYSEVEMNMNSVERVKEYME--IEQEPYNEH 1367

Query: 435  KFVP-----GKGEIVFKDVTFSY-PTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIA 488
            K +P       G+I   D++  Y P  P   + +++   + A S + +VG +G GKSTI 
Sbjct: 1368 KEIPPPQWPQDGKIEVNDLSLRYAPNLPR--VIKNVSFSVDAQSKIGIVGRTGAGKSTII 1425

Query: 489  LLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNI--------- 539
              L RF  P +G I ID  DIS ++++ LRR I ++ Q+P L SGT++ N+         
Sbjct: 1426 TALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDR 1485

Query: 540  ----TYGLTETPSKEEI-----RMVAKQCFCHN--FIVKFPHGYDTVIGPQGALLSGGQK 588
                        S+E++     R  + +    N   + KF     + I   G+ LS GQ+
Sbjct: 1486 QIFEALKRVNLISEEQLQQGATRETSNEASSTNSENVNKFL-DLSSEISEGGSNLSQGQR 1544

Query: 589  QRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRR 648
            Q + +AR+L++ P I++LDEAT+++D  S+  I  T  +  +    TI++IAHRL ++  
Sbjct: 1545 QLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRKEFQGS--TILTIAHRLRSVID 1602

Query: 649  SENIIVLGNDGSVVE 663
             + I+V+ + G V E
Sbjct: 1603 YDKILVM-DAGEVKE 1616

 Score = 87.4 bits (215), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 113/234 (48%), Gaps = 11/234 (4%)

Query: 438 PGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNP 497
           P      F++ T S+     +   +D++I+   G    V+GP+G GK+++ + LL     
Sbjct: 689 PNGNRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 498 SSGQIFIDGQDISK---LNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKE-EIR 553
            +G++ +   +  +   ++       I    Q   L++ T+++NI +    +P  E   +
Sbjct: 749 LNGKVVVPALEPRQELIVDANGTTNSIAYCSQAAWLLNDTVKNNILFN---SPFNEARYK 805

Query: 554 MVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSAL 613
            V + C           G  T IG +G  LSGGQKQR+++ARAL      ++LD+  SA+
Sbjct: 806 AVVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAV 865

Query: 614 DVESEGAI--NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETG 665
           D  +   I  N   G LM+ ++  +VS  H ++   R+  ++VL  DG V + G
Sbjct: 866 DSHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRVKDQG 917

>ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} similar
            to uniprot|P14772 Saccharomyces cerevisiae YLL015W BPT1
            ABC type transmembrane transporter of MRP/CFTR family
            found in vacuolar membrane involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates along with Ycf1p
          Length = 1570

 Score =  130 bits (326), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 140/538 (26%), Positives = 242/538 (44%), Gaps = 62/538 (11%)

Query: 164  IYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRANVIKKTIHQDSE-FFDRHKVG 222
            +++F+G +A L +     +  R V++ + S    +++  N +  ++ +    FF+   +G
Sbjct: 1025 LWKFVGIYALLGISSAAFDNIRAVIILLYSSIRGSKVLHNKMAVSVLKSPMGFFESTPIG 1084

Query: 223  DLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSA 282
             +I+R  SD   V R++    +  FK ++             P      L+F   +L   
Sbjct: 1085 RIINRFSSDMSTVDRNLKYNFAFFFKCVLDYFVTILLIGYNMP----WFLVFNAGLLVVY 1140

Query: 283  SIFGRKIRDTSTDLQE----ATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIF 338
              +       S +L+     A   +  +  E L G   + +F        R+S       
Sbjct: 1141 VYYQVFYVTLSRELKRLSSTAFSPIMSLFSETLGGHMVITAF--------RHSERFH-FL 1191

Query: 339  NVGKRAAYINAQF-FTATSSLGDISFLVVLAYGSYLVLQGGL----TIG---DLTA---- 386
            N  K    I+AQF   +T+    I   ++   G  +VL   L    TIG    +TA    
Sbjct: 1192 NFNKTQFQIDAQFNLRSTNRWLSIRLQII---GGAMVLITALLTLATIGTKKQMTAGLVG 1248

Query: 387  -FMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPS-----IKPTTGKKFVPGK 440
              M Y     +S+  +    + +   + +  R++E   ++PS     I+ +  +K  P  
Sbjct: 1249 LLMSYVLQVTNSLMWIVRMTTMIETNIISVERIYEYC-QLPSEAPAIIESSRPEKSWPSM 1307

Query: 441  GEIVFKDVTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSS 499
            GEI+FKD +  Y  RP  + + + +++ I     + VVG +G GKS+++L L R    + 
Sbjct: 1308 GEIIFKDYSTKY--RPELDPVLKKINLSIKPREKIGVVGRTGAGKSSLSLALFRLLESTG 1365

Query: 500  GQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQC 559
            G I IDG DISK+ +  LR H+ ++ Q+     GT+R N+        S +EI    +  
Sbjct: 1366 GSIEIDGVDISKIGLYDLRSHLSIIPQDAQAFEGTVRSNL--DPFNQYSVQEIWKAVELA 1423

Query: 560  FCHNFIVKF----------PH----GYDTVIGPQGALLSGGQKQRIAIARALIKKPTILV 605
                 I+K           P       D  I   G  +S GQ+Q + ++RAL+ K  +LV
Sbjct: 1424 HLKPHIIKMMTDEDPDKSSPEDEISALDVKISENGNNMSMGQRQLLCLSRALLSKSKVLV 1483

Query: 606  LDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVE 663
            LDEAT+A+D+E++  I  T     + K  TI++IAHR+ T+  S+ I+VL + G V E
Sbjct: 1484 LDEATAAVDMETDQIIQETIRNEFQDK--TILTIAHRIDTVLDSDKILVL-DKGEVKE 1538

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 72/261 (27%), Positives = 123/261 (47%), Gaps = 21/261 (8%)

Query: 418 LFELTDRVPSIKPT---TGKKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMD-IKIPAGSN 473
           + EL D V   KPT       F+  + E   K            V   ++D  +   G+ 
Sbjct: 611 IHELKDEVDGPKPTIEVNNATFL-WQSEKTLKSNDEEANVGSSQVALENIDHFEAKKGAL 669

Query: 474 VCVVGPSGRGKSTIALLLLRFYNPSSG-QIFIDGQDISKLNIKSLRRHIGLVQQEPVLMS 532
            CVVG  G GKST+   +L      SG + FI  + + +       R +    Q P +M+
Sbjct: 670 TCVVGRVGSGKSTLLRAILGQLPCRSGPKEFISPEILVR------ARSVAYCPQAPWVMN 723

Query: 533 GTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIA 592
            +++DNI +G      +    +  K C     +     G +T++G +G  LSGGQK R++
Sbjct: 724 ASIKDNILFG--HRYDETYYNLTIKACQLIPDLKILSEGDETLVGEKGISLSGGQKARLS 781

Query: 593 IARALIKKPTILVLDEATSALDVE-SEGAINYTFGQ---LMKSKSVTIVSIAHRLSTIRR 648
           +ARA+  +  + ++D+  SA+D E S+  I+   G+   L+K K  TI+   + +S ++ 
Sbjct: 782 LARAVYSRADLYLMDDILSAVDAEVSKNIIDKVLGEENGLLKHK--TIILTTNAVSVLKH 839

Query: 649 SENIIVLGNDGSVVETGKFKE 669
           S N+I     G +VE G +++
Sbjct: 840 S-NMIYALQGGRIVEEGTYEQ 859

>Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  130 bits (326), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 125/491 (25%), Positives = 220/491 (44%), Gaps = 46/491 (9%)

Query: 204  VIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSI 263
            ++ K +H    FFD    G +++R   D   + + +T  +   F +LI           I
Sbjct: 1141 ILNKVLHSKLRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFI 1200

Query: 264  SPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAE 323
            +PQ   + ++ +    F    +    R+       +   + +   E L GV T+++F  E
Sbjct: 1201 TPQFLSVAIVVSIMYYFIGYFYMAGSRELKRYESISRSPIYQHFSETLVGVTTIRAFGDE 1260

Query: 324  QKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLV-----LQGG 378
             + +      ++ I    K   Y+          +  I  LV+   G +++     L  G
Sbjct: 1261 GRFMQE---NLQKIDENNKPFFYLWVANRWLAFRIDMIGSLVIFGAGLFILSNIDHLDSG 1317

Query: 379  LTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVP 438
            +    LT  + +TE        L   YSE+   + +  R+ E  +     +P    K VP
Sbjct: 1318 MAGISLTYAISFTE----GALWLVRLYSEVEMNMNSVERVKEYME--IEQEPYNQHKEVP 1371

Query: 439  -----GKGEIVFKDVTFSY-PTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLL 492
                   G+I   D++  Y P  P   + +++   + A S V +VG +G GKSTI   L 
Sbjct: 1372 PPQWPQDGKIEVNDLSLRYAPNLPR--VIKNVSFSVDAQSKVGIVGRTGAGKSTIITALF 1429

Query: 493  RFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNI------------- 539
            RF  P +G I ID  DIS ++++ LRR I ++ Q+P L SGT++ N+             
Sbjct: 1430 RFLEPDTGHIKIDNIDISNVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYNEFSNQKIFE 1489

Query: 540  TYGLTETPSKEE-----IRMVAKQCFCHN--FIVKFPHGYDTVIGPQGALLSGGQKQRIA 592
                    S+E+     +R VA      +   + KF    ++ +   G+ LS GQ+Q + 
Sbjct: 1490 ALKRVNLVSEEQLQQGTVREVATDTSSADSENVNKFL-DLESEVSEGGSNLSQGQRQLMC 1548

Query: 593  IARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENI 652
            +AR+L++ P I++LDEAT+++D  S+  I  T  +  +    TI++IAHRL ++   + I
Sbjct: 1549 LARSLLRSPKIILLDEATASIDYSSDAKIQETIRKEFQGS--TILTIAHRLRSVIDYDKI 1606

Query: 653  IVLGNDGSVVE 663
            +V+ + G V E
Sbjct: 1607 LVM-DAGEVKE 1616

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 65/235 (27%), Positives = 111/235 (47%), Gaps = 13/235 (5%)

Query: 438 PGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNP 497
           P      F++ T S+     +   +D++I+   G    V+GP+G GK+++ + LL     
Sbjct: 689 PNGKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 498 SSGQIFIDGQDISK---LNIKSLRRHIGLVQQEPVLMSGTLRDNITYG--LTETPSKEEI 552
            +G++ +   D  +   +        I    Q   L++ T+++NI +     ET  K   
Sbjct: 749 LNGKVVVPALDPRQELVVEANGTTNSIAYCSQAAWLLNDTVKNNILFNSQFNETRYKA-- 806

Query: 553 RMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSA 612
             V + C           G  T IG +G  LSGGQKQR+++ARAL      ++LD+  SA
Sbjct: 807 --VVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSA 864

Query: 613 LDVESEGAI--NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETG 665
           +D  +   I  N   G LM+ ++  +VS  H ++   R+  ++VL  DG V + G
Sbjct: 865 VDSHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRVKDQG 917

>Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  129 bits (325), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 129/508 (25%), Positives = 231/508 (45%), Gaps = 22/508 (4%)

Query: 167  FLGGFAALMVFGIVANYGRIVLLRILSERVVARLRANVIKKTI-HQDSEFFDRHKVGDLI 225
            +L  + AL +   +A   + ++L +      ++   N++  ++      FF+   +G ++
Sbjct: 992  YLAIYFALGIGSALATLIQTIILWVFCTIHASKYLHNLMTNSVLRAPMTFFETTPIGRIL 1051

Query: 226  SRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIF 285
            +R  +D Y V   + +  S  F   +          + + Q   +++      ++    +
Sbjct: 1052 NRFSNDIYKVDALLGRTFSQFFVNAVKVTFTITVICATTWQFIFIIIPLGVFYIYYQQYY 1111

Query: 286  GRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAA 345
             R  R+           +    +E L G+ TV+ + ++QK   R+SH  +   +    A 
Sbjct: 1112 LRTSRELRRLDSITRSPIYSHFQETLGGLATVRGY-SQQK---RFSHINQCRIDNNMSAF 1167

Query: 346  Y--INAQFFTAT--SSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGL 401
            Y  INA  + A     +G I  L       + + QG LT G +   + Y      ++  +
Sbjct: 1168 YPSINANRWLAYRLELIGSIIILGAATLSVFRLKQGTLTSGMVGLSLSYALQITQTLNWI 1227

Query: 402  TSFYSELMQGVGAATRLFELTDRVPS----IKPTTGKKFVPGKGEIVFKDVTFSYPTRPG 457
                 E+   + +  R+ E  D        I+     K  P +G+I F + +  Y  RP 
Sbjct: 1228 VRMTVEVETNIVSVERIKEYADLKSEAPLIIEGHRPPKQWPAQGDIRFNNYSTRY--RPE 1285

Query: 458  -NVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKS 516
             +++ + ++I I     V +VG +G GKS++ L L R    S G I IDG  I+++ +  
Sbjct: 1286 LDLVLKQINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVIDGVSINEIGLYD 1345

Query: 517  LRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPH-GYDTV 575
            LR  + ++ Q+  +  GT+R+NI        S E I    +       ++   + G D  
Sbjct: 1346 LRHKLSIIPQDSQVFEGTVRENI--DPINQYSDEAIWRALELSHLKEHVLSMSNDGLDAQ 1403

Query: 576  IGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVT 635
            +   G+ LS GQ+Q + +ARA++    ILVLDEAT+A+DVE++  +  T     K +  T
Sbjct: 1404 LSEGGSNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVETDKVVQETIRTAFKDR--T 1461

Query: 636  IVSIAHRLSTIRRSENIIVLGNDGSVVE 663
            I++IAHRL+TI  S+ IIVL N G V E
Sbjct: 1462 ILTIAHRLNTIMDSDRIIVLDN-GKVAE 1488

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 90/385 (23%), Positives = 172/385 (44%), Gaps = 40/385 (10%)

Query: 304 TRVSEEQLSGVRTVQSFVAEQK-----EIHRYSHAIRDIFNVGKRAAYINAQFFTATSSL 358
           TRV  E L+ +++++ +  E+      E  R +  ++++  +G   A  + QF      +
Sbjct: 485 TRVISEILNNIKSLKLYAWEKPYREKLEEVRNNKELKNLTKLGCYMAVTSFQFNIVPFLV 544

Query: 359 GDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRL 418
              +F  V  Y     L   L    LT F L +         L SF    ++   +  RL
Sbjct: 545 SCCTF-AVFVYTEDRALTTDLVFPALTLFNLLSFPLMIIPMVLNSF----IEASVSIGRL 599

Query: 419 FELTDRVPSIKPTTGKKF--VPGKGEIVFK---DVTFSYPTRPG-NVIFRDMDIKIPAGS 472
           F        ++P + ++   V   G+I      D TF +  +P   V  +++D +   G+
Sbjct: 600 FSFFTN-EELQPDSVQRLPNVENIGDIAINIGDDATFLWQRKPEYKVALKNIDFQATKGN 658

Query: 473 NVCVVGPSGRGKSTIALLLLRFYNPSSGQIF-IDGQDISKLNIKSLRRHIGLVQQEPVLM 531
             C+VG  G GK+ +   +L       G +F + G         ++   I  V Q P +M
Sbjct: 659 LTCIVGKVGSGKTALLSCML-------GDLFRVKG-------FATVHGCIAYVSQVPWIM 704

Query: 532 SGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRI 591
           +GT+++NI +G       E      K C     +     G  T++G +G  LSGGQK R+
Sbjct: 705 NGTVKENILFG--HKYDAEFYEKTIKACALTIDLAILMDGDKTLVGEKGISLSGGQKARL 762

Query: 592 AIARALIKKPTILVLDEATSALDVE-SEGAINYTFGQ--LMKSKSVTIVSIAHRLSTIRR 648
           ++ARA+  +    +LD+  +A+D   +   I +  G   L+ +K+  + +  +++S +  
Sbjct: 763 SLARAVYSRADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKTRILAT--NKVSALSI 820

Query: 649 SENIIVLGNDGSVVETGKFKELFAD 673
           +++I +L N G +++ G + ++  D
Sbjct: 821 ADSIALLDN-GEIIQQGAYSDITKD 844

>YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON}
            YCF1Vacuolar glutathione S-conjugate transporter; member
            of the ATP-binding cassette family; has a role in
            detoxifying metals such as cadmium, mercury, and
            arsenite; also transports unconjugated bilirubin,
            selenodigluthatione, and oxidized glutathione; similar to
            human cystic fibrosis protein CFTR
          Length = 1515

 Score =  128 bits (321), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 123/469 (26%), Positives = 216/469 (46%), Gaps = 21/469 (4%)

Query: 215  FFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLF 274
            FF+   +G +++R  +D Y V   + +  S  F   +          + + Q   +++  
Sbjct: 1040 FFETTPIGRILNRFSNDIYKVDALLGRTFSQFFVNAVKVTFTITVICATTWQFIFIIIPL 1099

Query: 275  TPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAI 334
            +   ++    + R  R+           +    +E L G+ TV+ + ++QK   R+SH  
Sbjct: 1100 SVFYIYYQQYYLRTSRELRRLDSITRSPIYSHFQETLGGLATVRGY-SQQK---RFSHIN 1155

Query: 335  RDIFNVGKRAAY--INAQFFTAT--SSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLY 390
            +   +    A Y  INA  + A     +G I  L       + + QG LT G +   + Y
Sbjct: 1156 QCRIDNNMSAFYPSINANRWLAYRLELIGSIIILGAATLSVFRLKQGTLTAGMVGLSLSY 1215

Query: 391  TEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGK-----KFVPGKGEIVF 445
                  ++  +     E+   + +  R+ E  D + S  P   +     K  P +G+I F
Sbjct: 1216 ALQITQTLNWIVRMTVEVETNIVSVERIKEYAD-LKSEAPLIVEGHRPPKEWPSQGDIKF 1274

Query: 446  KDVTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFI 504
             + +  Y  RP  +++ + ++I I     V +VG +G GKS++ L L R    S G I I
Sbjct: 1275 NNYSTRY--RPELDLVLKHINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVI 1332

Query: 505  DGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNF 564
            D   I+++ +  LR  + ++ Q+  +  GT+R+NI   + +   +   R +       + 
Sbjct: 1333 DNIAINEIGLYDLRHKLSIIPQDSQVFEGTVRENID-PINQYTDEAIWRALELSHLKEHV 1391

Query: 565  IVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYT 624
            +     G D  +   G  LS GQ+Q + +ARA++    ILVLDEAT+A+DVE++  +  T
Sbjct: 1392 LSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVETDKVVQET 1451

Query: 625  FGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFAD 673
                 K +  TI++IAHRL+TI  S+ IIVL N G V E     +L +D
Sbjct: 1452 IRTAFKDR--TILTIAHRLNTIMDSDRIIVLDN-GKVAEFDSPGQLLSD 1497

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 90/385 (23%), Positives = 170/385 (44%), Gaps = 40/385 (10%)

Query: 304 TRVSEEQLSGVRTVQSFVAEQK-----EIHRYSHAIRDIFNVGKRAAYINAQFFTATSSL 358
           TRV  E L+ +++++ +  E+      E  R +  ++++  +G   A  + QF      +
Sbjct: 484 TRVISEILNNIKSLKLYAWEKPYREKLEEVRNNKELKNLTKLGCYMAVTSFQFNIVPFLV 543

Query: 359 GDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRL 418
              +F  V  Y     L   L    LT F L +         L SF    ++   +  RL
Sbjct: 544 SCCTF-AVFVYTEDRALTTDLVFPALTLFNLLSFPLMIIPMVLNSF----IEASVSIGRL 598

Query: 419 FELTDRVPSIKPTTGKKF--VPGKGEIVFK---DVTFSYPTRPG-NVIFRDMDIKIPAGS 472
           F        ++P + ++   V   G++      D TF +  +P   V  ++++ +   G+
Sbjct: 599 FTFFTN-EELQPDSVQRLPKVKNIGDVAINIGDDATFLWQRKPEYKVALKNINFQAKKGN 657

Query: 473 NVCVVGPSGRGKSTIALLLLRFYNPSSGQIF-IDGQDISKLNIKSLRRHIGLVQQEPVLM 531
             C+VG  G GK+ +   +L       G +F + G         ++   +  V Q P +M
Sbjct: 658 LTCIVGKVGSGKTALLSCML-------GDLFRVKG-------FATVHGSVAYVSQVPWIM 703

Query: 532 SGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRI 591
           +GT+++NI +G       E      K C     +     G  T++G +G  LSGGQK R+
Sbjct: 704 NGTVKENILFG--HRYDAEFYEKTIKACALTIDLAILMDGDKTLVGEKGISLSGGQKARL 761

Query: 592 AIARALIKKPTILVLDEATSALDVE-SEGAINYTFGQ--LMKSKSVTIVSIAHRLSTIRR 648
           ++ARA+  +    +LD+  +A+D   +   I +  G   L+ +K  T V   +++S +  
Sbjct: 762 SLARAVYARADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTK--TKVLATNKVSALSI 819

Query: 649 SENIIVLGNDGSVVETGKFKELFAD 673
           +++I +L N G + + G + E+  D
Sbjct: 820 ADSIALLDN-GEITQQGTYDEITKD 843

>KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1568

 Score =  128 bits (321), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 134/525 (25%), Positives = 231/525 (44%), Gaps = 39/525 (7%)

Query: 164  IYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRANVIKKTI-HQDSEFFDRHKVG 222
            I++++  +A + V        R +++ +      ++L  N +  ++      FF+   VG
Sbjct: 1030 IWKYVAVYALIGVTSSAFELARTIIMMLFCSIRASKLFHNQMAHSVVMAPMSFFETTPVG 1089

Query: 223  DLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSA 282
             +++R  SD   +       +S  F++++             P      LLF   +L   
Sbjct: 1090 RIVNRFSSDVNSIDEDFQHIISFFFRSMLDYLITIVIITVSMPWF----LLFNTILLGIY 1145

Query: 283  SIFGRKIRDTSTDLQEATG----QLTRVSEEQLSGVRTVQSFVAEQKEIHRYSH------ 332
              +       S +L+  T      +  +  E L G   + ++  +   I  Y +      
Sbjct: 1146 YYYQTLYVVLSRELKRLTSISYSPVMSLLSETLGGHVVINAY--KHANIFNYYNFENIQT 1203

Query: 333  AIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLA-YGSYLVLQGGLTIGDLTAFMLYT 391
             I  IFN      +++ +  T  + +  I+ L+ LA  G+   +  GL IG L   M Y 
Sbjct: 1204 NINFIFNFRSTNRWLSMRLQTIGAVIVLITSLMALASLGTSNPISAGL-IGLL---MSYA 1259

Query: 392  EYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPS----IKPTTGKKFVPGKGEIVFKD 447
                SS+  +      +   + +  R+ E  D  P     I+ +   K  P +GEI F+ 
Sbjct: 1260 LQVSSSLMWIIRMAVNIETTIVSVERIIEYRDLKPEGIRVIEDSRPPKNWPKRGEITFEH 1319

Query: 448  VTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQ 507
             T  Y      V+ +D+D++I     + VVG +G GKST+ L L R   P  G+I IDG 
Sbjct: 1320 YTTKYRENLDPVL-KDIDLRIKHQEKIGVVGRTGAGKSTLTLALFRILEPFEGKITIDGI 1378

Query: 508  DISKLNIKSLRRHIGLVQQEPVLMSGTLRDNIT--YGLTETPSKEEIRMVAKQCFCHNFI 565
            DIS L +  LRR + ++ Q+     GT+R N+      T+    + + +   +      +
Sbjct: 1379 DISTLGLYDLRRSLSIIPQDAQAFEGTVRSNLDPFNRHTDAEIWKALELSHLKPHIERIV 1438

Query: 566  VKFPHG-------YDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESE 618
             + P          DT I   G  LS GQ+Q + ++RAL+    IL+LDEAT+A+D E++
Sbjct: 1439 SELPDDENKPTDLLDTQISDNGNNLSMGQRQLLCLSRALLNPSKILILDEATAAVDRETD 1498

Query: 619  GAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVE 663
              I  T     K +  TI++IAHR+ T+  S+ I+VL + G V E
Sbjct: 1499 KIIQETIRTAFKDR--TILTIAHRIDTVLDSDKIMVL-DKGEVKE 1540

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/207 (29%), Positives = 108/207 (52%), Gaps = 23/207 (11%)

Query: 475 CVVGPSGRGKSTIALLLLRFYNPSSGQI-FIDGQDISKLNIKSLRR--HIGLVQQEPVLM 531
           C+VG  G GKST    +L       GQ+  +     S +  K + R  ++    Q+P +M
Sbjct: 657 CIVGRVGSGKSTFLQAIL-------GQLPCVSSDSASGVKPKVVIRADNLAYCPQQPWIM 709

Query: 532 SGTLRDNITYGLT--ETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQ 589
           + +L+DNI +G    E   K+ I    K C     +   P G  T++G +G  LSGGQK 
Sbjct: 710 NASLKDNILFGYKYDEAMYKKTI----KACQLLPDLEILPDGDQTLVGEKGISLSGGQKA 765

Query: 590 RIAIARALIKKPTILVLDEATSALDVE-SEGAINYTFGQ---LMKSKSVTIVSIAHRLST 645
           R+++ARA+  +  + +LD+  SA+D    +  I+    +   L+K+K+V + + A  ++ 
Sbjct: 766 RLSLARAVYSRADLYLLDDVLSAVDSHVCKSIIDDVLDRQKGLLKNKTVILTTNA--VNV 823

Query: 646 IRRSENIIVLGNDGSVVETGKFKELFA 672
           +  S+ I +L N G +VE+  ++E+ +
Sbjct: 824 LVHSDMIYLLKN-GKIVESNSYEEVMS 849

>TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1465

 Score =  127 bits (320), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 85/241 (35%), Positives = 127/241 (52%), Gaps = 34/241 (14%)

Query: 438  PGKGEIVFKDVTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYN 496
            P KGEIVF+DV+F+Y  RPG  V+ + + + I +   + + G +G GKSTI   L R   
Sbjct: 1199 PSKGEIVFEDVSFAY--RPGLPVVLKGISLDIKSQEKIGICGRTGAGKSTIMSALYRLNE 1256

Query: 497  PSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETP--------- 547
             S G+IFID  DI ++ +  LR+ + ++ Q+PVL  GT+R N+     E P         
Sbjct: 1257 LSDGKIFIDSVDIGQIGLYDLRKKLSIIPQDPVLFRGTIRKNLD-PFQEHPDELLWKSLV 1315

Query: 548  -----SKEEIRMVAKQ--------CFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIA 594
                 S EE+ +V  Q           H F +      D  +  +GA  S G++Q +A+ 
Sbjct: 1316 SGGAISAEEVEVVKGQKPDSIGSLSSMHKFHL------DQKVEEEGANFSLGERQLLALT 1369

Query: 595  RALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIV 654
            RAL+++  IL+LDEATS++D E++  I             TI+ IAHRL TI   + I+V
Sbjct: 1370 RALVRQSKILILDEATSSVDYETDNKIQSRIAAAF--GDCTILCIAHRLKTILTYDRILV 1427

Query: 655  L 655
            L
Sbjct: 1428 L 1428

 Score = 93.6 bits (231), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 107/213 (50%), Gaps = 24/213 (11%)

Query: 461 FRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRH 520
           F++++I I  G  V + GP G GKS++   +  F   +SG + +DG D+           
Sbjct: 596 FKNLNIDIKKGDFVMITGPIGTGKSSLLSAMAGFMRKTSGTVEVDG-DL----------- 643

Query: 521 IGLVQQEPVLMSGTLRDNITYGLTETP-SKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQ 579
             L+   P + + T+RDNI +G   +P  KE    V + C     I   P G  T IG +
Sbjct: 644 --LMCGYPWIQNATVRDNIIFG---SPYDKERFDEVVRVCSLKADIDILPGGELTEIGER 698

Query: 580 GALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAI--NYTFGQLMKSKSVTIV 637
           G  LSGGQK RI +AR++ K   I + D+  SA+D      I      G+L   K  T +
Sbjct: 699 GITLSGGQKARINLARSVYKDKDIFLFDDVLSAVDSRVGKHIMDECLLGRL---KGKTRI 755

Query: 638 SIAHRLSTIRRSENIIVLGNDGSVVETGKFKEL 670
              H+LS I ++  +IVLG DGS  E GK ++L
Sbjct: 756 LATHQLSLIEKASVVIVLGVDGS-FEAGKLEDL 787

>Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {ON}
            complement(13248..17630) [4383 nt, 1461 aa]
          Length = 1460

 Score =  126 bits (317), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 108/334 (32%), Positives = 171/334 (51%), Gaps = 44/334 (13%)

Query: 347  INAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYS 406
            +  QF  + SS+G     V+L Y    VLQ    +  +   +  TE   +SV  L S+ +
Sbjct: 1123 VTRQFHISASSVG-----VLLTY----VLQLPGLLNTVLRALTQTENDMNSVERLVSYAT 1173

Query: 407  ELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGKGEIVFKDVTFSYPTRPG-NVIFRDMD 465
            EL           E   R P   P       P +G+I F++V+F+Y  RPG   + +++ 
Sbjct: 1174 ELPT---------EAAYRKPESSPDPS---WPQEGKIDFEEVSFAY--RPGLPAVLKNLS 1219

Query: 466  IKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQ 525
            + I  G  + + G +G GKSTI   L R     SG+I IDG +IS + +  LRR + ++ 
Sbjct: 1220 MSINGGEKIGICGRTGAGKSTIMSALYRLNELESGRIIIDGVNISNIGLFDLRRSLSIIP 1279

Query: 526  QEPVLMSGTLRDNIT-YG------LTETPS------KEEIRMVAKQCFCHNFIVKFPHGY 572
            Q+PVL  GT+R N+  +G      L +  S      KE +  V  Q    N  V+  H +
Sbjct: 1280 QDPVLFRGTIRKNLDPFGERSDDELWDALSRGGSIDKESLEEVKTQKSTGNSKVQELHKF 1339

Query: 573  --DTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMK 630
              D  +  +G+  S G++Q +A+ARAL++   +L+LDEATS++D E++  I     ++++
Sbjct: 1340 HLDQEVEEEGSNFSLGERQLLALARALVRNSKVLILDEATSSVDYETDNKIQ---NRIIE 1396

Query: 631  SKS-VTIVSIAHRLSTIRRSENIIVLGNDGSVVE 663
            + S  TI+ IAHRL TI   + I+VL   G + E
Sbjct: 1397 AFSECTILCIAHRLKTILNYDRILVL-EKGEIAE 1429

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 68/212 (32%), Positives = 105/212 (49%), Gaps = 22/212 (10%)

Query: 461 FRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRH 520
           F+D++++I  G  + + GP G GK+++   +      + G + I+G+             
Sbjct: 604 FKDINLEIHKGEFIMITGPIGTGKTSLLNAMSGLMEKTEGSVQINGE------------- 650

Query: 521 IGLVQQEPVLMSGTLRDNITYGLTETP-SKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQ 579
             L+   P + + T+RDNI +G   +P  K +  MV K C     +   P G  T IG +
Sbjct: 651 -LLMGGYPWIQNATVRDNIIFG---SPFDKSKYNMVVKACCLDADLDILPAGDMTEIGER 706

Query: 580 GALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAI-NYTFGQLMKSKSVTIVS 638
           G  LSGGQK RI +AR + K   I + D+  SA+D      I +     L+  K  T V 
Sbjct: 707 GINLSGGQKARINLARCVYKNKDIYLFDDVLSAVDSRVGKLIMDECLLGLLNGK--TRVL 764

Query: 639 IAHRLSTIRRSENIIVLGNDGSVVETGKFKEL 670
             H+LS +  +  +IVLGNDGS V+ G  +EL
Sbjct: 765 ATHQLSLVENASRVIVLGNDGS-VDIGTVEEL 795

>KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa]
            {ON} similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1516

 Score =  126 bits (317), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 122/458 (26%), Positives = 213/458 (46%), Gaps = 19/458 (4%)

Query: 215  FFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLF 274
            FF+   +G +++R  +D Y V   + +  +  F  ++            + Q   ++L  
Sbjct: 1043 FFETTPIGRILNRFSNDIYKVDEILGRTFAQFFANVVKVSFTIVVICMATWQFIFIVLPL 1102

Query: 275  TPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAI 334
            +   ++    + R  R+           +    +E L G+ T++ +  + + +H     +
Sbjct: 1103 SVLYIYYQQYYLRTSRELRRLDSVTRSPIYAHFQETLGGLTTIRGYSQQNRFVHINQTRV 1162

Query: 335  RDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQ---GGLTIGDLTAFMLYT 391
             +  N+      +NA  + A   L  I  +++LA     V++   G LT G +   + + 
Sbjct: 1163 DN--NMSAFYPSVNANRWLAFR-LEFIGSVIILAASMLAVIRLGNGTLTAGMIGLSLSFA 1219

Query: 392  EYTGSSVFGLTSFYSELMQGVGAATRL---FELTDRVPSI-KPTTGKKFVPGKGEIVFKD 447
                 S+  +     E+   + +  R+    EL    P I K        P  GEI F  
Sbjct: 1220 LQITQSLNWIVRMTVEVETNIVSVERIKEYAELKSEAPYIIKDHRPPASWPESGEIKF-- 1277

Query: 448  VTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDG 506
            V +S   RP   +I +D+D+ I     + +VG +G GKS++ L L R    +SG I IDG
Sbjct: 1278 VNYSTRYRPELELILKDIDLHIHPKEKIGIVGRTGAGKSSLTLALFRIIEAASGHIVIDG 1337

Query: 507  QDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIV 566
              I  + +  LR  + ++ Q+  +  GT+R+NI    T   + EEI          + I+
Sbjct: 1338 IPIDSIGLADLRHGLSIIPQDSQIFEGTVRENI--DPTNRYTDEEIWNALALSHLKDHIL 1395

Query: 567  KF-PHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTF 625
                +G +T++   G+ LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++  I  T 
Sbjct: 1396 GMGSNGLETMLTEGGSNLSVGQRQLMCLARALLISSNILILDEATAAVDVETDQLIQKTI 1455

Query: 626  GQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVE 663
                K +  TI++IAHR++TI  S+ IIVL + G V E
Sbjct: 1456 RNAFKER--TILTIAHRINTIMDSDRIIVL-DKGRVTE 1490

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 92/384 (23%), Positives = 165/384 (42%), Gaps = 45/384 (11%)

Query: 304 TRVSEEQLSGVRTVQSFVAEQKEIHRYSHA-----IRDIFNVGKRAAYINAQFFTATSSL 358
           TRV+ E L+ +++++ +  E     +  H      ++++  +G   A  N QF      L
Sbjct: 482 TRVTSEILNNIKSLKVYGWEIPYKAKLDHVRNEKELKNLKKMGCTLALANFQF-NIVPFL 540

Query: 359 GDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRL 418
              S   V  Y     L   L    LT F L +         ++SF    ++   +  RL
Sbjct: 541 VSCSTFAVFVYTEERPLSTDLVFPALTLFNLLSFPLAVVPNAISSF----IEASVSINRL 596

Query: 419 F------ELTD----RVPSIKPTTGKKFVPGKGEIVFKDVTFSYPTRPG-NVIFRDMDIK 467
           F      EL +    R P +K         G   +   D TF +  +P   V  ++++  
Sbjct: 597 FAFLTNEELQNDAVLREPKVKNI-------GDEGVKVNDATFLWQRKPEYKVALKNINFV 649

Query: 468 IPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQE 527
              G   C+VG  G GKS +   LL             G  I      ++   +  V Q 
Sbjct: 650 AKKGELTCIVGKVGSGKSALIQSLL-------------GDLIRVKGFATVHGDVANVSQV 696

Query: 528 PVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQ 587
           P +M+GT++DNI +G    P  E  ++  K C     +   P G  T++G +G  LSGGQ
Sbjct: 697 PWIMNGTVKDNILFGHKYDP--EFYQLTIKACALSIDLSMLPDGDQTLVGEKGISLSGGQ 754

Query: 588 KQRIAIARALIKKPTILVLDEATSALDVE-SEGAINYTFGQLMKSKSVTIVSIAHRLSTI 646
           K R+++ARA+  +    +LD+  +A+D   ++  I +  G      S T V   ++++ +
Sbjct: 755 KARLSLARAVYSRADTYLLDDPLAAVDEHVAKHLIEHVLGPHGLLHSKTKVLATNKITVL 814

Query: 647 RRSENIIVLGNDGSVVETGKFKEL 670
             +++I ++ N G +++ G + ++
Sbjct: 815 SIADSITLMEN-GEIIQQGSYDQV 837

>TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4.6
            YHL035C
          Length = 1649

 Score =  126 bits (317), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 122/489 (24%), Positives = 223/489 (45%), Gaps = 61/489 (12%)

Query: 204  VIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSI 263
            ++ + ++    FFD   +G +++R   D  V+   +   +   F   I           I
Sbjct: 1139 LLYRVVNSKLTFFDNTPIGRIMNRFSKDIQVLDSELAPFLDGVFSCFIQAVTALMLIVFI 1198

Query: 264  SPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQ--EATGQ--LTRVSEEQLSGVRTVQS 319
            +P+     L+    ++ S+   G      S +L+  E++ +  + +   E LSG+ T+++
Sbjct: 1199 TPKF----LIIAIFIICSSITIGYLYLCCSRELKRFESSSKSPVYQHFTETLSGLVTIRA 1254

Query: 320  FVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGD-ISF-------LVVLAYGS 371
            F  E K +      I +           N +FF    S+   +SF       + V   G+
Sbjct: 1255 FGNEIKFLKENLDFIDE-----------NNKFFFYMWSVNSWLSFRIDLLGAITVFGSGA 1303

Query: 372  YLVLQG-----GLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTD--- 423
            +++L       GL    LT  + +TE+       +  FYS +   + +  RL E  +   
Sbjct: 1304 FILLNADKIDAGLAGISLTYAVTFTEF----CLWMVKFYSTVEMSMNSVERLKEYMEIEE 1359

Query: 424  -RVPSIKPTTGKKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGR 482
              +      T  +  P +G I F + +  Y  +  +V+ + +++KI  GS + VVG +G 
Sbjct: 1360 EALADPGAITPSENWPVQGAITFANYSLRYAPKLPDVL-KQLNLKIDGGSKIGVVGRTGA 1418

Query: 483  GKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYG 542
            GKSTI   L RF + SSG+I ID  DIS++N++ LR  + ++ Q+P L  GT+R N+   
Sbjct: 1419 GKSTIISALFRFLDCSSGKILIDDLDISEINLRRLRSCLTIIPQDPSLFVGTIRSNL--D 1476

Query: 543  LTETPSKEEIR--MVAKQCFCHNFIVKFPH--------------GYDTVIGPQGALLSGG 586
              E    ++I   +V       +++    +                D+ I   G  LS G
Sbjct: 1477 PNEEYENKDIYDALVKVHLLTEDYLANLNYDANADVAYDENIFLNLDSPISEGGINLSQG 1536

Query: 587  QKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTI 646
            Q+Q I +AR+++    I++LDEAT+++D +S+  +  T       K  TI++IAHR+ ++
Sbjct: 1537 QRQLICLARSILHCSKIVLLDEATASIDYKSDFKVQETIRNEFSQK--TILTIAHRIKSV 1594

Query: 647  RRSENIIVL 655
               + I+VL
Sbjct: 1595 IDYDKILVL 1603

 Score = 99.4 bits (246), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 106/417 (25%), Positives = 193/417 (46%), Gaps = 41/417 (9%)

Query: 268 SGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEI 327
           + +++ F P  +F   +  R  R+T T     T Q  +   E    +R ++SF  E   I
Sbjct: 545 TAVIIFFIPFNVFLTKLIARFQRETLT----FTDQRIQNLNETFQSIRIIKSFGWENNII 600

Query: 328 HRYSHAIRDIFNVGKRAAY---INAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDL 384
            +         +V KR +    INA  +  + ++     +  L++  Y+++       DL
Sbjct: 601 QKILGLRNKEISVLKRNSITWSINALVWYLSPTI-----ITTLSFSYYILVDKQ----DL 651

Query: 385 TAFMLYTEYTGSSVFGLTSF-YSELMQGVGAATRLFELTDRVP---SIKPTTGKKFVP-- 438
           T       +T  ++F L      +L   +   T+     DR+    S+K TT  + +   
Sbjct: 652 TT---PVAFTALALFNLLKAPLDQLSNTINFLTQSKVSLDRIEKFLSVKETTKFENLSVD 708

Query: 439 -GKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNP 497
             +  + F   T  +     +   R+++ +   G    V+GP+G GK+++ + LL   + 
Sbjct: 709 SSQNRLAFSGATLGWCGNKKSFQLRNINAEFEMGKLNLVIGPTGSGKTSLLMALLGELHL 768

Query: 498 SSGQIFIDGQDISKLNI----KSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIR 553
            SG++F+   + SK N+     +L   I    Q P + + T+R+NI + +     + E  
Sbjct: 769 FSGKVFVPNLE-SKFNLIPESDNLLNSIAYCSQLPWIFNDTIRNNIIFDMGYDKDRYENV 827

Query: 554 MVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSAL 613
           ++A  C           G  T++G +G+ LSGGQKQRI++ARAL  K   L+LD+  SA+
Sbjct: 828 VIA--CGLERDFQILNLGDKTIVGDKGSCLSGGQKQRISLARALYSKSRHLILDDCLSAV 885

Query: 614 DVESEGAINYTF---GQLMKSKSVTIVSIAHRLS-TIRRSENIIVLGNDGSVVETGK 666
           D  S   I Y     G LM+ ++  +VS  H +S TI+++  + ++ N G +V +G+
Sbjct: 886 DSHSAKWI-YNVCITGPLMQGRTCILVS--HNVSLTIKKASKVFMIEN-GYIVASGR 938

>Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON}
            YHL035C (REAL)
          Length = 1585

 Score =  126 bits (316), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 130/511 (25%), Positives = 234/511 (45%), Gaps = 78/511 (15%)

Query: 209  IHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLS 268
            +H    FFD   VG +++R   D   + + +   +      LI           I+P+  
Sbjct: 1083 LHAKIRFFDVTPVGRIMNRFSKDIEGIDQELIPYLEVTVFCLIQCSSILLLIVVITPRFF 1142

Query: 269  GLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIH 328
             + ++      F    + +  RD           + +   E L GV T+++F  E+    
Sbjct: 1143 SVAVIVFILYYFVGKWYLKASRDLKRIDSITKSPIFQHFSETLVGVCTIRAFGDEK---- 1198

Query: 329  RYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISF-------LVVLAYGSYLV-----LQ 376
                  R I    ++    N  FF  + ++   +F        +VL  GS+++     + 
Sbjct: 1199 ------RFILENMEKIDQNNKAFFYLSVAVKWFAFRVDMIGAFIVLGSGSFILFNIDNID 1252

Query: 377  GGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELT------------DR 424
             GL    LT  +L+T+    S   L   YS     + +  RL E +            D 
Sbjct: 1253 SGLAGISLTYAILFTD----SALWLVQLYSRFEMNMNSVERLKEYSSIVQEKYLGYDEDH 1308

Query: 425  VPSIKPTTGKKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGK 484
            + ++  ++     P  G+I  ++++  Y +    ++ +++  K+   S V +VG +G GK
Sbjct: 1309 IQALNDSSW----PKHGKIEVENLSLRYASNLP-LVLKNVCFKVDPQSKVGIVGRTGAGK 1363

Query: 485  STIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLT 544
            STI   L R   P +G I ID QDISK+++ +LRR I ++ Q+PVL +GT++ NI     
Sbjct: 1364 STIIAALFRLLEPVTGCIKIDDQDISKIDLITLRRSITIIPQDPVLFAGTIKSNI----- 1418

Query: 545  ETPSKE-----------EIRMVA----KQCFC--HNFIV--KFPHGYDTVIGPQGAL-LS 584
              P  E           ++ +++    KQ F    NF +  KF +    ++  +G L LS
Sbjct: 1419 -DPHDEYDERRIFKVLLQVNLISSLEFKQVFNLKENFNIHNKFLNLQSEIV--EGGLNLS 1475

Query: 585  GGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSK--SVTIVSIAHR 642
             G++Q + IAR+L+++  I++LDEATS++D +S+  I      +++SK    TI++IAHR
Sbjct: 1476 QGERQLLFIARSLLRESKIILLDEATSSIDYDSDHLIQ----SIIRSKFNKSTILTIAHR 1531

Query: 643  LSTIRRSENIIVLGNDGSVVETGKFKELFAD 673
            L ++   + I+V+ + G + E G   EL  +
Sbjct: 1532 LRSVIYYDKILVM-DAGEIKEYGHPYELLKN 1561

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/241 (29%), Positives = 114/241 (47%), Gaps = 12/241 (4%)

Query: 438 PGKGEIVFKDVTFSYPTRPGNV-IFR--DMDIKIPAGSNVCVVGPSGRGKSTIALLLLRF 494
           P + +I FK     +     ++  F+  D++I    G    V+G +G GKS + + LL  
Sbjct: 659 PDRNKIEFKKANLVWNENDNDINKFKLCDLNIIFSIGKLNLVLGSTGSGKSALLMSLLGE 718

Query: 495 YNPSSGQIFIDGQDISKLNI---KSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEE 551
            +  SG I I G +     I     L        Q   L+S T+++NI +    +  K  
Sbjct: 719 LDLVSGFIIIPGLEPRHDLIPDHDGLTNSFAYCSQSAWLVSDTIKNNIVFN--GSYDKSR 776

Query: 552 IRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATS 611
            + V   C  +  +   P G  T IG +G  LSGGQKQRI++ARA+      ++LD+  S
Sbjct: 777 YKKVIDACGLNRDLNILPAGDLTEIGEKGITLSGGQKQRISLARAVYSHAKHVLLDDCLS 836

Query: 612 ALDVESEGAI--NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKE 669
           A+D  +   I  N   GQLMK+++  +V+  H +    R+ +  ++  DG V   G  KE
Sbjct: 837 AVDSHTAVWIYENCITGQLMKNRTCILVT--HNVPLAIRNAHFAIILEDGKVKNQGTIKE 894

Query: 670 L 670
           L
Sbjct: 895 L 895

>AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YDR135C (YCF1)
          Length = 1492

 Score =  125 bits (315), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 123/482 (25%), Positives = 214/482 (44%), Gaps = 37/482 (7%)

Query: 200  LRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXX 259
            L  +++   +     FF+   +G +++R  +D Y V   + +  S  F            
Sbjct: 1003 LHESMLAAVLRAPMSFFETTPIGRILNRFSNDIYKVDELLARTFSQFFANTTRVSFTIIV 1062

Query: 260  XXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVS--------EEQL 311
                + Q +     F  P+      + +    TS +L+    +L  V+        +E L
Sbjct: 1063 ICVTTWQFT----FFVIPLAMLYIYYQQYYLKTSRELR----RLDSVTKSPVYAHFQETL 1114

Query: 312  SGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAY----INAQFFTATSSLGDISFLVVL 367
            +GV +++ +     ++ R+ H  +   N    A Y    +N         +G        
Sbjct: 1115 NGVSSIRGY----GQLDRFIHINQARINNNTSAYYPSMNVNRWLAYRLEFIGSCIIFFAA 1170

Query: 368  AYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPS 427
                + +  G LT G +   + Y      S+  +     E+   + +  R+ E  +  P 
Sbjct: 1171 TLSVFRLASGSLTSGMVGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYAELEPE 1230

Query: 428  ----IKPTTGKKFVPGKGEIVFKDVTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGPSGR 482
                I  +      P  GEI F++ +  Y  RPG ++I R +++ I     V +VG +G 
Sbjct: 1231 APQFIANSVPSGDWPKDGEIKFENYSTRY--RPGLDLILRGINLHIKPHERVGIVGRTGA 1288

Query: 483  GKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYG 542
            GKS++AL L R    + G I IDG  I  + +  LR+ + ++ Q+  +  GT+RDNI   
Sbjct: 1289 GKSSLALSLFRIIEAAEGHISIDGVPIDTIGLTDLRKKLSIIPQDSQVFEGTVRDNI--D 1346

Query: 543  LTETPSKEEIRMVAKQCFCHNFIVKF-PHGYDTVIGPQGALLSGGQKQRIAIARALIKKP 601
             T+  + E+I    +     + +      G DT +   G  LS GQ+Q + +ARAL+   
Sbjct: 1347 PTKQYTDEQIWKALELSHLADHVKGMGSDGLDTPLTEGGKNLSVGQRQLMCLARALLIPF 1406

Query: 602  TILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSV 661
             ILVLDEAT+A+DVE++  I  T       +  TI++IAHR++TI  S+ I+VL + G+V
Sbjct: 1407 RILVLDEATAAIDVETDKVIQDTIRSSFNDR--TILTIAHRINTIMDSDKIVVL-DKGTV 1463

Query: 662  VE 663
             E
Sbjct: 1464 AE 1465

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 117/501 (23%), Positives = 223/501 (44%), Gaps = 72/501 (14%)

Query: 204 VIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQK----VSDGFKALICXXXXXXX 259
           + KK +H  +E       GD+++ +  DA  + R +TQ      S  F+  +C       
Sbjct: 366 IYKKALHLSNEASGTSATGDIVNLMSVDAQRL-RDLTQWGNVIWSGPFQLCLCLYSLHRL 424

Query: 260 XXSISP--QLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTV 317
              + P   +  +LLLFT P+    S   R ++    +  +   + TR+  E L+ ++++
Sbjct: 425 ---LGPCIWVGVVLLLFTLPL---NSYISRVLKRLQKEQMKNKDERTRLISEILNNIKSL 478

Query: 318 QSFVAE-----QKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLA-YGS 371
           + +  E     + +  R    ++ +  +G   A+ N Q+         I FLV  + +  
Sbjct: 479 KLYAWEIPYKEKLDYVRNQKELKTLRKMGLTTAFANFQY-------NIIPFLVSCSTFAV 531

Query: 372 YLVLQGG------LTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTD-- 423
           +++ Q G      L    LT F L +         +TSF  E    +G  T      +  
Sbjct: 532 FVLTQKGRPLTTDLVFPALTLFNLLSFPLAVLPIAITSFI-EASVAIGRLTNFLTAEELQ 590

Query: 424 -----RVPSIKPTTGKKFVPGKGEIVFKD-VTFSYPTRPG-NVIFRDMDIKIPAGSNVCV 476
                R P++K        PG   +   D  TF +  +P   V  ++++ +       C+
Sbjct: 591 RDAITREPAVK-------APGGVAVALADNATFLWQRKPEYKVALKNINFRAKKSELTCI 643

Query: 477 VGPSGRGKSTIALLLLRFYNPSSGQIF-IDGQDISKLNIKSLRRHIGLVQQEPVLMSGTL 535
           +G  G GKS +   +L       G +F ++G  +       +R ++  V Q   +M+GT+
Sbjct: 644 IGKVGSGKSALIQAML-------GDLFRVNGSAV-------VRGNVAYVSQVAWIMNGTV 689

Query: 536 RDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIAR 595
           RDNI +G       +  +   K C     +   P G +T +G +G  LSGGQK R+++AR
Sbjct: 690 RDNILFG--HKYDAKFYQQTIKACALTVDLSILPDGDNTFVGEKGISLSGGQKARLSLAR 747

Query: 596 ALIKKPTILVLDEATSALDVE-SEGAINYTFGQ--LMKSKSVTIVSIAHRLSTIRRSENI 652
           A+  +    +LD+  +A+D   ++  +   FG   L+KSK+  + +  ++++ +  +++I
Sbjct: 748 AVYARADTYLLDDPLAAVDEHVAKHLLQNVFGPNGLLKSKARVLTT--NKITALEIADHI 805

Query: 653 IVLGNDGSVVETGKFKELFAD 673
           ++L N G +V+ G F E+ +D
Sbjct: 806 VLLEN-GEIVQQGTFSEVISD 825

>TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1514

 Score =  125 bits (315), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 108/367 (29%), Positives = 187/367 (50%), Gaps = 23/367 (6%)

Query: 308  EEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAY--INAQFFTATSSLGDISFLV 365
            +E L G+ T++ +  +Q++  R++H  +   +    A Y  +NA  + A   L  I  ++
Sbjct: 1135 QESLGGLSTIRGY--DQQD--RFTHINQSRIDNNMSAFYPSVNANRWLAFR-LEFIGTII 1189

Query: 366  VLAYGSYLVLQ---GGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELT 422
            +    S  +L+   G LT G +   + Y      S+  +     E+   + +  R+ E +
Sbjct: 1190 IFGAASLSMLRLKAGSLTPGMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYS 1249

Query: 423  DRVPSIKPTTGKKF-----VPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVV 477
            + + S  P   +        P KG+I F+  +  Y     N++ +D+++ +     + +V
Sbjct: 1250 E-IKSEAPLVIEDHRPPADWPSKGDIKFEHYSTRY-RENMNLVLKDINLHVKPQEKIGIV 1307

Query: 478  GPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRD 537
            G +G GKS++ L L R    + G+I IDG  I+++ +  LR  + ++ Q+  +  GT+R+
Sbjct: 1308 GRTGAGKSSLTLALFRIIEAAEGRIVIDGVPINEIGLHDLRHKLSIIPQDSQVFEGTVRE 1367

Query: 538  NITYGLTETPSKEEIRMVAKQCFCHNFIVKFPH-GYDTVIGPQGALLSGGQKQRIAIARA 596
            NI    T   S EEI  V +     N ++     G  T +   GA LS GQ+Q + +ARA
Sbjct: 1368 NI--DPTNQYSDEEIWRVLELSHLKNHVLSMSKDGLMTRLTEGGANLSVGQRQLMCLARA 1425

Query: 597  LIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLG 656
            L+    IL+LDEAT+A+DVE++  I  T     K +  TI++IAHRL+TI  S+ I+VL 
Sbjct: 1426 LLIPSRILILDEATAAVDVETDQVIQETIRTAFKDR--TILTIAHRLNTIMDSDRILVL- 1482

Query: 657  NDGSVVE 663
            + G V E
Sbjct: 1483 DAGEVRE 1489

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 115/247 (46%), Gaps = 39/247 (15%)

Query: 441 GEIVFK---DVTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYN 496
           G++  K   D  F +  +P   V  +++++++  G   CVVG  G GKS +   LL    
Sbjct: 627 GDVAIKISDDANFLWKRKPQYQVALKNINLEVKKGELACVVGKVGSGKSALVQSLLGDLY 686

Query: 497 PSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVA 556
              G   + G                 V Q P +M+GT++DNI +G    P   ++ +  
Sbjct: 687 RVKGYAAVHGS-------------TAYVSQVPWIMNGTVKDNILFGHKYDPVFYDLTI-- 731

Query: 557 KQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVE 616
           K C     +   P G  T++G +G  LSGGQK R+++ARA   +    +LD+  +A+D  
Sbjct: 732 KACALTIDLGILPDGDQTMVGEKGISLSGGQKARLSLARATYARADTYLLDDPLAAVDEH 791

Query: 617 -SEGAINYTFGQ--LMKSKS-------VTIVSIAHRLSTIRRSENIIVLGNDGSVVETGK 666
            ++  I +  G   L+KSK+       +T++SIA  +S +            G +++ G 
Sbjct: 792 VAQHLIEHVLGPRGLLKSKTKLLATNKITVLSIASSISLVE----------GGEIIQHGS 841

Query: 667 FKELFAD 673
           ++++  D
Sbjct: 842 YEDISKD 848

>Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {ON}
            YLL048C (YBT1) - bile acid transporter of ABC family
            [contig 274] PARTIAL
          Length = 1436

 Score =  125 bits (315), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 125/487 (25%), Positives = 213/487 (43%), Gaps = 40/487 (8%)

Query: 204  VIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSI 263
            ++KK ++    FFD   +G +++R   D   V + +T  V   F +L+           I
Sbjct: 920  ILKKVLYAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYI 979

Query: 264  SPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAE 323
            +P    + +            +    R+       +   + +   E L G+ T+++F  E
Sbjct: 980  TPGFFVVAIFIAILYYLVGYFYMAGSRELKRFESISRSPIHQHFSETLVGITTIRAFGDE 1039

Query: 324  QKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQ-----GG 378
            ++ +      +  I    K   Y+          +  I   V+ A G +++L       G
Sbjct: 1040 RRFMQ---ENLEKIDENNKPFFYLWVANRWLAFRIDMIGACVIFAAGIFVLLNIKSLDSG 1096

Query: 379  LTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFEL--TDRVPSIKPT-TGKK 435
            L    LT  + +TE        L   YS +   + +  RL E    ++ P  + T T   
Sbjct: 1097 LAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEYMEVEQEPHYQSTHTPPP 1152

Query: 436  FVPGKGEIVFKDVTFSY-PTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRF 494
              P +G+I   D++  Y P+ P   + +++   +     V +VG +G GKSTI   L RF
Sbjct: 1153 EWPSQGKIEVNDLSLRYAPSLPK--VIKNVSFTVDPNCKVGIVGRTGAGKSTIITALFRF 1210

Query: 495  YNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNI----TYG-------- 542
             +P SG I ID  DI+ + +K LR+ I ++ Q+P L +GT++ N+     Y         
Sbjct: 1211 LDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKSNLDPYDEYSDGQIFEAL 1270

Query: 543  -----LTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARAL 597
                 LTE                H+  V      D  I   GA LS GQ+Q + +AR+L
Sbjct: 1271 KRVNLLTEEELNSAGSPAPGNSSIHSENVNKFLRLDNEITEGGANLSQGQRQLVCLARSL 1330

Query: 598  IKKPTILVLDEATSALDVESEGAINYTF-GQLMKSKSVTIVSIAHRLSTIRRSENIIVLG 656
            ++ P +++LDEAT+++D  S+  I  T  G+   S   TI++IAHRL +I   + I+V+ 
Sbjct: 1331 LRSPKVMLLDEATASIDYTSDARIQQTIRGEFSNS---TILTIAHRLRSIIDYDKILVM- 1386

Query: 657  NDGSVVE 663
            + G V E
Sbjct: 1387 DAGEVKE 1393

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 66/239 (27%), Positives = 119/239 (49%), Gaps = 11/239 (4%)

Query: 439 GKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPS 498
            +  I F++ TFS+  +  +   ++M I+   G    V+GP+G GK+++ + LL   +  
Sbjct: 471 SRKRIGFENATFSWDRKNPDFKLKNMSIEFRLGKLNVVIGPTGSGKTSLLMGLLGEMDLL 530

Query: 499 SGQIF---IDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKE-EIRM 554
            G+++   +D ++   +    +   I    Q   L++ T+++NI +    +P  E     
Sbjct: 531 EGKVYAPCLDPREDLIVENDGMTNSIAYCSQGAWLLNDTVKNNILFS---SPFNEARYDA 587

Query: 555 VAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALD 614
           V + C           G  T IG +G  LSGGQKQR+++ARAL      L+LD+  SA+D
Sbjct: 588 VVEACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLSAVD 647

Query: 615 VESEGAI--NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELF 671
             +   I  N   G LM+ ++  +VS  H ++   ++ + +V   +G V + G+  ELF
Sbjct: 648 SHTALWIYENCITGPLMEGRTCILVS--HNVALTLKNADWVVFMENGKVKDQGEPLELF 704

>SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1653

 Score =  125 bits (314), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 126/484 (26%), Positives = 214/484 (44%), Gaps = 50/484 (10%)

Query: 204  VIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSI 263
            V+KK ++    FFD   +G +++R   D   V + +T  V   F +L+           I
Sbjct: 1138 VLKKVLYAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYI 1197

Query: 264  SPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQE----ATGQLTRVSEEQLSGVRTVQS 319
            +P      L+    + F   + G      S +L+     +   + +   E L G+ T+++
Sbjct: 1198 TPGF----LVVAIFIGFLYYLVGYFYMAGSRELKRFESVSRSPIHQHFSETLVGITTIRA 1253

Query: 320  FVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQ--- 376
            F  E++ +      ++ I    K   Y+          +  I   VV A G +++L    
Sbjct: 1254 FGDERRFML---ENLQKIDENNKPFFYLWVANRWLAFRIDMIGACVVFAAGVFILLNIKK 1310

Query: 377  --GGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGK 434
               GL    LT  + +TE        L   YS +   + +  RL E    V   +P+   
Sbjct: 1311 LDSGLAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEYM--VIEQEPSNDG 1364

Query: 435  KF-----VPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIAL 489
             F      P +G+I   D++  Y T    VI +++   +     V +VG +G GKSTI  
Sbjct: 1365 AFNPPIEWPDQGKIEVNDLSLRYATNLPRVI-KNVSFTVDPKCKVGIVGRTGAGKSTIIT 1423

Query: 490  LLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSK 549
             L RF +P +G I ID  DI+ + +K LR+ I ++ Q+P L SGT++ N+     +  + 
Sbjct: 1424 ALFRFLDPETGHIKIDNVDITSIGLKRLRQSITIIPQDPTLFSGTVKSNL--DPYDEYTD 1481

Query: 550  EEIRMVAKQC--FCHNFIVKFPHGYDTV----------------IGPQGALLSGGQKQRI 591
            E+I    K+      + +   P   D                  I   GA LS GQ+Q +
Sbjct: 1482 EQIFKALKRVNLVTADELDHVPDSADNASVNSENVNKFLDLRNEITEGGANLSQGQRQLV 1541

Query: 592  AIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSEN 651
             +AR+L++ P I++LDEAT+++D  S+  I  T  +       TI++IAHRL +I   + 
Sbjct: 1542 CLARSLLRSPKIILLDEATASIDYSSDAKIQQTIREEFGDS--TILTIAHRLRSIIDYDK 1599

Query: 652  IIVL 655
            I+V+
Sbjct: 1600 ILVM 1603

 Score = 88.2 bits (217), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 95/373 (25%), Positives = 180/373 (48%), Gaps = 31/373 (8%)

Query: 308 EEQLSGVRTVQSFVAEQKEIHRYSHAIR--DIFNVGKRA---AYINAQFFTATSSLGDIS 362
            E    +R ++ F  E+    R   AIR  ++  + KR+   A ++  +F   S +  +S
Sbjct: 561 NETFQSIRIIKFFSWEEN-FERDIKAIRTEELKILLKRSIVWALMSLVWFITPSIVTSVS 619

Query: 363 FLVVLAYGSYLVLQGGL--TIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFE 420
           F        Y+ +QG +  T    TA  L+T    + +  L+   S ++Q   +  R+ E
Sbjct: 620 F------AFYIYVQGEVLTTPIAFTALSLFT-LLRNPLDQLSDMLSFVIQSKVSLDRVQE 672

Query: 421 LTDRVPSIKPTTGKKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPS 480
             D   + K     +    + +I F++ TF++  +  +   ++++++   G    V+G +
Sbjct: 673 FLDEEETEK---YNQLTISRNKIAFENATFAWDKKNPSFKLKNLNVEFKLGKLNVVIGST 729

Query: 481 GRGKSTIALLLLRFYNPSSGQIFIDGQD-ISKLNIKS--LRRHIGLVQQEPVLMSGTLRD 537
           G GK+++ + LL   +   G++++   D   +L I+S  +   I    Q   L++ T+R+
Sbjct: 730 GSGKTSLLMGLLGEMDLIEGKVYVPSLDPREELVIESDGMTNSIAYCSQAAWLLNDTVRN 789

Query: 538 NITYGLTETPSKE-EIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARA 596
           NI +    +P  E   + V + C           G  T IG +G  LSGGQKQR+++ARA
Sbjct: 790 NILFN---SPYNETRYKAVVEACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARA 846

Query: 597 LIKKPTILVLDEATSALDVESEGAI--NYTFGQLMKSKSVTIVSIAHRLS-TIRRSENII 653
           L      ++LD+  SA+D  +   I  N   G LM+ ++  +VS  H ++ T++ +E ++
Sbjct: 847 LYSSSRHVLLDDCLSAVDSHTALWIYENCITGPLMQGRTCILVS--HNVALTLKNAEWVV 904

Query: 654 VLGNDGSVVETGK 666
           VL N G + + G+
Sbjct: 905 VLDN-GRIKDQGE 916

>Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  124 bits (310), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 124/491 (25%), Positives = 218/491 (44%), Gaps = 46/491 (9%)

Query: 204  VIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSI 263
            ++ K +H    FFD    G +++R   D   + + +T  +   F +LI           I
Sbjct: 1141 ILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFI 1200

Query: 264  SPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAE 323
            +PQ   + ++ +    F    +    R+       +   + +   E L GV T+++F  E
Sbjct: 1201 TPQFLSIAIVVSILYYFVGYFYMAGSRELKRFESISRSPIYQHFSETLVGVTTIRAFGDE 1260

Query: 324  QKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLV-----LQGG 378
             + +      ++ I    K   Y+          +  I  LV+   G +++     +  G
Sbjct: 1261 GRFMQE---NLQKIDENNKPFFYLWVANRWLAFRIDMIGSLVIFGAGLFILFNIDHIDSG 1317

Query: 379  LTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVP 438
            +    LT  + +TE        L   YSE+   + +  R+ E   ++   +P    K VP
Sbjct: 1318 MAGISLTYAISFTE----GALWLVRLYSEVEMNMNSVERVKEYM-KIEQ-EPYNQHKEVP 1371

Query: 439  -----GKGEIVFKDVTFSY-PTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLL 492
                   G+I   D++  Y P  P   +  ++   + A S + +VG +G GKSTI   L 
Sbjct: 1372 PSQWPQDGKIEVNDLSLRYAPNLPR--VINNVSFSVDAQSKIGIVGRTGAGKSTIITALF 1429

Query: 493  RFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNIT-YG--------- 542
            RF  P +G I ID  DIS ++++ LRR I ++ Q+P L SGT++ N+  Y          
Sbjct: 1430 RFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDKKIFE 1489

Query: 543  -------LTETPSKEEIRMVAKQCFCHN---FIVKFPHGYDTVIGPQGALLSGGQKQRIA 592
                   ++E  S +     A      N    I KF     + +   G+ LS GQ+Q + 
Sbjct: 1490 ALKRVNLISEEQSHQGAVREADNDTSSNSSENINKFL-DLSSEVSEGGSNLSQGQRQLMC 1548

Query: 593  IARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENI 652
            +AR+L++ P I++LDEAT+++D  S+  I  T  +  +    TI++IAHRL ++   + I
Sbjct: 1549 LARSLLRSPKIILLDEATASIDYSSDAKIQETIRKEFQGS--TILTIAHRLRSVIDYDKI 1606

Query: 653  IVLGNDGSVVE 663
            +V+ + G V E
Sbjct: 1607 LVM-DAGEVKE 1616

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 111/234 (47%), Gaps = 11/234 (4%)

Query: 438 PGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNP 497
           P       ++ T S+     +   +D++I+   G    V+GP+G GK+++ + LL     
Sbjct: 689 PNGKRFALENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 498 SSGQIFIDGQDISK---LNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKE-EIR 553
            +G+I +   +  +   ++       I    Q   L++ T++ NI +    +P  E   +
Sbjct: 749 LNGKIVVPALEPRQELVVDANGTTNSIAYCSQGAWLLNDTIKHNILFN---SPFNEARYK 805

Query: 554 MVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSAL 613
            V + C           G  T IG +G  LSGGQKQR+++ARAL      ++LD+  SA+
Sbjct: 806 AVVEACGLKRDFEILKAGDLTEIGEKGIALSGGQKQRVSLARALYSNARHVLLDDCLSAV 865

Query: 614 DVESEGAI--NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETG 665
           D  +   I  N   G LM+ ++  +VS  H ++   R+  ++VL  DG + + G
Sbjct: 866 DSHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRIKDQG 917

>Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  123 bits (308), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 123/492 (25%), Positives = 219/492 (44%), Gaps = 48/492 (9%)

Query: 204  VIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSI 263
            ++ K +H    FFD    G +++R   D   + + +T  +   F +LI           I
Sbjct: 1141 ILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFI 1200

Query: 264  SPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAE 323
            +PQ   + ++ +    F    +    R+       +   + +   E L GV T+++F  E
Sbjct: 1201 TPQFLSVAIVVSILYYFVGYFYMAGSRELKRFESISRSPIYQHFSETLVGVTTIRAFGDE 1260

Query: 324  QKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLV-----LQGG 378
             + +      ++ I    K   Y+          +  I  LV+   G +++     L  G
Sbjct: 1261 GRFMQE---NLQKIDENNKPFFYLWVANRWLAFRIDMIGSLVIFGAGLFILFNINHLDSG 1317

Query: 379  LTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVP 438
            +    LT  + +TE        L   Y+E+   + +  R+ E  +     +P    K VP
Sbjct: 1318 MAGISLTYAISFTE----GALWLVRLYAEVEMNMNSVERVKEYME--IEQEPYNQHKEVP 1371

Query: 439  -----GKGEIVFKDVTFSY-PTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLL 492
                   G+I   D++  Y P  P   + +++   + A S + +VG +G GKSTI   L 
Sbjct: 1372 PPQWPQDGKIEVNDLSLRYAPNLPR--VIKNVSFSVDAQSKIGIVGRTGAGKSTIITALF 1429

Query: 493  RFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNIT-YG--------- 542
            RF  P +G I ID  DIS ++++ LRR I ++ Q+P L SGT++ N+  Y          
Sbjct: 1430 RFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDRKIFE 1489

Query: 543  -------LTETPSKE----EIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRI 591
                   ++E  S++    E           N + KF     + +   G+ LS GQ+Q +
Sbjct: 1490 ALKRVNLISEEQSQQGTTREADNDNSSTNSEN-VNKFL-DLSSEVSEGGSNLSQGQRQLM 1547

Query: 592  AIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSEN 651
             +AR+L++ P I++LDEAT+++D  S+  I  T  +  +    TI++IAHRL ++   + 
Sbjct: 1548 CLARSLLRSPKIILLDEATASIDYGSDAKIQETIRKEFQGS--TILTIAHRLRSVIDYDK 1605

Query: 652  IIVLGNDGSVVE 663
            I+V+ + G V E
Sbjct: 1606 ILVM-DAGEVKE 1616

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 113/234 (48%), Gaps = 11/234 (4%)

Query: 438 PGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNP 497
           P      F++ T S+     +   +D++I+   G    V+GP+G GK+++ + LL     
Sbjct: 689 PNGKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 498 SSGQIFIDGQDISK---LNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKE-EIR 553
            SG++ +   +  +   ++       I    Q   L++ T+++NI +    +P  E   +
Sbjct: 749 LSGKVVVPALEPRQELVVDANGTTNAIAYCSQGAWLLNDTVKNNILFN---SPFNEARYK 805

Query: 554 MVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSAL 613
            V + C           G  T IG +G  LSGGQKQR+++ARAL      ++LD+  SA+
Sbjct: 806 AVVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAV 865

Query: 614 DVESEGAI--NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETG 665
           D  +   I  N   G LM+ ++  +VS  H ++   R+  ++VL  DG V + G
Sbjct: 866 DSHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRVKDQG 917

>CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1648

 Score =  123 bits (308), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 123/503 (24%), Positives = 229/503 (45%), Gaps = 64/503 (12%)

Query: 204  VIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSI 263
            ++ + +H    FFD   +G +++R   D   + + +   +   F + I           I
Sbjct: 1129 LLDRVLHARVRFFDSTPIGRIMNRFSKDIESIDQEIPPNIQSVFYSAIEVFATLLLISYI 1188

Query: 264  SPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQE----ATGQLTRVSEEQLSGVRTVQS 319
            +P    + ++    ++   SI G     TS +L+     +   + +   E L GV T+++
Sbjct: 1189 TPAFFPVAII----IVLGYSIVGFFYLTTSRELKRLDSISKSPIFQHFSETLVGVTTIRA 1244

Query: 320  FVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQ--- 376
            F  EQ+ I + + ++ D  ++     ++  ++ +    L  I  LV+ + G +++L    
Sbjct: 1245 FGDEQRFI-KENLSMIDQNSMPFFYLWVVNRWLSFRIDL--IGALVIFSSGVFILLNINN 1301

Query: 377  --GGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFE---------LTDRV 425
               GL    LT  + +TE    +   L   YSEL   + +  R+ E         + D  
Sbjct: 1302 IDAGLAGISLTYAISFTE----AALWLVRQYSELEMNMNSVERVLEYMNIEQEPLIADPA 1357

Query: 426  PSIKPTTGKKFVPGKGEIVFKDVTFSY-PTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGK 484
             ++ P       P  G++   +++  Y P  P   + +D+   I     V +VG +G GK
Sbjct: 1358 NAVTPPPQ---WPDSGKVEVNNLSLKYAPHLP--YVIKDVTFTIEPLEKVGIVGRTGAGK 1412

Query: 485  STIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLT 544
            STI   L RF    +G I +DG +I+ +++K LRR I ++ Q+P L +G++R N+     
Sbjct: 1413 STIITALFRFLEADTGSIKLDGVNIANIDLKRLRRSITIIPQDPTLFAGSIRSNL--DPY 1470

Query: 545  ETPSKEEIRMVAK-----------------QCFCHNFIVKFPHGYDTVIGPQGALLSGGQ 587
            +  S EEI    K                 Q      + KF +  ++ I   G+  S GQ
Sbjct: 1471 DEYSDEEIFTALKRVNLVSTEEMEASTSEIQSNSSKNVNKFLN-LESEIAEGGSNFSQGQ 1529

Query: 588  KQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIR 647
            +Q + +AR+L++ P +++LDEAT+++D  S+  I  T  Q   +   T+++IAHRL +I 
Sbjct: 1530 RQLMCLARSLLRMPKVILLDEATASIDYNSDAKIQETIRQEFNNS--TVLTIAHRLRSIV 1587

Query: 648  RSENIIVLGNDGSVVETGKFKEL 670
              + I+V+       + G+ KE 
Sbjct: 1588 DYDKILVM-------DAGEVKEF 1603

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 65/235 (27%), Positives = 114/235 (48%), Gaps = 9/235 (3%)

Query: 443 IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI 502
           + F++VT  + +   + + R++DI+   G    +VG +G GK++I + LL     S G+I
Sbjct: 706 LAFENVTLRWDSDKDSFVLRNLDIEFMTGKLNVIVGATGSGKTSILMGLLGEMQLSEGKI 765

Query: 503 FIDG---QDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQC 559
            +     +   +     +   I    Q   L++ T+R+NI +      ++ +   V + C
Sbjct: 766 IVPSLSPRHEYQSQAGVINDSIAYCSQAAWLLNDTVRNNILFNAPFDQARYD--AVVEAC 823

Query: 560 FCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEG 619
                      G  T IG +G  LSGGQKQR+++ARAL      L+LD+  SA+D  +  
Sbjct: 824 SLKRDFQILKAGDSTEIGEKGITLSGGQKQRVSLARALYSSAGHLLLDDCLSAVDSHTAL 883

Query: 620 AI--NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFA 672
            I      G LM+ ++  +V+  H ++   ++ + +V+  DG V E G   EL A
Sbjct: 884 WIYDKCISGPLMEGRTCILVT--HNIALTMKNADFVVMIEDGKVKEKGTPIELLA 936

>Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..10453)
            [4974 nt, 1658 aa]
          Length = 1657

 Score =  122 bits (307), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 133/511 (26%), Positives = 217/511 (42%), Gaps = 83/511 (16%)

Query: 204  VIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSI 263
            ++ K +H +  FFD   +G +++R   D   V + +   +      +I           I
Sbjct: 1144 LLNKALHANLRFFDSTPIGRIMNRFSKDMEAVDQELVPYLEAALYCIIDISSTILLITYI 1203

Query: 264  SPQLSGLLLL-----FTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQ 318
            +P+   + +L     +   VL+ A     K  D+ T        + +   E L GV TV+
Sbjct: 1204 TPEFLIIAILVAGLYYAIGVLYLAGSRELKRFDSIT-----KSPIYQHFSETLVGVTTVR 1258

Query: 319  SFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISF-------LVVLAYGS 371
            ++  E + +      I +           N  FF    S   ++F       LV+   G 
Sbjct: 1259 AYGDEARFMRENLKMIDEN----------NKPFFYLWVSNRWLAFRIDVVGALVIFGSGV 1308

Query: 372  YLVLQ-----GGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTD--- 423
            +++L       GL    L+  + +TE    S   L   YS L   + +  RL E  +   
Sbjct: 1309 FVLLNIDKIDSGLAGISLSFAISFTE----SALWLVRHYSNLEMNMNSVERLMEYMEVEQ 1364

Query: 424  --------RVPSIKPTTGKKFVPGKGEIVFKDVTFSY-PTRPGNVIFRDMDIKIPAGSNV 474
                     VPS  P  GK        I   DV+  Y P  P   + ++    +     V
Sbjct: 1365 EPYKSSSLDVPSSWPEEGK--------IEVNDVSLRYAPNLPR--VIKNATFTVDPKMKV 1414

Query: 475  CVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGT 534
             +VG +G GKSTI   L RF +P +G I ID  DIS + +K LRR I ++ Q+P L SGT
Sbjct: 1415 GIVGRTGAGKSTIITALFRFLDPETGSIKIDNVDISTIELKKLRRSITIIPQDPTLFSGT 1474

Query: 535  LRDNIT-YG-LTETPSKEEIRMVA-------------KQCFCHNFIVKFPHGYDTVIGPQ 579
            ++ N+  Y   +E    E ++ V              +Q        KF +  +  I   
Sbjct: 1475 IKSNLDPYDEYSEKQIFEALKRVNLVTEKELASGNSDQQSIASGNANKFLN-VNNEISEG 1533

Query: 580  GALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSI 639
            G+ LS GQ+Q + +AR+L++ P +++LDEAT+++D  S+  I  T          TI++I
Sbjct: 1534 GSNLSQGQRQLVCLARSLLRCPKVILLDEATASIDYASDAKIQETIRNEFDDS--TILTI 1591

Query: 640  AHRLSTIRRSENIIVLGNDGSVVETGKFKEL 670
            AHRL T+   + I+V+       + G+ KE 
Sbjct: 1592 AHRLRTVIDYDKILVM-------DAGEVKEF 1615

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 70/234 (29%), Positives = 121/234 (51%), Gaps = 13/234 (5%)

Query: 440 KGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSS 499
           + +I FK+ T ++     +   R++DI    G    ++GP+G GK+++ + LL   +   
Sbjct: 700 QNKIAFKNATTTWNKEKQDFKLRNIDIDFKIGKLNVIIGPTGSGKTSLLMALLGEMDLID 759

Query: 500 GQIFI---DGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEE--IRM 554
           G+I +   D ++  KL+   L   I    Q   L++ T+R+NI +    +P  EE    +
Sbjct: 760 GEIIVPCLDPREDLKLDANGLTNSIAYCSQAAWLLNDTVRNNILFN---SPYCEERYNAV 816

Query: 555 VAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALD 614
           V       +F +    G  T IG +G  LSGGQKQR+++ARAL      L+LD+  SA+D
Sbjct: 817 VEASGLKRDFEI-LNAGDMTEIGERGITLSGGQKQRVSLARALYSNSKHLLLDDCLSAVD 875

Query: 615 VESEGAI--NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGK 666
             +   I  N   G LM++++  +VS  H ++   R+ + +V   +G +VE G+
Sbjct: 876 SHTATWIYDNCISGPLMENRTCILVS--HNIALTLRNADYVVKLENGKIVEHGE 927

>KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1649

 Score =  122 bits (306), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 120/488 (24%), Positives = 215/488 (44%), Gaps = 42/488 (8%)

Query: 204  VIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSI 263
            ++KK ++    FFD   +G +++R   D   V + +T  V   F +L+           I
Sbjct: 1133 ILKKVLYAKLRFFDSTPIGRIMNRFSRDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYI 1192

Query: 264  SPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAE 323
            +P    + +            +    R+       +   + +   E L G+ T+++F  E
Sbjct: 1193 TPDFFFVAIFIGIFYYLVGYFYMAGSRELKRYESISRSPIHQHFSETLVGITTIRAFGDE 1252

Query: 324  QKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQ-----GG 378
            ++ +      +  I    K   Y+          +  I   V+ A G +++L       G
Sbjct: 1253 RRFMQ---ENLTKIDENNKPFFYLWVANRWLAFRIDMIGACVIFAAGIFVLLNIKSLDSG 1309

Query: 379  LTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFEL--TDRVPSIKPTTGKK- 435
            L    LT  + +TE        L   YS +   + +  RL E    ++ P  + T     
Sbjct: 1310 LAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEYMEVEQEPHYQSTHNPPP 1365

Query: 436  FVPGKGEIVFKDVTFSY-PTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRF 494
              P +G+I   D++  Y P+ P   + +++   +     V +VG +G GKSTI   L RF
Sbjct: 1366 EWPSQGKIEVNDLSLRYAPSLPK--VIKNVTFTVDPNCKVGIVGRTGAGKSTIITALFRF 1423

Query: 495  YNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKE---- 550
             +P SG I ID  DI+ + +K LR+ I ++ Q+P L +GT++ N+     E   K+    
Sbjct: 1424 LDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKSNLD-PYDEYSDKQIFEA 1482

Query: 551  --EIRMVAKQCFCH-------------NFIVKFPHGYDTVIGPQGALLSGGQKQRIAIAR 595
               + +V ++   H               + KF    +  I   G+ LS GQ+Q + +AR
Sbjct: 1483 LKRVNLVTQEELDHAANPSPDNASAVSENVNKFLF-LENEISEGGSNLSQGQRQLVCLAR 1541

Query: 596  ALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVL 655
            +L++ P +++LDEAT+++D +S+  I  T          TI++IAHRL +I   + I+V+
Sbjct: 1542 SLLRSPKVMLLDEATASIDYQSDARIQQTIRSEFSDS--TILTIAHRLRSIIDYDKILVM 1599

Query: 656  GNDGSVVE 663
             + G V E
Sbjct: 1600 -DAGEVKE 1606

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 119/238 (50%), Gaps = 11/238 (4%)

Query: 440 KGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSS 499
           + +I F++ TFS+  +  +   ++M+I    G    V+GP+G GK+++ + LL   +   
Sbjct: 686 RNKIGFENATFSWDRKNPDFKLKNMNIDFKLGKLNVVIGPTGSGKTSLLMGLLGEMDLLE 745

Query: 500 GQIF---IDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKE-EIRMV 555
           G+++   +D ++   +    +   I    Q   L++ T+++NI +    +P  E     V
Sbjct: 746 GKVYAPCLDPREDMVIENDGMTNSIAYCSQAAWLLNDTVKNNILFS---SPFNEGRYNAV 802

Query: 556 AKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDV 615
            + C           G  T IG +G  LSGGQKQR+++ARAL      L+LD+  SA+D 
Sbjct: 803 IEACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLSAVDS 862

Query: 616 ESEGAI--NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELF 671
            +   I  N   G LM+ ++  +VS  H ++   ++   +V   +G V + G+  EL+
Sbjct: 863 HTALWIYENCISGPLMEGRTCILVS--HNVALTLKNAEWVVFMENGRVKDQGEPLELY 918

>Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON}
            YHL035C (REAL)
          Length = 1599

 Score =  122 bits (306), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 166/679 (24%), Positives = 297/679 (43%), Gaps = 103/679 (15%)

Query: 51   QLSPLSQIQFQTTRPLTRSFTSSVRLLQAKSPKEAEQKSGLK---DVVRLLMLAKPDWKL 107
            + S L +   Q T+ +T +  S   L+Q     + EQKS      DV +  +     WK 
Sbjct: 923  ETSDLQESDSQKTKGVTENKESGEDLVQKGQLVKDEQKSNGAISLDVYKWYLKYFGGWKA 982

Query: 108  LVIAITLLTVSCGIGMTIPKVIGMILDVLKTGLETNEGKDGPISMADVP----------P 157
            L    TL  ++  + ++    I   ++ +K  +E N G    +S+  +P          P
Sbjct: 983  LSALFTLYIITQVLFISQSWWIRYWVNDIKPHIE-NSG----VSINGLPLKGSVLERLGP 1037

Query: 158  IFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVA--RLRANVIKKTIHQDSEF 215
            +   +++  +LG + A+    I A  G I  +      + A  ++  N++   +H    F
Sbjct: 1038 LKNKHTMLYYLGMYFAIGF--IQALLGGIKNIATFFSGIQASRKIFDNMLDLVLHAKIRF 1095

Query: 216  FDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFT 275
            FD   +G +++R   D   V + +T  +      LI           I+P       L  
Sbjct: 1096 FDVTPIGRIMNRFAKDIEGVDQELTPYLEVTMFCLIQCTSIIFLITIITPHF-----LIV 1150

Query: 276  PPVLFSASIF-GRKIRDTSTDLQE----ATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRY 330
              V+F    F G      S +L+         + +   E L GV T+++F  E+    R+
Sbjct: 1151 AVVVFILYYFVGMWYLTASRELKRIDSITKSPIFQHFSETLVGVCTIRAFGDEK----RF 1206

Query: 331  SHAIRDIFNVGKRAAY---INAQFFTATSSLGDISFLVVLAYGSYLVLQ-----GGLTIG 382
                 D  +   RA +   +  ++F     +  I   +VLA GS++++       GL   
Sbjct: 1207 ILENLDKIDQNNRAFFYLSVAVKWFAFRVDI--IGAFIVLASGSFILINIGNIDSGLAGI 1264

Query: 383  DLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELT------------DRVPSIKP 430
             LT  +L+T+        L   YS     + +  RL E +            D +  ++ 
Sbjct: 1265 SLTYAILFTD----GALWLVRLYSTFEMSMNSVERLKEYSSIEQENYFDYNKDHIQELQQ 1320

Query: 431  TTGKKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALL 490
            ++     P  G+I   +++  Y +    VI +++   I   S V +VG +G GKSTI   
Sbjct: 1321 SSW----PEHGQIEVDNLSLRYASNLPPVI-KNVSFTIEPQSKVGIVGRTGAGKSTIITA 1375

Query: 491  LLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKE 550
            L R   P +G I IDG DIS++++ +LRR I ++ Q+P+L +GT++ N+     E  +K+
Sbjct: 1376 LFRLLEPETGHIKIDGYDISQIDLVTLRRAITIIPQDPILFTGTIKSNVD-PCDEYDNKK 1434

Query: 551  EIRMVAKQCFCHNFIV-------------------KFPHGYDTVIGPQGALLSGGQKQRI 591
              +++++     N I                    KF +   T I   G  +S G++Q +
Sbjct: 1435 IFKVLSQV----NLISTGEMEAAQNMGDDSNTARNKFVN-LQTEITEGGQNISQGERQLL 1489

Query: 592  AIARALIKKPTILVLDEATSALDVESEGAINYTF-GQLMKSKSVTIVSIAHRLSTIRRSE 650
             IAR+L+++P I++LDEATS++D ES+  I      +  KS   TI++IAHRL ++   +
Sbjct: 1490 FIARSLLREPKIILLDEATSSIDYESDHLIQGIIRNEFNKS---TILTIAHRLRSVIDYD 1546

Query: 651  NIIVLGNDGSVVETGKFKE 669
             ++V+       + G+ KE
Sbjct: 1547 RVLVM-------DAGEIKE 1558

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/244 (28%), Positives = 119/244 (48%), Gaps = 18/244 (7%)

Query: 438 PGKGEIVFKDVTFSYPTRPGN-VIFR--DMDIKIPAGSNVCVVGPSGRGKSTIALLLLRF 494
           P + +I FK+ T ++     +  IF+   ++I    G    ++G +G GKS + + LL  
Sbjct: 661 PDENKIEFKNATLTWNENDKDSTIFKLCGLNITFQIGKLNLILGSTGSGKSALLMGLLGE 720

Query: 495 YNPSSGQIFIDGQDISKLNI---KSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEE 551
            +  SG I + G +     I     L        Q   L++ T+++NI +      + ++
Sbjct: 721 LHLISGSITVPGLEPRHDLIPDHNGLTNSFAYCSQSAWLLNDTVKNNIIFN----GAYDD 776

Query: 552 IRM--VAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEA 609
           +R   V   C     +   P G  T IG +G  LSGGQKQRI++ARA+      ++LD+ 
Sbjct: 777 VRYKEVIDACGLKRDLEILPAGDSTEIGEKGITLSGGQKQRISLARAVYSNAKHVLLDDC 836

Query: 610 TSALDVESEGAI--NYTFGQLMKSKSVTIVSIAHRLS-TIRRSENIIVLGNDGSVVETGK 666
            SA+D  +   I  N   G +M++++  +V+  H +S TIR +   ++L N G V   G 
Sbjct: 837 LSAVDSHTAVWIYENCITGPIMENRTCILVT--HNVSLTIREAYFAVILEN-GKVKNQGT 893

Query: 667 FKEL 670
            K+L
Sbjct: 894 IKQL 897

>NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON}
            Anc_4.6
          Length = 1682

 Score =  122 bits (306), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 123/488 (25%), Positives = 215/488 (44%), Gaps = 45/488 (9%)

Query: 199  RLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXX 258
            ++  +++   +H    FFD   +G +++R   D   V + +T  +   F  L+       
Sbjct: 1159 KIFKSLLHTVLHSKLRFFDATPIGRIMNRFSKDIEAVDQELTPYLEAAFYCLVECVSTML 1218

Query: 259  XXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQ-LTRVSEEQLSGVRTV 317
                I+PQ   +L +F   + +    F           +  T   + +   E L G+ T+
Sbjct: 1219 LIAFITPQFL-ILAIFIGFLYYLVGYFYMAASRELKRFESVTKSPIYQHFSETLVGIVTI 1277

Query: 318  QSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQ- 376
            +++  E++ +    H I +     K   Y+ A     +  +  I  LVV   G +++L  
Sbjct: 1278 RAYGDEKRFMLENLHKIDE---NNKPFFYLWAFNRWLSFRIDMIGSLVVFGAGVFIILNI 1334

Query: 377  ----GGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELT--DRVPSIKP 430
                 GL    LT  + +TE    +   L  FY+++   + +  RL E    D+ P  + 
Sbjct: 1335 DNLDSGLAGISLTYAISFTE----AALWLVRFYADVEMNMNSVERLKEYMEIDQEPYEEH 1390

Query: 431  TTGKKFV-----PGKGEIVFKDVTFSY-PTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGK 484
                + +     P  G+I   +++  Y P  P   + +++   +     V VVG +G GK
Sbjct: 1391 LERSEVLAVDNWPRNGKIEVNNLSLRYAPNLPK--VIKNVTFVVEPNCKVGVVGRTGAGK 1448

Query: 485  STIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNIT-YG- 542
            STI   L RF +  +G I ID  DI+ +N+  LRR I ++ Q+P L SGT+R N+  Y  
Sbjct: 1449 STIITALFRFLDAETGYIKIDDIDITTVNLTKLRRSITIIPQDPTLFSGTIRSNLDPYNE 1508

Query: 543  ---------------LTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQ 587
                           + E  S              N + KF +     I   G  LS GQ
Sbjct: 1509 FSDDAIFKALRRVNLINENESTGPASSETSPSSTEN-VNKFLN-LKNEITEGGNNLSHGQ 1566

Query: 588  KQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIR 647
            +Q + +AR+L++ P I++LDEAT+++D  S+  I  T  +  K    TI++IAHRL ++ 
Sbjct: 1567 RQLVCLARSLLRCPKIILLDEATASIDNASDAKIQETIRKEFKES--TILTIAHRLRSVC 1624

Query: 648  RSENIIVL 655
              + I+V+
Sbjct: 1625 DYDKILVM 1632

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 68/231 (29%), Positives = 114/231 (49%), Gaps = 11/231 (4%)

Query: 441 GEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSG 500
             I F++ T ++  +      RD++I    G    V+GP+G GKS++ L LL   +  +G
Sbjct: 729 NRIAFQNATVAWDKKNSEFKLRDLNIDFKPGKLNVVIGPTGSGKSSLLLALLGEMHLENG 788

Query: 501 QIFI---DGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKE-EIRMVA 556
            I +   D +D   ++   +   I    Q   L++ T+R+NI +    +P  E     V 
Sbjct: 789 NIIVPSLDPRDELVIDHDGMTNSIAYCSQGAWLLNDTVRNNILFN---SPYNEARYNAVV 845

Query: 557 KQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVE 616
           + C           G  T IG +G  LSGGQKQR+++ARAL      ++LD+  SA+D  
Sbjct: 846 EACCLKRDFEILKAGDMTEIGEKGITLSGGQKQRVSLARALYSNSRHVLLDDCLSAVDSH 905

Query: 617 SEGAI--NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETG 665
           +   I  N   G LM++++  +VS  H ++   R+  ++V+  DG V + G
Sbjct: 906 TALWIYDNCITGPLMENRTCILVS--HNIALTLRNAELVVILEDGRVKDQG 954

>Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] {ON}
            YDR135C (YCF1) - metal resistance protein, similar to
            multidrug resistance proteins and cystic fibrosis protein
            CFTR [contig 171] FULL
          Length = 1494

 Score =  122 bits (305), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 101/364 (27%), Positives = 178/364 (48%), Gaps = 17/364 (4%)

Query: 308  EEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTA--TSSLGDISFLV 365
            +E L G+ T++ +  + + +H     + +  N+      +NA  + A     +G I  L 
Sbjct: 1113 QETLGGISTIRGYQQQGRFLHINQARVDN--NMSAFYPSVNANRWLAFRLEFIGSIIILG 1170

Query: 366  VLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRV 425
                  + + QG LT G +   + Y      S+  +     E+   + +  R+ E  +  
Sbjct: 1171 AATLSVFRLKQGALTPGMIGLSVSYALQITQSLNWIVRMTVEVETNIVSVERIKEYANIT 1230

Query: 426  PS----IKPTTGKKFVPGKGEIVFKDVTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGPS 480
            P     I+     +  P  G I F++ +  Y  RP  ++  R+++I I     + +VG +
Sbjct: 1231 PEAPAVIESNRPAEDWPTHGAIKFENYSARY--RPELDLSLRNINIDIKPQERIGIVGRT 1288

Query: 481  GRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNIT 540
            G GKS++ L L R    + G+I IDG     + ++ LR H+ ++ Q+  +  GT+R+NI 
Sbjct: 1289 GAGKSSLTLALFRIIEAAEGRIIIDGVPTDSIGLRDLRHHLSIIPQDSQVFEGTVRENI- 1347

Query: 541  YGLTETPSKEEIRMVAKQCFCHNFIVKF-PHGYDTVIGPQGALLSGGQKQRIAIARALIK 599
               T   + EEI    +     + I        ++++   G  LS GQ+Q + +ARAL+ 
Sbjct: 1348 -DPTNEYTDEEIWHALELAHLKDHIKSLGKDELESMLTEGGGNLSVGQRQLMCLARALLI 1406

Query: 600  KPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDG 659
               ILVLDEAT+A+DVE++  I  T     K++  TI++IAHR++TI  S+ I+VL + G
Sbjct: 1407 PTRILVLDEATAAVDVETDQVIQETIRTAFKNR--TILTIAHRINTILDSDRILVL-DSG 1463

Query: 660  SVVE 663
             + E
Sbjct: 1464 KIAE 1467

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 123/244 (50%), Gaps = 25/244 (10%)

Query: 437 VPGKGEIVFK---DVTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLL 492
           V   GE+      D TF +  +P   V  ++++ +   G   C+VG  G GKS +   +L
Sbjct: 603 VTKTGEVAINVGADATFLWQRKPEYKVALKNINFQAKKGELTCIVGKVGSGKSALIQGIL 662

Query: 493 RFYNPSSGQIF-IDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEE 551
                  G +F + G         S+   I  V Q P +M+GT+++NI +G        +
Sbjct: 663 -------GDLFRVKG-------FASVHGSIAYVSQVPWIMNGTVKENILFGHKYDADFYD 708

Query: 552 IRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATS 611
             + A  C     +   P G +T++G +G  LSGGQK RI++ARA+  +    +LD+  +
Sbjct: 709 TTLRA--CALAVDLSILPKGDETLVGEKGISLSGGQKARISLARAVYARADTYLLDDPLA 766

Query: 612 ALDVE-SEGAINYTFG-QLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKE 669
           A+D   ++  I +  G Q + S  V +++  +++S +  +++I +L N G +++ G ++E
Sbjct: 767 AVDEHVAKHLIEHVLGSQGLLSSKVKVLA-TNKISVLSIADHISLLEN-GEIIQQGSYEE 824

Query: 670 LFAD 673
           + +D
Sbjct: 825 VTSD 828

>TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1377

 Score =  121 bits (304), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 141/544 (25%), Positives = 238/544 (43%), Gaps = 92/544 (16%)

Query: 167  FLGGFAALMVFG-IVANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVGDLI 225
            F  G  +  VFG IV   G+  LL  +  R    L    + + IH    F +   +G ++
Sbjct: 839  FYMGMYSFFVFGSIVFLTGQFSLLCYIGLRASKSLNLQAVNRVIHSPMWFMESTPMGRIM 898

Query: 226  SRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIF 285
            +R   D    + S+  ++ D  + ++               +S L +++ P    +    
Sbjct: 899  NRFTKD----TESLDNQILDNLRFVVYQACTIVG-------ISVLCIIYLPWFAIAIPGL 947

Query: 286  GRKIRDTSTDLQEATGQLTRVSEEQ-----------LSGVRTVQSFVAEQKEIHRYSHAI 334
            G  +    +  Q +  ++ R+   Q           L GV T++++ AE+    R+S+ +
Sbjct: 948  GLILFVACSHYQSSAREIKRLEAVQRSFIYNHLNDVLGGVDTIRAYGAEE----RFSYKL 1003

Query: 335  RDIFNVGKRAAYINA---QFFTATSSLGDISFLVVLAY------------GSYLVLQGGL 379
              + +    A+Y+     ++     +L  ISF ++++              + +VL   L
Sbjct: 1004 DYLIDKTNEASYLYTAVQRWINIVINLVGISFTLIVSLLCVTKVFNLSGASTGVVLSYVL 1063

Query: 380  TIGDLTAFML----YTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKK 435
             I DL    L     TE   +SV  L ++ +EL Q            + VPS       K
Sbjct: 1064 LIPDLLNNTLTMVTQTENDMNSVERLVTYATELPQEASHG-------EEVPS-------K 1109

Query: 436  FVPGKGEIVFKDVTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRF 494
              P  GEI F++V +++  R G   +     +KI AG  V + G +G GKST+   L R 
Sbjct: 1110 TWPENGEIKFENVRYTH--RDGLPAVLDKFTLKIAAGERVGICGRTGAGKSTVLGALYRL 1167

Query: 495  YNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRM 554
                SG++ ID  D+SKLN+ +LR  + ++ Q+PVL  G++R N+       P  E    
Sbjct: 1168 REVESGRVMIDDVDVSKLNLTALRSRLAIIPQDPVLFQGSVRHNL------DPFGEYDDD 1221

Query: 555  VAKQCFCHNFIVKF-------PHGYDT-----VIG---------PQGALLSGGQKQRIAI 593
            V K       + KF         G DT     ++G           G   S G++Q +A+
Sbjct: 1222 VLKNALMRCTVGKFNKTGNESTEGIDTDADNGLVGKFRLDQDVEENGCNFSVGERQVLAL 1281

Query: 594  ARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENII 653
            ARALI+  +ILVLDEAT+A+D  ++  +     +  K +  T++ +AHRL TI   + I+
Sbjct: 1282 ARALIRNSSILVLDEATAAVDAATDAHVQRLVAEAFKGR--TVLCVAHRLDTILNYDRIL 1339

Query: 654  VLGN 657
            VL N
Sbjct: 1340 VLEN 1343

 Score = 93.6 bits (231), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 105/401 (26%), Positives = 181/401 (45%), Gaps = 55/401 (13%)

Query: 295 DLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGK----RAAYINAQ 350
           ++ + T Q   +  E L+ ++ V+ +  EQ     Y  +I+ I ++      R   +   
Sbjct: 354 NINQVTDQRVSILREVLNNIKMVKLYCWEQA----YEKSIKKIRSLETSKLTRMEILKNV 409

Query: 351 FFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQ 410
            F+ T SL +I  L  + + +   + GGL      A  +++  +   +  L SFY  L  
Sbjct: 410 IFSVTFSLPNICSL--MTFLALFKIHGGLK----NAATIFSSLSLFKILSLLSFYIPLSL 463

Query: 411 G-----VGAATRLFELTDRVPS-----IKPTTGKKFVPGKGEIVFKDVTFSYPTRPGNVI 460
           G     V +  R  E  +   S     I+ T  + +      I     +F + T   +  
Sbjct: 464 GTAIDIVTSLDRFQEFLEAEESKETRIIRETNSEIYGDNTVAIKASHCSFRWDTEEKDNN 523

Query: 461 -------FRDMDIKIPAGSNVCVVGPSGRGKSTI--ALLLLRFYNPSSGQIFIDGQDISK 511
                  F D++ +I  G  + +VGP G GK+++  A+  L     + G++ +DG  +S 
Sbjct: 524 EEKEFSGFHDLNFEIMKGELIIIVGPIGSGKTSLLNAICGLMPQYGNEGELEVDGSLVS- 582

Query: 512 LNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHG 571
                     G     P + + T+RDNI +G     SK   + V + C     + K    
Sbjct: 583 ---------CGY----PWIQNTTVRDNILFGSKYDESK--FKRVIRMCSLEEDLEKLS-A 626

Query: 572 YD-TVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVE-SEGAINYTFGQLM 629
           YD T IG +G  LSGGQK RI +AR+L K+  I + D+  SA+D    +  +     + +
Sbjct: 627 YDMTEIGERGVTLSGGQKSRINLARSLYKEKDIYLFDDILSAVDSRVGQSIMKECLMEGL 686

Query: 630 KSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKEL 670
           K+K  T V   H+LS I +++ +IVLGNDG   + G++++L
Sbjct: 687 KNK--TRVLATHQLSLIGKADQLIVLGNDGK-FDMGRYEDL 724

>Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar to
            Ashbya gossypii ACL072C
          Length = 1678

 Score =  120 bits (301), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 132/537 (24%), Positives = 234/537 (43%), Gaps = 58/537 (10%)

Query: 159  FMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFDR 218
            F   SIY  LG   AL+      +  +++L  I   +   ++   ++KK ++    FFD 
Sbjct: 1124 FYYLSIYILLGTLRALI------STVKVILSYISGLKASRKIFTLLLKKVLYAKLRFFDS 1177

Query: 219  HKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPV 278
               G +++R   D   +   +       F +L+           I+P    + L F   +
Sbjct: 1178 TPTGRIMNRFSRDVEAIDEELIPFFEGAFASLVQCITTILLIGYITP----VFLFFAIVI 1233

Query: 279  LFSASIFGRKIRDTSTDLQE----ATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAI 334
              S  I G      S +LQ         + +   E L GV T+++F  E++ +       
Sbjct: 1234 CVSYYIVGYFYLVGSRELQRFESITKSPIHQHFSETLVGVTTIRAFGDERRFLAD----- 1288

Query: 335  RDIFNVGKRAAYINAQFFTATSSLGDISF-------LVVLAYGSYLVLQ-GGLTIGDLTA 386
                N+ K   + N  FF    +   ++F        V+LA G +++L    L  G    
Sbjct: 1289 ----NLSKVDTH-NRPFFYLWVTNRWLAFRIDFIGAFVILASGIFILLNVNSLDAGLAGI 1343

Query: 387  FMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELT--DRVPSIKPTTGKKFVPGKGEIV 444
             ++Y          L   YS +   + +  RL E    ++ PS          P +G+I 
Sbjct: 1344 SLIYAISFTEGALWLVRLYSNVEMTMNSVERLKEYMKIEQEPSTGLYEPPPEWPDRGKIE 1403

Query: 445  FKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFI 504
              +++  Y +    VI +++   +   S V +VG +G GKSTI   L RF +P +G I +
Sbjct: 1404 VNNLSLRYASNLPKVI-KNVTFTVEPQSKVGIVGRTGAGKSTIITALFRFLDPDTGTIKL 1462

Query: 505  DGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNI----TYG--------------LTET 546
            D  DI+ + +K LR+ I ++ Q+PVL +GT++ N+     Y               + E 
Sbjct: 1463 DNVDITSIRLKRLRQSITIIPQDPVLFAGTIKSNLDPYSEYADDRIFEALKRVNLIVQEE 1522

Query: 547  PSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVL 606
             +  +I   +      N + KF     + I   G+ LS GQ+Q + +AR+L++ P  ++L
Sbjct: 1523 LTPTDIPSSSSSLSFEN-VNKFLD-LTSEITEGGSNLSQGQRQLVCLARSLLRNPKAILL 1580

Query: 607  DEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVE 663
            DEAT+++D  S+  I  T  +       TI++IAHRL +I   + ++V+ + G + E
Sbjct: 1581 DEATASIDYASDAKIQQTIREEFSGS--TILTIAHRLRSIIDYDKVLVI-DSGELAE 1634

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 120/255 (47%), Gaps = 15/255 (5%)

Query: 423 DRVPSIKPTTGKKFVPGKGEIVFKDVTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGPSG 481
           D  P  +  T KK   G     F + T  +      +   ++++I    G    +VGP+G
Sbjct: 696 DETPKYRQLTVKKDRLG-----FSNATIGWDHDSATDFKLKNLNIDFKIGKLNVIVGPTG 750

Query: 482 RGKSTIALLLLRFYNPSSGQIFIDGQDISK---LNIKSLRRHIGLVQQEPVLMSGTLRDN 538
            GK+++ + LL   N S G+I++   +  +   ++   +   IG   Q   L++ TLR+N
Sbjct: 751 SGKTSLLMGLLGEINLSEGKIYVPALNPREDLVVDADGMTDSIGYCSQSAWLLNDTLRNN 810

Query: 539 ITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALI 598
           I +      ++     V   C     +     G  T +G +G  LSGGQKQR+++ARA+ 
Sbjct: 811 ILFSAPYEANR--YNAVIHACGLTRDLEILNAGDQTEVGEKGITLSGGQKQRVSLARAMY 868

Query: 599 KKPTILVLDEATSALDVESEGAI--NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLG 656
            +   ++LD+  SA+D  +   I  +   G LM+ ++  +VS  H  +   ++ + +V+ 
Sbjct: 869 SRARHILLDDCLSAVDSHTAQWIYKHCITGPLMEGRTCVLVS--HNTALTLKNADWVVIL 926

Query: 657 NDGSVVETGKFKELF 671
            +  V   G+  ELF
Sbjct: 927 ENAKVTAQGEPLELF 941

>TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_5.10
            YGR281W
          Length = 1477

 Score =  120 bits (300), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 92/304 (30%), Positives = 145/304 (47%), Gaps = 33/304 (10%)

Query: 398  VFGLTSFYSELMQGVGAATRLFELTDRVPSI-----------KPTTGK-KFVPGKGEIVF 445
            V  L   ++ L++ V         T+R+ S            KP T   +  P +G I F
Sbjct: 1157 VLQLPGLFNTLLRAVSQVENDMNSTERLVSYATDLPLEAQYHKPETAPPESWPEEGTIKF 1216

Query: 446  KDVTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFI 504
            ++V F+Y  RPG  ++ ++++++I     + + G +G GKSTI   L R    +SG I I
Sbjct: 1217 ENVDFAY--RPGLPIVLKNINLQINGTEKIGICGRTGAGKSTIMTALYRLNELTSGSILI 1274

Query: 505  DGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSK-------------EE 551
            D  DI+KL +  LR+ + ++ Q+PVL  G +R N+      T  +             E+
Sbjct: 1275 DDVDINKLGLHELRKKLAIIPQDPVLFRGDIRKNLDPFHERTDEELWDVLVRGGAIAPED 1334

Query: 552  IRMVAKQCFCHNFIVKFPHGY--DTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEA 609
            +     Q    +      H +  D V+   GA  S G++Q +A+ RAL++   IL+LDEA
Sbjct: 1335 LAETKAQHITEDGTSADLHKFHLDKVVEEDGANFSLGERQILALTRALVRNTKILILDEA 1394

Query: 610  TSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKE 669
            TS++D E++  I             TI+ IAHRL TI   + I+VL + G V E      
Sbjct: 1395 TSSVDYETDRKIQERIATAF--SHCTILCIAHRLKTILNYDRILVLEH-GEVAEFDTPMN 1451

Query: 670  LFAD 673
            LF D
Sbjct: 1452 LFKD 1455

 Score = 93.6 bits (231), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 109/203 (53%), Gaps = 21/203 (10%)

Query: 461 FRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRH 520
           F +++ +I  G  V + GP G GK+++      F   +SG I I+G D+           
Sbjct: 612 FTNLNFEIKKGEFVMITGPIGTGKTSLLNSFAGFMEKTSGTIQING-DL----------- 659

Query: 521 IGLVQQEPVLMSGTLRDNITYGLTETPSKEE-IRMVAKQCFCHNFIVKFPHGYDTVIGPQ 579
             L+   P + + T+RDNI +G   +P +E+  + V + C   + +   P G  T IG +
Sbjct: 660 --LMGGYPWIQNATVRDNIIFG---SPYEEDKYKEVLRACSLESDLDILPAGDKTEIGER 714

Query: 580 GALLSGGQKQRIAIARALIKKPTILVLDEATSALDVE-SEGAINYTFGQLMKSKSVTIVS 638
           G  LSGGQK RI +AR + K+  I +LD+  SA+D    +  ++    +L+ +K+  + +
Sbjct: 715 GITLSGGQKARINLARCVYKEKDIYLLDDVLSAVDSRVGKHIMDECLTKLIGNKTRLLAT 774

Query: 639 IAHRLSTIRRSENIIVLGNDGSV 661
             H+LS I ++  IIVLGNDGSV
Sbjct: 775 --HQLSLIDKASRIIVLGNDGSV 795

>Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {ON}
            complement(69924..74519) [4596 nt, 1532 aa]
          Length = 1531

 Score =  119 bits (297), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 121/488 (24%), Positives = 221/488 (45%), Gaps = 41/488 (8%)

Query: 200  LRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXX 259
            L ++++   +     FF+   +G +++R  +D Y +   + +  S  F   +        
Sbjct: 1033 LHSSMVSSILRAPMTFFETTPIGRILNRFSNDVYKIDEVLGRSFSQFF---VNAVKVSFT 1089

Query: 260  XXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQE----ATGQLTRVSEEQLSGVR 315
               I       +LL  P  +         +R TS +L+         +    +E L G+ 
Sbjct: 1090 ILVICWNTWQFILLVIPMGVLYLYYQQYYLR-TSRELRRLDSITKSPIYAHFQESLGGLA 1148

Query: 316  TVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVL 375
            T++ +  +++ IH     + +  N+      IN+  + A   L  +  L++    S  +L
Sbjct: 1149 TIRGYEQQKRFIHINQARVDN--NMSAYYPSINSNRWLAYR-LEFLGSLIIFGAASLSIL 1205

Query: 376  Q---GGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRL---FELTDRVPSI- 428
            +   G LT G +   + Y      S+  +     E+   + +  R+    EL    P I 
Sbjct: 1206 KLRDGTLTAGMIGLSLSYALQVTQSLNWIVRMTVEVETNIVSVERIKEYAELKSEAPLII 1265

Query: 429  ---KPTTGKKFVPGKGEIVFKDVTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGPSGRGK 484
               +P+      P +G I F++ +  Y  RP  +++ +++ + I     V +VG +G GK
Sbjct: 1266 EEKRPSEN---WPERGAIKFENYSTRY--RPDLDLVLKNISLDIKPQEKVGIVGRTGAGK 1320

Query: 485  STIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLT 544
            S++ L L R    + G I +DG +IS++ +  LR  + ++ Q+  +  GT+R+NI    T
Sbjct: 1321 SSLTLALFRIIEAAEGSIIVDGLNISEIGLYDLRHKLSIIPQDSQVFEGTIRENI--DPT 1378

Query: 545  ETPSKEEIRMVAKQCFCHNFIVKF---------PHGYDTVIGPQGALLSGGQKQRIAIAR 595
               + E+I    +       I++           +   T +   G  LS GQ+Q + +AR
Sbjct: 1379 NIYTDEQIWNALELSHLKQHILRMNEESVNGSENNALYTRVTEGGNNLSVGQRQLMCLAR 1438

Query: 596  ALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVL 655
            AL+    IL+LDEAT+A+DVE++  I  T     K +  TI++IAHRL+TI  S+ I+VL
Sbjct: 1439 ALLVPSKILILDEATAAVDVETDSLIQETIRTAFKDR--TILTIAHRLNTIMDSDKIVVL 1496

Query: 656  GNDGSVVE 663
             + G V E
Sbjct: 1497 -DKGEVAE 1503

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 98/387 (25%), Positives = 176/387 (45%), Gaps = 50/387 (12%)

Query: 304 TRVSEEQLSGVRTVQSFVAEQKEIHRYSHA-----IRDIFNVGKRAAYINAQFFTATSSL 358
           TRV  E L+ +++++ +  EQ    +  H      ++++  +G   A  N QF      L
Sbjct: 485 TRVINEILNNIKSLKLYAWEQPYKEKLEHVRNEKELKNLTRIGVFNAMTNFQF-NLVPFL 543

Query: 359 GDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRL 418
              S   V  Y     L   L    LT F L T    +    +T+F    ++   + +RL
Sbjct: 544 VSCSTFAVFVYIEDKPLTTDLVFPALTLFNLLTFPLAALPIVITAF----IEASVSMSRL 599

Query: 419 FEL-------TDRVPSIKPTTGKKFVPGKGEIVFK---DVTFSYPTRPG-NVIFRDMDIK 467
           F         TD +  + P      V  +G+I      + TF +  +P   V  ++++ +
Sbjct: 600 FSFMTNEELQTDAIQRLPP------VKKQGDIAVNIGDNATFLWKRKPEYKVALKNIEFQ 653

Query: 468 IPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIF-IDGQDISKLNIKSLRRHIGLVQQ 526
              G   C+VG  G GKS     +L       G +F + G         ++  ++  V Q
Sbjct: 654 AKKGELACIVGKVGSGKSAFIQSIL-------GDLFRVKG-------FATIHGNVAYVSQ 699

Query: 527 EPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGG 586
            P +M+GT++DNI +G     ++E      + C     +   P G  T++G +G  LSGG
Sbjct: 700 LPWIMNGTVKDNILFG--HKYNQEFYEKTLRACALTIDLSILPDGDQTLVGEKGISLSGG 757

Query: 587 QKQRIAIARALIKKPTILVLDEATSALDVE-SEGAINYTFGQ--LMKSKSVTIVSIAHRL 643
           QK R+++ARA+  +  + +LD+  +A+D   S+  I +  G   L+ +K  T V   +++
Sbjct: 758 QKARLSLARAVYARADVYLLDDPLAAVDEHVSKHLIQHVIGPNGLLHTK--TRVLATNKI 815

Query: 644 STIRRSENIIVLGNDGSVVETGKFKEL 670
           S +  ++NI +L +DG +V+ G + E+
Sbjct: 816 SVLSIADNITLL-DDGEIVQQGTYNEV 841

>SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa]
            {ON} similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1558

 Score =  119 bits (297), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 94/319 (29%), Positives = 153/319 (47%), Gaps = 30/319 (9%)

Query: 378  GLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPS----IKPTTG 433
             L+ G +   M Y     +S+  +     ++   + +  R+ E  +  P     I+ +  
Sbjct: 1228 ALSSGMVGLLMSYALQVTTSLTWIVRMSVQVETDIVSVERILEYCNLPPEADAIIEESRP 1287

Query: 434  KKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLR 493
             K  P +G I F++ +  Y      V+ +D+ ++I     + +VG +G GKST++L L R
Sbjct: 1288 PKEWPSRGAITFQNYSTKYRENLDPVL-KDITVEIKPQEKIGIVGRTGAGKSTLSLALFR 1346

Query: 494  FYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNIT-YGLTETPSKEEI 552
               PS G I IDG DI+KL +  LR ++ ++ Q+     GT++ N+  +G     S EEI
Sbjct: 1347 LLEPSGGSIVIDGIDIAKLGLSDLRGNLAIIPQDAQAFEGTIKSNLDPFG---QYSDEEI 1403

Query: 553  RMVAKQCFCHNFIVKFPHGYDTV------------------IGPQGALLSGGQKQRIAIA 594
                +       I+K     +T                   I   G  LS GQ+Q + ++
Sbjct: 1404 WRALELSHLKPHILKMASEENTENSETTTEATRSHELLSARITENGGNLSIGQRQLLCLS 1463

Query: 595  RALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIV 654
            RAL+    ILVLDEAT+A+D+E++  I  T     K +  TI++IAHR+ T+  S+ I+V
Sbjct: 1464 RALLNHSKILVLDEATAAVDMETDKIIQETIKTAFKDR--TILTIAHRIDTVMDSDKIMV 1521

Query: 655  LGNDGSVVETGKFKELFAD 673
            L + G V E      L AD
Sbjct: 1522 L-DKGEVKEFDTPTNLLAD 1539

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 67/206 (32%), Positives = 108/206 (52%), Gaps = 20/206 (9%)

Query: 471 GSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVL 530
           G   C+VG  G GKST    +L      SG   +D     KL I++  + I    Q+P +
Sbjct: 656 GDLTCIVGRVGSGKSTFLQAILGQLPCISG---LDEHVPPKLIIRA--KSIAYCPQQPWI 710

Query: 531 MSGTLRDNITYG--LTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQK 588
           M+ +L+DN+ +G  L E   K  IR    +C     +   P G  T++G +G  LSGGQK
Sbjct: 711 MNASLKDNVIFGHRLNEDYYKATIR----KCQLLPDLDILPDGDQTLVGEKGISLSGGQK 766

Query: 589 QRIAIARALIKKPTILVLDEATSALDVE-----SEGAINYTFGQLMKSKSVTIVSIAHRL 643
            R+++ARA+  +  + +LD+  SA+D E      E  +N   G ++K+K+V + + A  +
Sbjct: 767 ARLSLARAVYARADVYLLDDILSAVDAEVSKNIVEQVLNRGTG-ILKNKTVILTTNA--V 823

Query: 644 STIRRSENIIVLGNDGSVVETGKFKE 669
           S ++ S+NI  L  DG +VE   + +
Sbjct: 824 SVLKHSQNIYALL-DGEIVENKSYAD 848

>YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC type
            transmembrane transporter of MRP/CFTR family, found in
            vacuolar membrane, involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates, along with Ycf1p
          Length = 1559

 Score =  119 bits (297), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 135/537 (25%), Positives = 250/537 (46%), Gaps = 37/537 (6%)

Query: 164  IYEFLGGFAALMVFGIVANYGR-IVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVG 222
            ++ F+G ++ + V     N  R I++L   S R   +L  ++ K  I     FF+   VG
Sbjct: 1017 VWMFVGVYSLIGVASAAFNNLRSIMMLLYCSIRGSKKLHESMAKSVIRSPMTFFETTPVG 1076

Query: 223  DLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSA 282
             +I+R  SD   V  ++    S  FK+++             P      +      ++  
Sbjct: 1077 RIINRFSSDMDAVDSNLQYIFSFFFKSILTYLVTVILVGYNMPWFLVFNMFLVVIYIYYQ 1136

Query: 283  SIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIH----RYSHAIRDIF 338
            + +    R+    +  +   +  +  E L+G   + ++   ++ I+    +  + +  +F
Sbjct: 1137 TFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYNVDFVF 1196

Query: 339  NVGKRAAYINAQFFTATSSLGDISFLVVLA-YGSYLVLQGGLTIGDLTAFMLYTEYTGSS 397
            N      +++ +  T  +++   + ++ LA   +   L  G+ +G L ++ L  E TGS 
Sbjct: 1197 NFRSTNRWLSVRLQTIGATIVLATAILALATMNTKRQLSSGM-VGLLMSYSL--EVTGSL 1253

Query: 398  VFGLTSFYSELMQGVGAATRLFELTDRVP---SIKPTTG-KKFVPGKGEIVFKDVTFSYP 453
             + + +  + +   + +  R+ E  +  P   SI P     +  P KG I FK+ +  Y 
Sbjct: 1254 TWIVRTTVT-IETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSKGGIEFKNYSTKYR 1312

Query: 454  TRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLN 513
                 V+  ++++KI     V +VG +G GKST++L L R   P+ G+I IDG DIS + 
Sbjct: 1313 ENLDPVL-NNINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDGIDISDIG 1371

Query: 514  IKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHG-- 571
            +  LR H+ ++ Q+     GT++ N+        S++E++   +Q      + K  H   
Sbjct: 1372 LFDLRSHLAIIPQDAQAFEGTVKTNL--DPFNRYSEDELKRAVEQAHLKPHLEKMLHSKP 1429

Query: 572  ---------------YDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVE 616
                            D  I   G+ LS GQ+Q + +ARAL+ +  ILVLDEAT+++D+E
Sbjct: 1430 RGDDSNEEDGNVNDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATASVDME 1489

Query: 617  SEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFAD 673
            ++  I  T  +  K +  TI++IAHR+ T+  S+ IIVL + GSV E     +L +D
Sbjct: 1490 TDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DQGSVREFDSPSKLLSD 1543

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 98/436 (22%), Positives = 188/436 (43%), Gaps = 76/436 (17%)

Query: 283 SIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGK 342
           +   RK++  S    +      +   E L+ +++++ +  E+  + R +H   D+     
Sbjct: 451 AFLSRKVKKLSKTQMKYKDMRIKTITELLNAIKSIKLYAWEEPMMARLNHVRNDMELKNF 510

Query: 343 RAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAF-------------ML 389
           R              +G +S L+  A+    ++    T G  + F             + 
Sbjct: 511 R-------------KIGIVSNLIYFAWNCVPLMVTCSTFGLFSLFSDSPLSPAIVFPSLS 557

Query: 390 YTEYTGSSVFGLTSFYSELMQGVGAATRL--FELTDRVPS-----IKPTTGKKFVPGKGE 442
                 S+++ + S  + +++   +  RL  F L+D +       I P+  ++ +P    
Sbjct: 558 LFNILNSAIYSVPSMINTIIETSVSMERLKSFLLSDEIDDSFIERIDPSADERALPA--- 614

Query: 443 IVFKDVTFSYPTRP---------------------GNVIFRDMD-IKIPAGSNVCVVGPS 480
           I   ++TF + ++                        +  +++D  +   G  VCVVG  
Sbjct: 615 IEMNNITFLWKSKEVLTSSQSGDNLRTDEESIIGSSQIALKNIDHFEAKRGDLVCVVGRV 674

Query: 481 GRGKSTIALLLLRFYNPSSGQI-FIDGQDIS---KLNIKSLRRHIGLVQQEPVLMSGTLR 536
           G GKST    +L       GQ+  + G   S   KL I+S    +    QE  +M+ ++R
Sbjct: 675 GAGKSTFLKAIL-------GQLPCMSGSRDSIPPKLIIRS--SSVAYCSQESWIMNASVR 725

Query: 537 DNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARA 596
           +NI +G      ++   +  K C     +   P G +T++G +G  LSGGQK R+++ARA
Sbjct: 726 ENILFG--HKFDQDYYDLTIKACQLLPDLKILPDGDETLVGEKGISLSGGQKARLSLARA 783

Query: 597 LIKKPTILVLDEATSALDVE-SEGAINYTF-GQLMKSKSVTIVSIAHRLSTIRRSENIIV 654
           +  +  I +LD+  SA+D E S+  I Y   G+    K+ TI+   + +S ++ S+ I  
Sbjct: 784 VYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKTALLKNKTIILTTNTVSILKHSQMIYA 843

Query: 655 LGNDGSVVETGKFKEL 670
           L N G +VE G ++++
Sbjct: 844 LEN-GEIVEQGNYEDV 858

>TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4.6
            YHL035C
          Length = 1642

 Score =  119 bits (297), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 122/492 (24%), Positives = 214/492 (43%), Gaps = 52/492 (10%)

Query: 204  VIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSI 263
            ++ K +H    FFD   +G +++R   D     + +T  +   F +L+           I
Sbjct: 1128 LLSKVMHAKLRFFDSTPIGRIMNRFSKDMEAADQELTPFIEGAFYSLVQCVSTVVLITFI 1187

Query: 264  SPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAE 323
            +PQ   + +L      F    +    R+       +   + +   E L GV T+++F  E
Sbjct: 1188 TPQFLFVAILVAVLYYFVGYFYLTGSRELKRLESISRSPIYQHFSETLVGVTTIRAFGDE 1247

Query: 324  QKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISF-------LVVLAYGSYLVLQ 376
             + +      I +           N  FF    +   +SF       LV+   G +++L 
Sbjct: 1248 SRFMRENLQKIDEN----------NRPFFYLWVANRWLSFRIDMIGALVIFGAGIFVLLN 1297

Query: 377  -----GGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTD--RVPSIK 429
                  G     LT  + +TE        L   YS +   + +  RL E  D  + P  +
Sbjct: 1298 IDHIDSGKAGISLTYAITFTE----GALWLVRLYSNVEMNMNSVERLKEYMDVEQEPYDQ 1353

Query: 430  PT-TGKKFVPGKGEIVFKDVTFSY-PTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTI 487
               T     P +G I   D++  Y P  P   + +++   +   S V +VG +G GKSTI
Sbjct: 1354 SILTPPVEWPQQGRIEVNDLSLRYAPNLPK--VIKNVSFTVDPRSKVGIVGRTGAGKSTI 1411

Query: 488  ALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETP 547
               L RF +P +G I ID  DI+ ++++ LRR I ++ Q+P L +GT++ N+      T 
Sbjct: 1412 ITALFRFLDPETGNIKIDNVDITSIDLQRLRRSITIIPQDPTLFTGTIKSNLDPYDEYTD 1471

Query: 548  SK-----EEIRMVAKQ-----------CFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRI 591
             +     + + +V ++                 I KF     + I   G  +S GQ+Q +
Sbjct: 1472 QQIFEALKRVNLVTQEELDRRPTSESSSVSSENINKFL-DLSSEISEGGGNISQGQRQLV 1530

Query: 592  AIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSEN 651
             +AR+L++ P I++LDEAT+++D  S+  I  T  +       TI++IAHRL ++   + 
Sbjct: 1531 CLARSLLRSPKIILLDEATASIDYASDAKIQETIRKEFGGN--TILTIAHRLRSVIDYDK 1588

Query: 652  IIVLGNDGSVVE 663
            I+V+ + G V E
Sbjct: 1589 ILVM-DAGEVKE 1599

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 61/233 (26%), Positives = 112/233 (48%), Gaps = 11/233 (4%)

Query: 440 KGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSS 499
           K +I F++ T ++     +   ++++I    G    ++GP+G GK+++ + LL   +  S
Sbjct: 693 KKKIGFENATITWDAERPDFKLKNLNIDFKVGKLNVIIGPTGSGKTSLLMALLGEMHLVS 752

Query: 500 GQIFIDGQDISK---LNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKE-EIRMV 555
           G+I +   D  +   +    +   +    Q   L++ T+++NI +    +P  E     V
Sbjct: 753 GKIIVPSLDPRQELPIEADGMTNSMAYCSQAAWLLNDTVKNNILFN---SPYNEGRYEAV 809

Query: 556 AKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDV 615
            + C           G  T IG +G  LSGGQKQRI++AR+L      ++LD+  SA+D 
Sbjct: 810 VEACGLKRDFSILSAGDLTEIGERGITLSGGQKQRISLARSLYSNARHVLLDDCLSAVDS 869

Query: 616 ESEGAI--NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGK 666
            +   I  N   G LM+ ++  +VS  H  +   R+  ++V   +G V   G+
Sbjct: 870 HTASWIYDNCITGPLMEGRTCILVS--HNTALTLRNAELVVTMENGQVKNQGE 920

>CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1 or uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1
          Length = 1535

 Score =  118 bits (296), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 83/246 (33%), Positives = 134/246 (54%), Gaps = 8/246 (3%)

Query: 420  ELTDRVP-SIKPTTGKKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVG 478
            EL    P  I+     K  P  GEI F+     Y     + + +D++++I     + +VG
Sbjct: 1270 ELKSEAPLVIESNRPPKEWPVAGEIKFEHYYTRY-REDLDYVLKDINLEIKPREKIGIVG 1328

Query: 479  PSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDN 538
             +G GKS++ L L R    +SG I IDG  I+++ +  LR H+ ++ Q+  +  GT+R+N
Sbjct: 1329 RTGAGKSSLTLALFRIIEATSGGILIDGVHINEIGLHDLRHHLSIIPQDSQVFEGTIREN 1388

Query: 539  ITYGLTETPSKEEIRMVAKQCFCHNFIVKF-PHGYDTVIGPQGALLSGGQKQRIAIARAL 597
            I    T   +  +I    +       I++    G  T++   G+ LS GQ+Q + +ARAL
Sbjct: 1389 I--DPTNQFTDADIWRALELSHLKEHIMQMGGDGLMTMMTEGGSNLSVGQRQLMCLARAL 1446

Query: 598  IKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGN 657
            +    +LVLDEAT+A+DVE++  I  T     K +  TI++IAHR++TI  ++ IIVL +
Sbjct: 1447 LVPSKVLVLDEATAAVDVETDKVIQETIRTSFKDR--TILTIAHRINTIMDNDRIIVL-D 1503

Query: 658  DGSVVE 663
             G VVE
Sbjct: 1504 KGKVVE 1509

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 92/385 (23%), Positives = 166/385 (43%), Gaps = 40/385 (10%)

Query: 304 TRVSEEQLSGVRTVQSFVAEQ--KEIHRYSHAIRDIFNVGKRAAYINAQFF--TATSSLG 359
           TRV  E L+ +++++ +  EQ  KE   Y    +++ N+ K   Y+    F       L 
Sbjct: 503 TRVISEILNNMKSLKLYAWEQPYKEKLEYVRNEKELKNLKKLGVYMACTSFQFNIVPFLV 562

Query: 360 DISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLF 419
             S   V  Y     L   L    LT F L +      +  + +  + +++   + +RLF
Sbjct: 563 SCSTFAVFVYTEDKALTTDLVFPALTLFNLLS----FPLMVIPNVITAIIESSVSVSRLF 618

Query: 420 ELTDRVPSIKPTTGKKFVPGKGEI------VFKDVTFSYPTRPG-NVIFRDMDIKIPAGS 472
                    K    +  +P   EI      V  + TF +  +P   V  ++++ +   G 
Sbjct: 619 NFLTNEELQKDAVQR--LPKVKEIGDVAVNVGDNATFLWKRKPEYKVALKNINYQAKKGE 676

Query: 473 NVCVVGPSGRGKSTIALLLLRFYNPSSGQIF-IDGQDISKLNIKSLRRHIGLVQQEPVLM 531
             C+VG  G GKS     LL       G +F + G         ++   +  V Q   +M
Sbjct: 677 LSCIVGKVGSGKSAFLQSLL-------GDLFRVKG-------FATIHGSVAYVSQVAWIM 722

Query: 532 SGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRI 591
           +GT+RDN+ +G    P  E      K C     +     G  T++G +G  LSGGQK R+
Sbjct: 723 NGTVRDNVLFGHKYDP--EFYEKTIKACALTIDLATLVDGDQTLVGEKGISLSGGQKARL 780

Query: 592 AIARALIKKPTILVLDEATSALDVE-SEGAINYTFGQ--LMKSKSVTIVSIAHRLSTIRR 648
           ++ARA+  +    +LD+  +A+D   S   + +  G   L+ SK+  + +  +++S +  
Sbjct: 781 SLARAVYARADTYLLDDPLAAVDEHVSRHLVEHVLGPNGLLHSKTRILAT--NKISVLSA 838

Query: 649 SENIIVLGNDGSVVETGKFKELFAD 673
           +++I +L N G + + G + +   D
Sbjct: 839 ADSITLLEN-GEITQQGTYADCRKD 862

>Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON}
            YHL035C (REAL)
          Length = 1587

 Score =  117 bits (294), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 133/518 (25%), Positives = 235/518 (45%), Gaps = 82/518 (15%)

Query: 203  NVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXS 262
            N++   +H +  FFD   VG +++R   D   V + +   +      LI           
Sbjct: 1078 NMLDLVLHANIRFFDVTPVGRIMNRFAKDIEGVDQELIPYLEVTIFCLIQCLSIIFLITI 1137

Query: 263  ISPQLSGLLLLFTPPVLFSASIF---GRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQS 319
            I+P+   + ++      F    +   GR+++   +  +    Q      E L+GV T+++
Sbjct: 1138 ITPRFLVVAVVVLVLYYFVGKCYLSAGRELKRIDSITKSPIFQYF---SETLAGVCTIRA 1194

Query: 320  FVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGG- 378
            F  E+    R+     D  +   RA      FF  + ++   +F V +  G+++VL  G 
Sbjct: 1195 FGDEK----RFILENMDKIDQNNRA------FFYLSVAVKWFAFRVDII-GAFIVLGSGS 1243

Query: 379  ---LTIGDLTAFMLYTEYTGSSVF-----GLTSFYSELMQGVGAATRLFELT-------- 422
               L IGD+ + +     T S +F      L   YS     + +  RL E +        
Sbjct: 1244 FILLNIGDIDSSLAGISLTYSILFTDGALWLVRLYSTFEMNMNSVERLKEYSGIEQENYN 1303

Query: 423  -DRVPSIKPTTGKKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSG 481
             + + +++ +      P  G+I   +++  Y +    VI +++   +   + + +VG +G
Sbjct: 1304 ENHIQALQNS----LWPEHGKIEVDNLSLRYASNLPPVI-KNVSFTVDPQTKIGIVGRTG 1358

Query: 482  RGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNI-- 539
             GKSTI   L R   P +G I IDG DISK+++ +LRR I ++ Q+P+L +GT++ N+  
Sbjct: 1359 AGKSTIITALFRLLKPVTGCIKIDGYDISKIDLVTLRRAITIIPQDPILFTGTIKSNLDP 1418

Query: 540  --------------------TYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQ 579
                                +  L ET ++EE          HN  +       T I   
Sbjct: 1419 YDEYDERRIFKVLSQVNLISSRELEETLNREE-----NFSGVHNRFLNLR----TEIVEG 1469

Query: 580  GALLSGGQKQRIAIARALIKKPTILVLDEATSALDVES----EGAINYTFGQLMKSKSVT 635
            G  LS G+KQ + IAR+L+++P I++LDEATS++D +S    +G I   F     S+S T
Sbjct: 1470 GLNLSQGEKQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRNEF-----SRS-T 1523

Query: 636  IVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFAD 673
            I++IAHRL ++   + ++V+ + G V E     EL  +
Sbjct: 1524 ILTIAHRLRSVIDYDKVLVM-DAGEVKEYDHPYELLKN 1560

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 74/244 (30%), Positives = 112/244 (45%), Gaps = 18/244 (7%)

Query: 438 PGKGEIVFKDVTFSYPTRPGNV-IFR--DMDIKIPAGSNVCVVGPSGRGKSTIALLLLRF 494
           P K +I FK  T  +     ++  FR  D++I    G    ++G +G GKS + + LL  
Sbjct: 657 PDKNKIKFKKATLVWNENDNDINKFRLCDLNINFRIGKLNLILGSTGSGKSALLMGLLGE 716

Query: 495 YNPSSGQIFIDGQD-----ISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSK 549
               SG I + G +     I  LN   L        Q   L++GT+R+NI +       +
Sbjct: 717 LYLLSGSIIVPGLEPRHDMIPDLN--GLTNSFAYCSQSAWLLNGTVRNNIIFN--GVYDE 772

Query: 550 EEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEA 609
              + V   C     +   P G  T IG +G  LSGGQKQRI++ARA+      ++LD+ 
Sbjct: 773 NRYKNVIDACGLKRDLEILPAGDSTEIGEKGITLSGGQKQRISLARAIYSNAKHVLLDDC 832

Query: 610 TSALDVESEGAINYTF---GQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGK 666
            SA+D  +   I Y     G LMK+++  +V+  H +S   R     V+  +G V   G 
Sbjct: 833 LSAVDSHTAIWI-YEICITGLLMKNRTCILVT--HNISLAIRKAYFAVILENGKVKSQGT 889

Query: 667 FKEL 670
             EL
Sbjct: 890 ITEL 893

>KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1653

 Score =  115 bits (289), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 123/495 (24%), Positives = 214/495 (43%), Gaps = 66/495 (13%)

Query: 204  VIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSI 263
            ++ K +H    FFD   +G +++R   D   + + +       F + I           I
Sbjct: 1134 LLDKVLHAKLRFFDSTPIGRIMNRFSKDMEGIDQDLAPYFQGAFYSFIECITTIILITFI 1193

Query: 264  SPQ------LSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTV 317
            +PQ      + G+L         + S   R+++   +  +    Q      E L GV T+
Sbjct: 1194 TPQFLSVAIIVGMLYYMIGYFYLTGS---RELKRLDSITKSPIYQHF---SETLVGVTTI 1247

Query: 318  QSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISF-------LVVLAYG 370
            ++F  E + +        ++  + +     N  FF    +   +SF       LVV   G
Sbjct: 1248 RAFGDESRFLRE------NLLKIDEN----NRPFFYLWVANRWLSFRIDVIGALVVFGSG 1297

Query: 371  SYLV-----LQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELT--D 423
             +++     +  G+    LT  + +TE        L  FYSE+   + +  R+ E    +
Sbjct: 1298 IFILTNINTIDSGMAGISLTYAISFTE----GALWLVRFYSEVEMNMNSVERVHEYMTIE 1353

Query: 424  RVPSIKPTTGKKFVPG----KGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGP 479
            + P  +       VP     +G I   D++  Y      VI +++   +   + V VVG 
Sbjct: 1354 QEPYDEVQVSDSKVPADWPEEGRIEVSDLSLRYAAHLPKVI-KNVTFNVDPRAKVGVVGR 1412

Query: 480  SGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNI 539
            +G GKSTI   L RF    +G I IDG DI+ +N+  LRR I ++ Q+P L SGT++ N+
Sbjct: 1413 TGAGKSTIITALFRFLEAETGYIKIDGLDITSVNLTRLRRSITIIPQDPTLFSGTIKSNL 1472

Query: 540  ----TYGLTET-PSKEEIRMVAKQ-------------CFCHNFIVKFPHGYDTVIGPQGA 581
                 Y   E   +   + +V ++                   I +F    ++ I   G 
Sbjct: 1473 DPYDEYKDEEVFEALRRVNLVTEEELSSRTENNNDEASVSSKNINRFL-DLESEIAEGGT 1531

Query: 582  LLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAH 641
              S GQ+Q I +AR+L++ P IL+LDEAT+++D +S+  +  T          TI++IAH
Sbjct: 1532 NFSQGQRQLICLARSLLRSPKILLLDEATASIDYDSDAKVQETIRTEFSES--TILTIAH 1589

Query: 642  RLSTIRRSENIIVLG 656
            RL ++   + I+V+G
Sbjct: 1590 RLRSVIDYDKILVMG 1604

 Score = 94.0 bits (232), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 115/233 (49%), Gaps = 11/233 (4%)

Query: 439 GKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPS 498
            K +I FK+ T ++     +   R+++I    G    ++GP+G GK+++ + LL   N  
Sbjct: 697 NKNQIAFKNTTVAWDNSRDSFKLRNLNIDFKVGKLNVIIGPTGSGKTSLLMALLGEMNLL 756

Query: 499 SGQIFIDGQDI-SKLNIKS--LRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKE-EIRM 554
            GQI +   +    L ++S      I    Q   L++ T+R+NI +    +P  E     
Sbjct: 757 EGQIVVPALNARHDLIVESDGTTNSIAYCSQAAWLLNDTVRNNILFN---SPYNETRYHN 813

Query: 555 VAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALD 614
           V + C           G  T IG +G  LSGGQKQRI++ARAL      ++LD+  SA+D
Sbjct: 814 VVEACGLRRDFEILKAGDMTEIGEKGIALSGGQKQRISLARALYSNSRHVLLDDCLSAVD 873

Query: 615 VESEGAI--NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETG 665
             +   +  N   G LM+ ++  +VS  H ++   R+ +++V+  DG V + G
Sbjct: 874 AHTALWVYDNCITGPLMEGRTCILVS--HNIALTLRNADLVVMLEDGQVKDQG 924

>TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1546

 Score =  115 bits (287), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 129/541 (23%), Positives = 221/541 (40%), Gaps = 92/541 (17%)

Query: 200  LRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVS----RSMTQKVSDGFKA-----L 250
            L + ++   +     FF+   +G +++R  +D Y V     R+ +Q  S+  K      +
Sbjct: 1009 LHSQMLASVLRAPMSFFETTPIGRILNRFSNDMYKVDELLGRTFSQFFSNAVKVTFTLVV 1068

Query: 251  ICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVS--- 307
            IC               +   + F  P+ F    + +    TS +L+     +TR     
Sbjct: 1069 ICVS-------------TWQFIFFIVPMSFLYIYYQQYYMRTSRELRRLDS-VTRSPTIS 1114

Query: 308  --EEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTA--TSSLGDISF 363
              +E L G+ T++ +  E + IH     + +  N+      IN   + A     LG +  
Sbjct: 1115 HFQETLGGISTIRGYSQENRFIHINQQRVDN--NMSAYYPSINCNRWLAFRLEFLGSVII 1172

Query: 364  LVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRL---FE 420
            L     G Y + QG +T G +   + Y      S+  +     E+   + +  R+    E
Sbjct: 1173 LGASTLGIYRLSQGNMTPGMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSE 1232

Query: 421  LTDRVPSI----KPTTGKKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCV 476
            L    PSI    +P       P  G + F      Y     + + +D+ + I     + +
Sbjct: 1233 LASEAPSIVEDKRPDVN---WPQDGAVKFNHYYTRYRADL-DYVLKDITLDIKPREKIGI 1288

Query: 477  VGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLR 536
            VG +G GKS++ L L R    S G I +DG +  ++ +  LR  + ++ Q+  +  GT+R
Sbjct: 1289 VGRTGAGKSSLTLALFRIIEASEGNINVDGINTDEIGLYDLRHKLSIIPQDSQVFEGTVR 1348

Query: 537  DNITYGLTETPSKEEIRMVAKQCFCHNFIVKF---------------------------- 568
            DNI    T   + EEI    +     + I+                              
Sbjct: 1349 DNI--DPTGQYTDEEIWKALELSHLKSHIINMSKHSSSDSSSNESLSPASNNSSGNNDNS 1406

Query: 569  ----------------PHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSA 612
                             +  +T +   G+ LS GQ+Q + +ARAL+    ILVLDEAT+A
Sbjct: 1407 NSSSDGLTSSGLEDISHNALNTKLSEGGSNLSVGQRQLMCLARALLVPSNILVLDEATAA 1466

Query: 613  LDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFA 672
            +DVE++  I  T     K++  TI++IAHRL+TI  S+ I+VL + G + E    + L  
Sbjct: 1467 VDVETDQLIQETIRSAFKNR--TILTIAHRLNTIMDSDRILVL-DKGEIKEFDSPQTLLG 1523

Query: 673  D 673
            D
Sbjct: 1524 D 1524

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 97/393 (24%), Positives = 175/393 (44%), Gaps = 54/393 (13%)

Query: 304 TRVSEEQLSGVRTVQSFVAEQ--KEIHRYSHAIRDIFNVGKRAAYIN-AQF-FTATSSLG 359
           TR+  E L+ +++++ +  E   KE   Y    +++ N+ K   Y+    F F     L 
Sbjct: 468 TRLISEILNNIKSLKLYAWEAPYKEKLEYVRNEKELKNLTKMGCYVAFTHFQFNIVPFLV 527

Query: 360 DISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLF 419
             S   V  +     L   L    LT F L +    +    +TSF    ++   +  RLF
Sbjct: 528 SCSTFAVFVWTQDRPLTTDLVFPALTLFNLLSFPMAAIPIMITSF----IEASISINRLF 583

Query: 420 EL----------TDRVPSIKPTTGKKFVPGKGEIVFK---DVTFSYPTRPG-NVIFRDMD 465
                         R+P++K T         G++  K   D TF +  +P   V  ++++
Sbjct: 584 SFLTNEELQKDAVQRLPNVKNT---------GDVSIKLGDDATFLWKRKPEYKVALKNIN 634

Query: 466 IKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIF-IDGQDISKLNIKSLRRHIGLV 524
            +   G   C+VG  G GKS +   +L       G +F + G         ++   +  V
Sbjct: 635 FQARKGELTCIVGKVGSGKSALIQSIL-------GDLFRVKG-------FATVHGDVAYV 680

Query: 525 QQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLS 584
            Q P +M+GT+++NI +G      K+      K C     +   P G  T++G +G  LS
Sbjct: 681 SQVPWIMNGTVKENILFG--HKFDKKFYEKTIKACALTIDLSILPDGDSTLVGEKGISLS 738

Query: 585 GGQKQRIAIARALIKKPTILVLDEATSALDVE-SEGAINYTFGQ--LMKSKSVTIVSIAH 641
           GGQK R+++ARA+  +    + D+  +A+D    +  I +  G   L+ SK  T V   +
Sbjct: 739 GGQKARLSLARAVYARADTYLFDDPLAAVDEHVGKHLIEHVLGPNGLLHSK--TKVLATN 796

Query: 642 RLSTIRRSENIIVLGNDGSVVETGKFKELFADP 674
           +++ +  ++ I +L N G +++ GK++E+ +DP
Sbjct: 797 KITVLNIADYITLLDN-GEIIQRGKYEEVTSDP 828

>Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]
            {OFF} complement(118923..123713) [4791 nt, 1597 aa]
          Length = 1596

 Score =  114 bits (285), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 138/536 (25%), Positives = 236/536 (44%), Gaps = 51/536 (9%)

Query: 163  SIYEFLGGFAALMVFGIVANYGR-IVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKV 221
            +++ F+G +A + +     N  R IV+L   S R   +L  N+    ++    FF+   +
Sbjct: 1040 NLWMFVGVYALIGIISAAFNNLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPI 1099

Query: 222  GDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFS 281
            G +I+R   D   V   +    S  F++L+               ++ +L+ +  P  F 
Sbjct: 1100 GRIINRFSGDLDSVDSGLQFIFSHFFRSLLGYI------------VTVILVGYNMPWFFV 1147

Query: 282  ASIFGRKIRDTSTDLQEATG-QLTRVSEEQLSGVRT-VQSFVAEQKEIHRYSHAIR-DIF 338
             +IF   I          T  +L R++    S + + +   +A    I+ Y+HA R   F
Sbjct: 1148 FNIFLIVIYFYYQAYYIVTSRELKRLTSITYSPIMSLISETLAGYLVINAYNHAKRFSYF 1207

Query: 339  NVGKRAAYINAQF-FTATSS-----LGDISFLVVLAYG----SYLVLQGGLTIGDLTAFM 388
            N       I+  F F +T+      L  I  L+VLA G    S +     LT G +   M
Sbjct: 1208 NFESVQFNIDCLFNFRSTNRWLSVRLQAIGALIVLATGLLSLSTIGTSKQLTAGMVGLLM 1267

Query: 389  LYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKP----TTGKKFVPGKGEIV 444
             Y+    +S+  +     ++   + +  R+ E  +  P        T  +K  P  G I 
Sbjct: 1268 SYSLQVTNSLMWIVRMSVQIETNIVSVERILEYCELPPEPPHEIEETKPEKSWPAHGSIK 1327

Query: 445  FKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFI 504
            F D +  Y  +  + +   ++++I     + +VG +G GKST+ L L R    + G+I I
Sbjct: 1328 FIDYSTKY-RKNLDPVLNKINLEIEPREKIGIVGRTGAGKSTLTLALFRILEATDGKIVI 1386

Query: 505  DGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNIT----------YGLTET----PSKE 550
            DG DIS L +  LR ++ ++ Q+     GT+R N+           +   E     P  E
Sbjct: 1387 DGVDISTLGLSDLRSNLAIIPQDAQAFEGTIRTNLDPFDQHSDEELWKAIEASHLKPHLE 1446

Query: 551  EI---RMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLD 607
             I   R    +    N   K  +  +  I   G+ LS GQ+Q + ++RAL+    ILVLD
Sbjct: 1447 RIISNRDDNSESEETNVSAKDNNLLEIKINENGSNLSVGQRQLLCLSRALLNHSKILVLD 1506

Query: 608  EATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVE 663
            EAT+++D+E++  I  T       +  TI++IAHR+ T+   + I+VL + G V E
Sbjct: 1507 EATASVDMETDKIIQETIRNEFSDR--TILTIAHRIDTVLGYDKILVL-DKGEVRE 1559

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 64/221 (28%), Positives = 114/221 (51%), Gaps = 23/221 (10%)

Query: 459 VIFRDMD-IKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI-FIDGQDIS---KLN 513
           V F++++  ++  GS  C+VG  G GK+T+   +L       GQ+  I G   S   KL 
Sbjct: 670 VAFKNVNHFEVKEGSLTCIVGRVGSGKTTLLRAVL-------GQLPCISGAQESIPPKLI 722

Query: 514 IKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYD 573
           I+     I    Q+  +M+ ++++NI +G      +    +  + C     +   P G +
Sbjct: 723 IRG--NSIAYCPQQAWIMNSSVKENILFG--HKYDEHYYNLTIEACQLTEDLKMLPDGDE 778

Query: 574 TVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVE-SEGAINYTFGQ---LM 629
           T++G +G  LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  I     +   L+
Sbjct: 779 TIVGEKGISLSGGQKARLSLARAVYSRSDIYLLDDILSAVDAEVSKNIIEKVLDEQTGLL 838

Query: 630 KSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKEL 670
           KSK  TI+   + +S ++ S+ I  L N   ++E G + ++
Sbjct: 839 KSK--TIILTTNAISVLKHSQKIYALEN-CEIIEEGAYDDV 876

>Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 1568 aa]
            {ON} ANNOTATED BY YGOB -
          Length = 1568

 Score =  114 bits (285), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 138/538 (25%), Positives = 237/538 (44%), Gaps = 55/538 (10%)

Query: 163  SIYEFLGGFAALMVFGIVANYGR-IVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKV 221
            +++ F+G +A + +     N  R IV+L   S R   +L  N+    ++    FF+   +
Sbjct: 1012 NLWMFVGVYALIGIISAAFNNLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPI 1071

Query: 222  GDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFS 281
            G +I+R   D   V   +    S  F++L+               ++ +L+ +  P  F 
Sbjct: 1072 GRIINRFSGDLDSVDSGLQFIFSHFFRSLLGYI------------VTVILVGYNMPWFFV 1119

Query: 282  ASIFGRKIRDTSTDLQEATG-QLTRVSEEQLSGVRT-VQSFVAEQKEIHRYSHAIR-DIF 338
             +IF   I          T  +L R++    S + + +   +A    I+ Y+HA R   F
Sbjct: 1120 FNIFLIVIYFYYQAYYIVTSRELKRLTSITYSPIMSLISETLAGYLVINAYNHAKRFSYF 1179

Query: 339  NVGKRAAYINAQF-FTATSS-----LGDISFLVVLAYG----SYLVLQGGLTIGDLTAFM 388
            N       I+  F F +T+      L  I  L+VLA G    S +     LT G +   M
Sbjct: 1180 NFESVQFNIDCLFNFRSTNRWLSVRLQAIGALIVLATGLLSLSTIGTSKQLTAGMVGLLM 1239

Query: 389  LYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKP----TTGKKFVPGKGEIV 444
             Y+    +S+  +     ++   + +  R+ E  +  P        T  +K  P  G I 
Sbjct: 1240 SYSLQVTNSLMWIVRMSVQIETNIVSVERILEYCELPPEPPHEIEETKPEKSWPAHGSIK 1299

Query: 445  FKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFI 504
            F D +  Y  +  + +   ++++I     + +VG +G GKST+ L L R    + G+I I
Sbjct: 1300 FIDYSTKY-RKNLDPVLNKINLEIEPREKIGIVGRTGAGKSTLTLALFRILEATDGKIVI 1358

Query: 505  DGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIR--MVAKQCFCH 562
            DG DIS L +  LR ++ ++ Q+     GT+R N+     +  S EE+   + A     H
Sbjct: 1359 DGVDISTLGLSDLRSNLAIIPQDAQAFEGTIRTNL--DPFDQHSDEELWKAIEASHLKPH 1416

Query: 563  -----------------NFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILV 605
                             N   K  +  +  I   G+ LS GQ+Q + ++RAL+    ILV
Sbjct: 1417 LERIISNRDDNSESEETNVSAKDNNLLEIKINENGSNLSVGQRQLLCLSRALLNHSKILV 1476

Query: 606  LDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVE 663
            LDEAT+++D+E++  I  T       +  TI++IAHR+ T+   + I+VL + G V E
Sbjct: 1477 LDEATASVDMETDKIIQETIRNEFSDR--TILTIAHRIDTVLGYDKILVL-DKGEVRE 1531

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 64/221 (28%), Positives = 114/221 (51%), Gaps = 23/221 (10%)

Query: 459 VIFRDMD-IKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI-FIDGQDIS---KLN 513
           V F++++  ++  GS  C+VG  G GK+T+   +L       GQ+  I G   S   KL 
Sbjct: 642 VAFKNVNHFEVKEGSLTCIVGRVGSGKTTLLRAVL-------GQLPCISGAQESIPPKLI 694

Query: 514 IKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYD 573
           I+     I    Q+  +M+ ++++NI +G      +    +  + C     +   P G +
Sbjct: 695 IRG--NSIAYCPQQAWIMNSSVKENILFG--HKYDEHYYNLTIEACQLTEDLKMLPDGDE 750

Query: 574 TVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVE-SEGAINYTFGQ---LM 629
           T++G +G  LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  I     +   L+
Sbjct: 751 TIVGEKGISLSGGQKARLSLARAVYSRSDIYLLDDILSAVDAEVSKNIIEKVLDEQTGLL 810

Query: 630 KSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKEL 670
           KSK  TI+   + +S ++ S+ I  L N   ++E G + ++
Sbjct: 811 KSK--TIILTTNAISVLKHSQKIYALEN-CEIIEEGAYDDV 848

>KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1507

 Score =  113 bits (283), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 76/229 (33%), Positives = 128/229 (55%), Gaps = 13/229 (5%)

Query: 439  GKGEIVFKDVTFSY-PTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNP 497
            G  EI F  V   Y P  P   + +++   +   S V +VG +G GKST+ + L R    
Sbjct: 1234 GGAEISFDHVYVRYAPHLPD--VLKNVSFTLLPNSKVAIVGRTGSGKSTVMMSLFRLIEL 1291

Query: 498  SSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNIT-YGLTETPSKEEIRMVA 556
            ++G I I G DI+ LN+++LRR + ++ Q+P L SGT++ NI  +G     S +E+   A
Sbjct: 1292 TNGTIRIGGIDIASLNLQTLRRELTVIPQDPSLFSGTIKSNIDPFG---RYSDQELTHFA 1348

Query: 557  KQ--CFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALD 614
            ++   F     V+  +   +++   G  +S GQ+Q + +ARAL++K  IL+LDEAT+++D
Sbjct: 1349 RRIGLFSGTDDVRTFNSLGSLVSEGGENMSQGQRQLLCLARALLQKSKILILDEATASID 1408

Query: 615  VESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVE 663
             E++  I         S    ++++AHR+STI   + +IVL  D  +V+
Sbjct: 1409 HETDATIQQVVRDF--SSGGIVITVAHRMSTIIDYDQVIVL--DSGIVK 1453

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 118/237 (49%), Gaps = 17/237 (7%)

Query: 442 EIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQ 501
           E+ F++ + ++       + +++ I         ++GPSG GKS++ L LL   +   G 
Sbjct: 634 EMGFRNASLTWNRFDTGFMLKNLTIDFELHKLNVIIGPSGSGKSSVLLALLGELDLIEGS 693

Query: 502 IFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFC 561
           I      + +  +   R       Q P + + T+++NI +  +   + +  + V   C  
Sbjct: 694 I-----RVPRGYMHDDRCSFAFCSQTPWITNATVKENIVF--SSQFNTKRYQEVLHACGL 746

Query: 562 HNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAI 621
              I++   G +TV+G +G  LSGGQ+QR+A+ARA+      L+LD+  SA+D    G  
Sbjct: 747 EEDILEMQEGDETVVGDKGMTLSGGQRQRLALARAVYSGAEHLLLDDCLSAVD---PGMA 803

Query: 622 NYTF-----GQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFAD 673
            + F     G LMK K+  + +  H ++ +++  ++I+L ++G V + GK ++   D
Sbjct: 804 VWIFQKCIMGPLMKGKTCILAT--HNIALVQKHADMIILLDNGRVSKIGKARDFNFD 858

>TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.52
            YLL015W
          Length = 1570

 Score =  113 bits (283), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 138/599 (23%), Positives = 249/599 (41%), Gaps = 65/599 (10%)

Query: 118  SCGIGMTIPKVIGMILDVLKTGLETNEGKDGPISMADVPPIFMGYSIYEFLGGFAALMVF 177
            +CG+   I   + MIL  +    ET   K    S A       GY+  +FL       + 
Sbjct: 977  ACGVTGVILFFVFMILTRIFDLAETFWLKYWSESNAKA-----GYN-KDFLKFVTIYAII 1030

Query: 178  GIVA----NYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAY 233
            G+++    N   +++L   S R   +L   +    +     FF+   +G +++R  SD  
Sbjct: 1031 GLLSAAFNNIRTVIMLLYCSIRGSKKLHDGMALSVMRSPMSFFETTPIGRIVNRFSSDLE 1090

Query: 234  VVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIFGRKIRDTS 293
             +   +    S  F++++             P    L  +      +  + +    R+  
Sbjct: 1091 AIDSGLQYIFSFFFRSVLIYVVSLILVGYNLPWFIALNAVLIMIYFYYQAYYIMLSRELK 1150

Query: 294  TDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIR-DIFNVGKRAAYINAQF- 351
                 +   +  +  E L G   + +F           H  R + FN       I+  F 
Sbjct: 1151 RLTTISYSPIMSLISETLGGFSVINAF----------DHTSRFNFFNFETVQYNIDCVFQ 1200

Query: 352  FTATSS-----LGDISFLVVLAYG--SYLVL--QGGLTIGDLTAFMLYTEYTGSSVFGLT 402
            F +T+      L  I  L++LA G  S+  L  +  L+ G +   M Y+    SS+  + 
Sbjct: 1201 FRSTNRWLSVRLQTIGNLIILATGLLSFATLGTKKQLSSGMVGLLMSYSLQVTSSLMWIV 1260

Query: 403  SFYSELMQGVGAATRLFELTDRVPS----IKPTTGKKFVPGKGEIVFKDVTFSYPTRPGN 458
                ++   + +  R  E  +  P     I+ +   +  P +G I F + T  Y      
Sbjct: 1261 RMTVQIETRIVSVERTLEYCELKPEALEIIENSRPPEGWPREGAIEFNNYTTKYRENLDP 1320

Query: 459  VIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLR 518
            V+ +D+++ I     + +VG +G GKST+ L L R    + G I IDG DISK+ ++ LR
Sbjct: 1321 VL-KDINVSIKPKEKIGIVGRTGAGKSTLTLALFRLIEATGGSISIDGIDISKIGLEDLR 1379

Query: 519  RHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKF---------- 568
             ++ ++ Q+     GT+R N+     +  S EE+    +       I++           
Sbjct: 1380 SNLAIIPQDAQAFEGTIRSNL--DPFDQHSDEELWRAVELSHLKQHILRMNEEANDRESD 1437

Query: 569  --------PHGYD------TVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALD 614
                    P  ++      T I   G+ +S GQ+Q + ++RAL+    +L+LDEAT+A+D
Sbjct: 1438 SSRTDITTPDSHNIKELLATPISKNGSNVSVGQRQLLCLSRALLNPSKVLILDEATAAID 1497

Query: 615  VESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFAD 673
            +E++  +  T     K +  TI++IAHR+ T+   + I+VL + G V E      L +D
Sbjct: 1498 METDKIVQDTIKNEFKER--TILTIAHRIDTVMNYDKILVL-DKGEVAEFDTVSNLLSD 1553

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 58/215 (26%), Positives = 108/215 (50%), Gaps = 23/215 (10%)

Query: 465 DIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI----FIDGQDISKLNIKSLRRH 520
           +  +  GS  C+VG  G GKSTI   +L       GQ+     +D     K+ I++    
Sbjct: 650 NFTVKKGSLTCIVGKVGSGKSTILHAIL-------GQLPCISALDQTRAPKVTIRA--TS 700

Query: 521 IGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQG 580
           I    QE  +M+ ++++NI +G      +    +V + C   + +   P G +T++G +G
Sbjct: 701 IAYCPQEAWIMNSSVKENIVFG--HKHDENYYNLVIQACQLASDLSILPDGDETIVGEKG 758

Query: 581 ALLSGG-QKQRIAIARALIKKPTILVLDEATSALDVE-SEGAINYTFGQ---LMKSKSVT 635
             L GG QK RI++ARA+  +  + +LD+  SA+D   S+  I Y   +   L+++K  T
Sbjct: 759 ISLVGGVQKARISLARAVYARADVYLLDDILSAVDAHVSKNIIKYVLSKETGLLRNK--T 816

Query: 636 IVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKEL 670
           I+   + ++ ++ S+ I  +   G +VE   ++ +
Sbjct: 817 IILSTNNVNVLKNSQKIYAI-EKGEIVEESDYENV 850

>Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 992

 Score =  112 bits (281), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 91/284 (32%), Positives = 141/284 (49%), Gaps = 44/284 (15%)

Query: 410 QGVGAATRLF--------ELTDRVPSIKPTTGKKFVPGKGEIVFKDVTFSY-PTRPGNVI 460
            G+ +A RL         E   R P + P       P +GEI F+ V+F+Y P+ P   +
Sbjct: 690 NGMNSAERLVTYALDLPQEAEYRRPEMSPPEN---WPDRGEIKFEGVSFAYRPSLPP--V 744

Query: 461 FRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRH 520
            ++  + I +G  + + G +G GKSTI   L R      G+IFID  +I+ L +  LR  
Sbjct: 745 LKNFSLNIGSGEKIGICGRTGAGKSTIMSALYRINEVIDGKIFIDNINIADLGLFELRSK 804

Query: 521 IGLVQQEPVLMSGTLRDNIT-YG------LTETPSK------EEIRMVAKQ----CFCHN 563
           + ++ Q+PVL  GT++ N+  +G      L E+  +      E+I     Q       H+
Sbjct: 805 LAIIPQDPVLFRGTIKKNLDPFGEKTDQELWESLVRGGAIAPEDIEETKAQQPDASGSHS 864

Query: 564 FIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAIN- 622
            + KF    +  +  +G   S G+KQ +A+ RAL++   IL+LDEATS++D E++  I  
Sbjct: 865 KMHKFH--LEQKVEEEGGNFSLGEKQLLALTRALVRNSRILILDEATSSVDYETDDKIQS 922

Query: 623 ---YTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVE 663
                FG        TI+ IAHRL+TI   + I+VL   G V E
Sbjct: 923 RIVEAFG------DCTILCIAHRLNTILNYDRILVL-EQGEVAE 959

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 66/212 (31%), Positives = 108/212 (50%), Gaps = 22/212 (10%)

Query: 461 FRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRH 520
           F++++  I  G  + V GP G GK+++   +  F   S G + ++G+ +S          
Sbjct: 106 FQNLNFDIKKGEFIIVTGPIGTGKTSLLSAMAGFMARSGGSVEVNGRLLS---------- 155

Query: 521 IGLVQQEPVLMSGTLRDNITYGLTETP-SKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQ 579
            G     P + + T+RDNI +G   +P  K + R V K C   + +   P G  T IG +
Sbjct: 156 CGY----PWIQNATVRDNIIFG---SPYEKAKYRKVIKACSLDSDLEILPAGDMTEIGER 208

Query: 580 GALLSGGQKQRIAIARALIKKPTILVLDEATSALDVE-SEGAINYTFGQLMKSKSVTIVS 638
           G  LSGGQK RI +AR + K   I + D+  SA+D    +  ++     L+  K+  + +
Sbjct: 209 GINLSGGQKARINLARCVYKDKDIYLFDDVLSAVDARVGKHIMDECLLGLLGQKTRILAT 268

Query: 639 IAHRLSTIRRSENIIVLGNDGSVVETGKFKEL 670
             H+L+ I ++  +IVLGNDGS    G ++EL
Sbjct: 269 --HQLALIEKATRLIVLGNDGSFT-IGTYEEL 297

>KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] {ON}
            similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281W YOR1 Plasma membrane transporter of the ATP-
            binding cassette (ABC) family mediates export of many
            different organic anions including oligomycin
          Length = 1486

 Score =  111 bits (277), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 86/278 (30%), Positives = 133/278 (47%), Gaps = 25/278 (8%)

Query: 412  VGAATRL-FELTDRVPSIKPTTGKKFVPGKGEIVFKDVTFSYPTRPG-NVIFRDMDIKIP 469
            +  AT L  E   R P + P       P  G I F  V+ +Y  RPG  ++ +D+ + + 
Sbjct: 1193 ISYATELPLEAAYRRPEMSPPAE---WPTDGRIEFDHVSLAY--RPGLPLVLKDVTLHVA 1247

Query: 470  AGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPV 529
            AG  + + G +G GKSTI   L R      G I IDG DIS L +  LR  + ++ Q+PV
Sbjct: 1248 AGEKIGICGRTGAGKSTIMSALYRMCELHDGSITIDGVDISTLGLYDLRSKLSIIPQDPV 1307

Query: 530  LMSGTLRDNITYGLTETPSK-------------EEIRMVAKQCFCHNFIVKFPHGY--DT 574
            +  G +R N+      T  +             E +  V  Q   +   +   H +    
Sbjct: 1308 MFKGDVRKNLDPFHERTDDELWHALVRGGAIPAESLATVRAQTHENAGSLSNMHKFHLQQ 1367

Query: 575  VIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSV 634
             +   G   S G++Q +A+ RAL+++  IL+LDEATS++D E++  I     +     + 
Sbjct: 1368 EVEEDGTNFSLGERQLLALTRALVRQSKILILDEATSSVDYETDAKIQTRIVEAF--SNC 1425

Query: 635  TIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFA 672
            TI+ IAHRL+TI   + I+VL + G V E      L+A
Sbjct: 1426 TILCIAHRLNTILDYDRILVL-DQGRVCEFDTPAALYA 1462

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 73/214 (34%), Positives = 101/214 (47%), Gaps = 26/214 (12%)

Query: 461 FRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRH 520
           F +++I+I  G  V V G  G GKS++   L  F   + G I+ DG              
Sbjct: 603 FDNLNIQITKGELVIVTGSVGTGKSSLLYALSGFMKKTGGDIYKDG-------------- 648

Query: 521 IGLVQQEPVLMSGTLRDNITYG--LTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGP 578
             L+   P + + T+RDNI +G    E    E IR+    C     +   P G  T IG 
Sbjct: 649 TMLLCGYPWIQNATVRDNILFGSPYNEARYNEIIRV----CSLQADLELLPAGDRTEIGE 704

Query: 579 QGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAI--NYTFGQLMKSKSVTI 636
           +G  LSGGQK RI +ARA+ KK  I + D+  SA+D      I      G+L  S   T 
Sbjct: 705 RGITLSGGQKARINLARAVYKKKDIYLFDDVLSAVDARVGKHIMDECLMGKLEGS---TR 761

Query: 637 VSIAHRLSTIRRSENIIVLGNDGSVVETGKFKEL 670
           V   H+LS I R+  +I +  DGS V+ G  +EL
Sbjct: 762 VLATHQLSLIARASKVIYIDLDGS-VDVGSVEEL 794

>TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1646

 Score =  110 bits (276), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 120/478 (25%), Positives = 202/478 (42%), Gaps = 43/478 (8%)

Query: 204  VIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSI 263
            ++ K +H    FFD   +G +++R   D   + + +T  V       +           I
Sbjct: 1136 LLSKVLHSKLRFFDSTPIGRIMNRFSKDIEAIDQELTPYVESVVYNSVQLIATVLLITYI 1195

Query: 264  SPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAE 323
            +     + LL      F    +    R+           + +   E L GV T++++   
Sbjct: 1196 TNGFIVVALLVILLYYFVGVYYLSGSRELKRFESTTKSPIYQHFSETLVGVTTIRAY--- 1252

Query: 324  QKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQ-----GG 378
              EI      +  I    K   Y+          +  I  LV+   G  +++       G
Sbjct: 1253 GDEIRFMKENLTKIDENNKPFFYLWVANRWLCFRIDIIGSLVIFGAGVLVLMNINKIDSG 1312

Query: 379  LTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTD--RVP-SIKPTTGKK 435
            L    LT  + +TE    S   L   YS +   + +  R+ E  D  + P S       K
Sbjct: 1313 LAGISLTYAITFTE----SALWLVRSYSNVEINMNSVERVKEYMDIEQEPYSAGIVNVDK 1368

Query: 436  FVPGKGEIVFKDVTFSY-PTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRF 494
              P +G+I   D++  Y P+ P   + +++   +     V VVG +G GKSTI   L RF
Sbjct: 1369 SWPSEGKIEVNDLSLRYAPSLPK--VIKNVSFTVEPKMKVGVVGRTGAGKSTIITALFRF 1426

Query: 495  YNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKE-EIR 553
             +P +G I ID  DI+ +++K LR+ I ++ Q+P L +GT++ N+       P  E    
Sbjct: 1427 LDPETGYIKIDNIDITTIDLKKLRKSITIIPQDPTLFTGTIKSNL------DPYNEYNDD 1480

Query: 554  MVAKQCFCHNFIVKFPHGYDTV----------------IGPQGALLSGGQKQRIAIARAL 597
             + K     N IV      D                  I   G+ LS GQ+Q + +AR+L
Sbjct: 1481 QIFKALRRVNLIVDGNLNSDVTSVSSENVNKFLNLQSEISEGGSNLSQGQRQLMCLARSL 1540

Query: 598  IKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVL 655
            ++ P I++LDEAT+++D  S+  I  T     + K  TI++IAHRL ++   + I+V+
Sbjct: 1541 LRAPNIMLLDEATASIDYASDAKIQGTIRN--EFKDSTILTIAHRLRSVIDYDKILVM 1596

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 115/223 (51%), Gaps = 10/223 (4%)

Query: 441 GEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSG 500
            +I  ++VT S+  +  +   R+++I    G    V+GP+G GK+++ + LL   +   G
Sbjct: 696 NKISLENVTVSWNKQKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSLLMALLGEMHLLEG 755

Query: 501 QIFIDGQD---ISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAK 557
           +I +   D       +   L   +    Q   L++ T+++NI +   E   +  + +++ 
Sbjct: 756 KITVPSLDPRCEMTFDSDGLSNSMAYCSQAAWLLNDTVKNNILFN-AEYNEERYLAVISA 814

Query: 558 QCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVES 617
                +F +    G  T IG +G  LSGGQKQRI++ARAL      ++LD+  SA+D  +
Sbjct: 815 CALKRDFEI-LAAGDLTEIGERGITLSGGQKQRISLARALYSSSKHILLDDCLSAVDSHT 873

Query: 618 EGAI--NYTFGQLMKSKSVTIVSIAHRLS-TIRRSENIIVLGN 657
              I  N   G LM++++  +VS  H ++ T++ +E +I++ N
Sbjct: 874 AAWIYDNCIIGPLMENRTCILVS--HNVALTLKNAEQVIMIDN 914

>TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_5.10
            YGR281W possible pseudogene; NNN added to avoid internal
            stop codon; truncated at 5' end
          Length = 1058

 Score =  110 bits (275), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 79/257 (30%), Positives = 133/257 (51%), Gaps = 27/257 (10%)

Query: 423  DRVPSIKPTTGKKFVPGKGEIVFKDVTFSYPT-RPGNVIFRDMDIKIPAGSNVCVVGPSG 481
            +R  S   T+     P  G+I FKD  F Y    P  +I ++ ++ + +G  + + G +G
Sbjct: 782  ERTSSKPETSPGHIWPENGKIQFKDANFRYKEGLP--LILKNFNMLVQSGEKIGICGRTG 839

Query: 482  RGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNIT- 540
             GKSTI   L R    + G I+ID  DIS L +  LR+++ ++ Q+P+L  GT+R N+  
Sbjct: 840  AGKSTIMNCLFRLDELTDGAIYIDDIDISTLGLHDLRKNLSIIPQDPILFEGTIRKNLDP 899

Query: 541  YGLTETPSKEEIRMVA----KQCFCH--------NFIVKFPHGYDTVIGPQGALLSGGQK 588
            +   +  +  E  +++    +  F H          + KF       +   G   S G+K
Sbjct: 900  FSYFDDATLWEAMILSGFIDRDTFGHFSEKPVNNKELTKFH--LTAHVEEDGTNYSLGEK 957

Query: 589  QRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSV---TIVSIAHRLST 645
            Q +A  RA+I    ++VLDEA+S++D E++  I     Q + SK     TI+ IAHRL+T
Sbjct: 958  QLLAFTRAIIHHSKVVVLDEASSSVDYETDAKI-----QTLISKQFSHNTILCIAHRLNT 1012

Query: 646  IRRSENIIVLGNDGSVV 662
            I + + I+VL + G+++
Sbjct: 1013 ILKYDRILVL-DHGNII 1028

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 69/212 (32%), Positives = 103/212 (48%), Gaps = 22/212 (10%)

Query: 461 FRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRH 520
           F +++  I  G  + + GP G GK+++   +        G I IDG      N++     
Sbjct: 205 FNNLNFSI-XGEFIIITGPIGTGKTSLLYAMSGLMKKLEGTIEIDG------NLQ----- 252

Query: 521 IGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQG 580
              +   P + + T+RDNI +G      KE+   V + C     +  F     T IG  G
Sbjct: 253 ---LCGYPWVQNTTVRDNIIFG--SKYEKEKFDHVIRICALTEDLENFSGKDLTEIGELG 307

Query: 581 ALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAI--NYTFGQLMKSKSVTIVS 638
             LSGGQK RI +ARA+ K   I + D+  SA+D      I  N   G L   K+  I++
Sbjct: 308 ITLSGGQKARINLARAIYKTSDIYLFDDILSAVDSRVGNFIMENCLLGAL-SGKTXXILA 366

Query: 639 IAHRLSTIRRSENIIVLGNDGSVVETGKFKEL 670
             H+LS I++++ I+VLGND S  E G +KEL
Sbjct: 367 -THQLSLIKKADRIVVLGNDNS-FEIGPYKEL 396

>AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YGR281W (YOR1)
          Length = 1400

 Score =  110 bits (274), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 75/234 (32%), Positives = 122/234 (52%), Gaps = 9/234 (3%)

Query: 442  EIVFKDVTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSG 500
            EIVF++V+F+Y  RPG  +    +   + AG  + + G +G GK+++   L R     SG
Sbjct: 1144 EIVFQEVSFAY--RPGLPLALCGVSFHVRAGEKIGICGRTGAGKTSVTTALYRLSELESG 1201

Query: 501  QIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCF 560
             I IDG DI+ L +  LR  + ++ Q+P+L  GT+R N+     E         + +   
Sbjct: 1202 SIKIDGVDIATLGLHDLRSALSIIPQDPLLFRGTVRKNLD-PFAEHTDGTLWSALVRSGV 1260

Query: 561  CHNFIVKFPHGY--DTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESE 618
                +V   H +  D  +   GA  S G++Q +A+ARAL++   IL+LDEATS++D  ++
Sbjct: 1261 VPAGVVPTSHKFHLDQEVDEGGANFSLGERQLLALARALVRSTRILILDEATSSVDYATD 1320

Query: 619  GAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFA 672
              +        + +  T++ +AHRL TI   + I+VL + G V E      LFA
Sbjct: 1321 ARVQARIAA--EFRQATVLCVAHRLRTIISYDRILVL-DQGRVAEFDTPYRLFA 1371

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 95/198 (47%), Gaps = 17/198 (8%)

Query: 463 DMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIG 522
           D+   I  G  + V+G  G GK+++   +  +   ++G + ++G         SL     
Sbjct: 553 DLLFSIKKGEFIIVIGAIGTGKTSLLNAVAGYMKKTTGSVHVNG---------SL----- 598

Query: 523 LVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGAL 582
           L    P + + T+RDNI +G +   ++ +   V   C        FP G  T +G +G  
Sbjct: 599 LFCGVPWIQNATIRDNIIFGSSFDQTRYD--EVVNACALEADFKIFPAGDKTEVGERGIT 656

Query: 583 LSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHR 642
           LSGGQK RI++ARA+ K   I + D+  SA+D      I      L + ++ T +   H+
Sbjct: 657 LSGGQKARISLARAIYKDRDIYLFDDIISAVDANVAAHITQK-CLLDRLQNRTRILATHQ 715

Query: 643 LSTIRRSENIIVLGNDGS 660
           L+ ++ +  +I LG DGS
Sbjct: 716 LALVQEASRVIFLGQDGS 733

>KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} similar
            to uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1454

 Score =  110 bits (275), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 126/535 (23%), Positives = 224/535 (41%), Gaps = 41/535 (7%)

Query: 167  FLGGFAALMVFGIVA-NYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVGDLI 225
            F  G   L V G +A  + + + + +L       L    +++ +H    F D   +G ++
Sbjct: 910  FYMGLYILFVLGSLAFMFTQFISIGLLGTYASKHLNIKALQRLLHAPMSFMDVTPIGRVM 969

Query: 226  SRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASIF 285
            +R   D   +   +T+ V      +              P  +  +       +F A  +
Sbjct: 970  NRFTKDTDTLDNEITESVRLLIFQIANLTGIIILCIIYIPWFAIAMPFLVFLYVFVADHY 1029

Query: 286  ---GRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGK 342
               GR+I+    D  + +      +E  L G+ T++++ +EQ+ + +    I  +   G 
Sbjct: 1030 QASGREIK--RMDAVQRSFVYNNFNE-VLGGMDTIKAYRSEQRFLMKSDFLINKMNEAGY 1086

Query: 343  RAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLT 402
                I      +   L  I  L++      +  Q  ++ G +   + Y       +  L 
Sbjct: 1087 LVTSIQRWVAISLDMLAVIFALIIALLC--VTRQFHVSAGSVGVMVTYVLQLPGLLNALL 1144

Query: 403  SFYSELMQGVGAATRLFELTDRVP-----SIKPTTGKKFVPGKGEIVFKDVTFSY-PTRP 456
               ++    + +A RL      +P      I  T   +  P +G I F++V+ +Y P  P
Sbjct: 1145 RSQTQTENDLNSAERLVNYAYDLPIEAKYRILETQPPEQWPSEGRIKFENVSLAYRPELP 1204

Query: 457  GNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKS 516
              V  +++ I I +   + + G +G GKSTI   L R     +G+I ID  DIS L +  
Sbjct: 1205 --VALKNVSIDIGSNEKIGICGRTGAGKSTIMSALYRLVELKTGKITIDDIDISTLGLYE 1262

Query: 517  LRRHIGLVQQEPVLMSGTLRDN----------------ITYGLTETPSKEEIRMVAKQCF 560
            LR  + ++ Q+PVL  G +R N                +  G  +    + IR   K   
Sbjct: 1263 LRSKLAIIPQDPVLFKGDIRRNLDPFQECTDEQLWDALVRGGAIDRKDVDSIRAQHKDA- 1321

Query: 561  CHNFIV--KFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESE 618
              N +    F    D ++   G+  S G++Q +A+ RAL++   IL+LDEATS++D  ++
Sbjct: 1322 --NGLSGDMFKFHLDQMVEDDGSNFSLGERQLLALTRALVRGSKILILDEATSSVDYATD 1379

Query: 619  GAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFAD 673
              I     +  +  + TI+ IAHRL TI     I+VL + G VVE    K+L+ D
Sbjct: 1380 AKIQSRIVE--EFSNCTILCIAHRLKTILAYNRILVL-DQGQVVEFDTPKKLYND 1431

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 99/202 (49%), Gaps = 21/202 (10%)

Query: 461 FRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRH 520
           F  ++  +     + + GP G GKS++   L  F   SSG + I G D+           
Sbjct: 592 FHGLNFDVKENEFIIITGPIGTGKSSLLNALAGFMRRSSGSMTIKG-DL----------- 639

Query: 521 IGLVQQEPVLMSGTLRDNITYGLTETP-SKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQ 579
             L+   P + + T++DNI +G   +P  K + + V + C     +   P G  T IG +
Sbjct: 640 --LLCGYPWVQNATVKDNILFG---SPFDKPKYQKVIEICSLQADLDILPAGDRTEIGER 694

Query: 580 GALLSGGQKQRIAIARALIKKPTILVLDEATSALDVE-SEGAINYTFGQLMKSKSVTIVS 638
           G  LSGGQK RIA+AR++ K   I + D+  SA+D    +  ++      +K K+  + +
Sbjct: 695 GITLSGGQKARIALARSVYKDMDIYLFDDVLSAVDSRVCKHIVDECMMGYLKQKTRILAT 754

Query: 639 IAHRLSTIRRSENIIVLGNDGS 660
             H+LS I ++  +I LG DGS
Sbjct: 755 --HQLSLIDKASRVIFLGLDGS 774

>YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative
           transporter of the multidrug resistance-associated
           protein (MRP) subfamily; contains a stop codon in S288C;
           adjacent ORFs YKR103W and YKR104W are merged in
           different strain backgrounds
          Length = 306

 Score =  104 bits (260), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 80/281 (28%), Positives = 141/281 (50%), Gaps = 38/281 (13%)

Query: 412 VGAATRLFELTDRVPS-----IKPTTGKKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDI 466
           + +  R+ E TD +PS     I P       P  G++  K+++  Y       +  ++  
Sbjct: 1   MSSVERIKEYTD-IPSESNGYISPPAN---WPQTGDVELKNLSLRYSPHSSKAL-DNVSF 55

Query: 467 KIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQ 526
           K+ AG+ V +VG +G GKS+I   + R  +  +G I ID +DI  + ++ LR  I  + Q
Sbjct: 56  KVKAGTKVGIVGRTGAGKSSIIAAIYRLSDWENGTITIDNKDIKHIPLERLRNSISCIPQ 115

Query: 527 EPVLMSGTLRDNIT----------YGLTET----PSKEEIRMVAKQ----CFCHNFIVKF 568
           +P L  GT+R N+           YG+          +E+ ++ +Q       H    +F
Sbjct: 116 DPTLFDGTVRSNLDPFDRYSDVQIYGVLSKVGLIEECDELCLIFEQEQPNFSSHKLRNRF 175

Query: 569 PHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQL 628
               +TV+   G+ LS GQ+Q + +AR+++    I+++DEAT+++D  S+  I  T  + 
Sbjct: 176 I-DLNTVVKSGGSNLSQGQRQLLCLARSMLGARNIMLIDEATASIDYISDAKIQKTIRET 234

Query: 629 MKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKE 669
           M  K+ TI++IAHRL ++   + I+V+       E G+ KE
Sbjct: 235 M--KNTTILTIAHRLRSVIDYDKILVM-------EMGRVKE 266

>Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR103W
            (REAL)
          Length = 1595

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 127/534 (23%), Positives = 232/534 (43%), Gaps = 73/534 (13%)

Query: 162  YSIYEFLGGF------AALMVFGIVANYGRIVLLRILSERVVARLRANVIKKTIHQDSEF 215
            Y+I  F+  F         ++FG   N  + +  ++LS   +A+LR             F
Sbjct: 1045 YTIIGFISSFLTAGKVWVAVLFG--TNATKKIFAKLLSSIFLAKLR-------------F 1089

Query: 216  FDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFT 275
             D   VG +++R   D  ++ + +       F +++           I+P+     LLF 
Sbjct: 1090 HDITPVGRIMNRFSKDMDIIDQQLIPNFEGLFYSVVVCLWVIFLIGYITPRF----LLFA 1145

Query: 276  PPVLFSASIFGRKIRDTSTDLQE----ATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYS 331
             P+     I G      S +L+         + ++  E + GV T+++   E++ I +  
Sbjct: 1146 IPLCALYYIVGSLYLRASRELKRIDNINVSPIHQLFTEAIKGVATIRALADERRFITQTL 1205

Query: 332  HAIRDIFNVGKRAA---YINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFM 388
             AI       K  A   Y+N      T  +  I  L++ +    +VL+       L   +
Sbjct: 1206 VAI------DKSNAPFFYLNLATEWITYRVDIIGALILFSSSLMIVLKAPYLDAGLAGIL 1259

Query: 389  L-----YTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVP-----SIKPTTGKKFVP 438
            L     +TE T   +  + S    LM  V    R+ E  D VP     S    T     P
Sbjct: 1260 LSNAFSFTE-TAQWIIKVFSGVELLMSSV---ERIKEYVD-VPLESSESNNYATPLANWP 1314

Query: 439  GKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPS 498
              G+I F+++T  Y       +   +  K+ AG+ V +VG +G GKS+I   + R  +  
Sbjct: 1315 QTGDIEFENLTLRYSPHSSKAL-DGVSFKVKAGTKVGIVGRTGAGKSSIIAAIYRLSDWE 1373

Query: 499  SGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNI----TYGLTET-PSKEEIR 553
             G I ID +DI  + ++ LR  I  + Q P L  GT+R N+     Y   +   + E++ 
Sbjct: 1374 DGTIIIDNKDIKYVPLECLRNSISCIPQNPTLFEGTIRSNLDPWDQYSDVQVFEALEKVG 1433

Query: 554  MVAKQ---CFCHNFIVKFPHGY---------DTVIGPQGALLSGGQKQRIAIARALIKKP 601
            ++ +    C      + +P  +         +TV+   G+ +S GQ+Q + +AR+++   
Sbjct: 1434 LIEQSEGLCSLPGQKLSYPSNHKLRNRFIDLNTVVKSGGSNISQGQRQLLCLARSMLGAR 1493

Query: 602  TILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVL 655
             I+++DEAT+++D  S+  I  T  + M  ++ T+++IAHRL ++   + I+V+
Sbjct: 1494 NIMLIDEATASIDYVSDAKIQKTIRETM--RNTTVLTIAHRLRSVIDYDKILVM 1545

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 116/233 (49%), Gaps = 9/233 (3%)

Query: 439 GKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPS 498
            K ++ F++    +     +   +++ I     +   ++GP+G GKS++ L LL   N  
Sbjct: 661 SKTKLGFENANMEWEAAETSFKLKNISIDFKQNTLNAIIGPTGSGKSSLLLGLLGELNLR 720

Query: 499 SGQI---FIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMV 555
           SG+I    +  +D  ++ I  +   +    Q P L+SGT++DNI +G  E  ++++   V
Sbjct: 721 SGKINVPTVHSRDDLEIGIDGMANSMAYCSQSPWLISGTIKDNIVFG--EFFNQQKFDDV 778

Query: 556 AKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDV 615
            K C     I     G  T +G  G  LSGGQ+QRIA+ARA+      L+ D+  SA+D 
Sbjct: 779 IKCCCLEKDIKAMTAGLKTDVGEGGFSLSGGQQQRIALARAIYSSSRYLLFDDCLSAVDP 838

Query: 616 ESEGAI--NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGK 666
           E+   I      G +MK ++  + S  H +S I +    +V+ ++G V   GK
Sbjct: 839 ETALHIYEECLCGPMMKGRTCIVTS--HNISLIIKQAQWLVILDNGEVKAQGK 889

>Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (REAL)
          Length = 1580

 Score =  107 bits (267), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 124/550 (22%), Positives = 235/550 (42%), Gaps = 70/550 (12%)

Query: 158  IFMGYSIYEFLGGFAALMVFGIVANY---GRIVLLRILSERVVARLRANVIKKTIHQDSE 214
            I   +S   FL  +A   + G+++++   G++ +  +       ++ + ++         
Sbjct: 1019 ILQTHSTLYFLLFYA---IIGLISSFLTAGKVWVAMLSGTNATKKIFSKLLSSIFEAKLR 1075

Query: 215  FFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLF 274
            F D   VG +++R   D  ++ + +       F +++           ++P+     L+F
Sbjct: 1076 FHDITPVGRIMNRFSKDMDIIDQQLIPNFEGLFYSVVVCLWIVILIGYVTPRF----LIF 1131

Query: 275  TPPVL----FSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRY 330
              P+     F  +++ R  R+           + ++  E + GV T+++   E++ I   
Sbjct: 1132 AIPLCGLYYFVGALYLRASRELKRIDNINVSPIHQLFTEAIKGVVTIRALADERRFITHT 1191

Query: 331  SHAIRDIFNVGKRAAYINAQFFTATSSLGDISF--------------LVVLAYGSYLVLQ 376
              AI      G      NA FF  + +   I++              L+++A   YL   
Sbjct: 1192 LEAID-----GS-----NAPFFYLSVATEWITYRVDIIGALVLFSSSLMIIARAPYL--D 1239

Query: 377  GGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFEL-TDRVPSIKPTTGKK 435
             GL    L+    +TE T   +  + S    LM  V       E+  +   S    T   
Sbjct: 1240 AGLAGILLSNAFSFTE-TAQWIIKVFSGVELLMSSVERIKEYIEVPLEFSKSNDSATSPV 1298

Query: 436  FVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFY 495
              P  GEI FK+++  Y       +  ++  K+  G+ V +VG +G GKS+I   + R  
Sbjct: 1299 DWPQTGEIEFKNLSLRYSPHSSKAL-DNVSFKVRTGTKVGIVGRTGAGKSSIIAAIYRLS 1357

Query: 496  NPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNI---------------- 539
            +  SG I ID +DI  ++++ LR  I  + Q P L  GT+R N+                
Sbjct: 1358 DWESGTIIIDNKDIKCVSLECLRNSISCIPQNPTLFDGTIRSNLDPYNQYSDKQVFDALA 1417

Query: 540  TYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIK 599
              GL E    E + +V  +    +F        ++V+   G+ LS GQ+Q + +AR+++ 
Sbjct: 1418 KVGLIE--RNEVLCLVTDRQQSSSFSPNKFSDLNSVVRSGGSNLSQGQRQLLCLARSMLG 1475

Query: 600  KPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDG 659
               I+++DEAT+++D  S+  I  T  + M  ++ TI++IAHRL ++     I+V+    
Sbjct: 1476 SRKIMLIDEATASIDYISDAKIQKTIRETM--ENTTILTIAHRLRSVIDYNKILVM---- 1529

Query: 660  SVVETGKFKE 669
               + G+ KE
Sbjct: 1530 ---DMGRVKE 1536

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 74/233 (31%), Positives = 118/233 (50%), Gaps = 9/233 (3%)

Query: 439 GKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPS 498
            K ++ FKD    +     +   +++ I+    S   ++GP+G GKS++ L LL   N  
Sbjct: 660 SKSKVGFKDANMEWDADETSFKLKNISIEFKLNSLNAIIGPTGSGKSSLLLGLLGELNLC 719

Query: 499 SGQIFI---DGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMV 555
           SGQI++   D +D  ++ I  +   +    Q P L+SGT+ DNI +G  E P++     V
Sbjct: 720 SGQIYVPSVDSRDDLEVGIDGMTNSMAYCSQSPWLISGTIEDNIVFG--ERPNQRRFNAV 777

Query: 556 AKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDV 615
            K C     +     G  T +G  G  LSGGQ+QR+A+ARA+      L+LD+  SA+D 
Sbjct: 778 IKACCLEKDVKAMSAGLKTSVGGGGFSLSGGQQQRVALARAIYSSSRFLLLDDCLSAVDP 837

Query: 616 ESEGAI--NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGK 666
           E+   I      G +MK ++  I S  H +S I +    +V+ ++G V   GK
Sbjct: 838 ETALNIYEKCLCGPIMKGRTCIITS--HNISLITKKAEWLVILDNGEVKGQGK 888

>ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLL048C
            (YBT1) and YHL035C
          Length = 1627

 Score =  107 bits (266), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 117/494 (23%), Positives = 213/494 (43%), Gaps = 57/494 (11%)

Query: 204  VIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSI 263
            V+ K +H    FFD    G +++RL  D   V + +       F A++           +
Sbjct: 1114 VLWKILHAKMRFFDATPTGRIMNRLSKDLEAVDQELIPYFEGSFAAVVQCISTLVLIAYV 1173

Query: 264  SPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVS-----EEQLSGVRTVQ 318
            +PQ     L+    + F  ++ G     TS +L+     +TR        E L G+ +++
Sbjct: 1174 TPQF----LIMAIFIGFLYALIGYFYVTTSRELKRFE-SITRSPIYQHFSETLVGITSIR 1228

Query: 319  SFVAEQK----EIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLV 374
            ++  E++     + R     R  F +     +I  ++      L  +  LV    G ++ 
Sbjct: 1229 AYGDERRFMLENLSRIDDNNRPFFYL-----WIANRWLAFRVDL--LGALVTFFSGLFIY 1281

Query: 375  LQ-GGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELT-------DRVP 426
            L  G L  G     + Y  +           YS +   + +  RL E         +   
Sbjct: 1282 LNIGKLDAGLAGISLTYAIFFTEGALWFVRHYSNVEMTMNSFERLKEYMEIEQEPYNENA 1341

Query: 427  SIKPTTGKKFVPGKGEIVFKDVTFSY-PTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKS 485
             + P       P  G I   D++  Y P  P   + ++++  +     V +VG +G GKS
Sbjct: 1342 QLPPDNW----PQHGRIDVSDLSLRYAPNLPK--VIKNVNFSVEPKLKVGIVGRTGAGKS 1395

Query: 486  TIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTE 545
            TI   + RF +P +G + ID  DI+ + +  LR+ I ++ Q+P L +GTL+ +I    ++
Sbjct: 1396 TIITAMFRFLDPETGFVKIDNIDITTIPLHRLRQSITIIPQDPTLFTGTLK-SILDPYSQ 1454

Query: 546  TPSKEEIRMVAKQCFCHNF----------------IVKFPHGYDTVIGPQGALLSGGQKQ 589
               K+    + +     +                 I KF    +  +   GA LS GQ+Q
Sbjct: 1455 YSDKQIYEALQRVNLLSDTDINSLSSPSTQSSGENINKF-LDLNNEVTEGGANLSQGQRQ 1513

Query: 590  RIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRS 649
             + +AR+L++ P I++LDEAT+++D  S+  I  T  +  + +  TI++IAHRL +I   
Sbjct: 1514 LVCLARSLLRSPKIIMLDEATASIDYTSDEKIQQTIRE--EFRDSTILTIAHRLKSIIDY 1571

Query: 650  ENIIVLGNDGSVVE 663
            + ++V+ + G V E
Sbjct: 1572 DKVLVM-DAGEVKE 1584

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 101/370 (27%), Positives = 166/370 (44%), Gaps = 25/370 (6%)

Query: 308 EEQLSGVRTVQSFVAEQKEIHRYSHAIRD--IFNVGKRAAYINAQFFTATSSLGDISFLV 365
            E L  +R ++ F A +    +   AIR+  +  + KRA   +A  F        +S +V
Sbjct: 541 NETLQSIRIIK-FFAWETNFEKEVQAIREDELATLLKRAIVWSAISFLWFM----VSTIV 595

Query: 366 VLA-YGSYLVLQGG-LTIG-DLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELT 422
           V A +  Y+ +QG  LTI    TA  L+     + +  L    S ++Q   +  R+    
Sbjct: 596 VSASFACYIYIQGEVLTIPVAFTALSLFVMLR-NPLDVLADMLSYVVQSKVSLDRIQAFL 654

Query: 423 DRVPSIKPTTGKKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGR 482
           D   + K    ++       + F++ T ++   P +   R++DI+   G      GP+G 
Sbjct: 655 DEDETTK---YEQLTISGNRLAFENATIAWNDDPSSFRLRNIDIEFMIGKLNVAFGPTGT 711

Query: 483 GKSTIALLLLRFYNPSSGQIFIDGQDISK---LNIKSLRRHIGLVQQEPVLMSGTLRDNI 539
           GKS++ L LL       G+I++   D  +   +    L   I    Q   L++ T R NI
Sbjct: 712 GKSSLLLGLLGEMTLQEGKIYVPSLDPREDLVIQADGLTNSIAYCSQSAWLLNDTARSNI 771

Query: 540 TYGLTETPSKEE-IRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALI 598
              L  +P  E+    V + C           G  T IG +G  LSGGQKQRI++ARAL 
Sbjct: 772 ---LFNSPYNEQRYNDVLEACGLKKDFEILSGGDLTQIGEKGMTLSGGQKQRISLARALY 828

Query: 599 KKPTILVLDEATSALDVESEGAI--NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLG 656
                L+LD+  SA+D  +   I  N   G LM+ ++  +VS  H ++   R+ + +V+ 
Sbjct: 829 SSARHLLLDDCLSAVDSHTALLIYENCIIGPLMEGRTCVLVS--HNVALTMRNADWVVIL 886

Query: 657 NDGSVVETGK 666
            +G V   G+
Sbjct: 887 ENGRVKAQGE 896

>TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON} 
          Length = 1485

 Score =  105 bits (263), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 138/561 (24%), Positives = 230/561 (40%), Gaps = 95/561 (16%)

Query: 167  FLGGFAALMVFG--IVANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVGDL 224
            F  G  +  VFG  I  N G+  LL  +       L    + K +H    F D + +G +
Sbjct: 942  FYMGLYSFFVFGSYIFMN-GQYTLLCYMGVVASKTLNLQALHKILHTPMSFMDTNPLGRI 1000

Query: 225  ISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPVLFSASI 284
            ++R   D   +   +T+ +      +                +  + +++ P   F+ +I
Sbjct: 1001 LNRFTKDTDALDNELTENLRLAMSQIANIIG-----------VGAMCIIYLP--WFAIAI 1047

Query: 285  -FGRKIRDTSTDLQEATGQLTRVSE------------EQLSGVRTVQSFVAEQKEIHRYS 331
             F   I     D  ++TG+  +  E            E L+G+ T++++ A+     R++
Sbjct: 1048 PFLLLIFLLIADHYQSTGREVKRLEAIQRSFVYNNLNEMLTGMDTIKAYNAQD----RFA 1103

Query: 332  HAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQ--------GGLTIGD 383
                 + +    AAYI+          G    LV +A+   + L          G   G 
Sbjct: 1104 TKSEFLIDKMNEAAYIS---IAVQRWAGIFLDLVAVAFALIITLLCVTRQFHISGADTGV 1160

Query: 384  LTAFMLY--------------TEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIK 429
            L  ++L               TE   +S   L S+ ++L Q         E   R P   
Sbjct: 1161 LLTYVLQLPGLLNTVLRALTQTENDMNSTERLVSYATQLPQ---------EAQYRKPECS 1211

Query: 430  PTTGKKFVPGKGEIVFKDVTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGPSGRGKSTIA 488
            P       P  G IVF+++ F+Y  RPG  +I ++ ++ I     + + G +G GKSTI 
Sbjct: 1212 PPID---WPQNGHIVFENINFAY--RPGLPIILKNFNLIIKPNEKIGICGRTGAGKSTIM 1266

Query: 489  LLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDN---------- 538
              L R    ++G+I ID  DIS L +  LR  + ++ Q+PVL  G +R N          
Sbjct: 1267 NALYRLTELTTGKIIIDDIDISNLGLYELRSKLAIIPQDPVLFRGNIRRNLDPFDEYQDD 1326

Query: 539  ------ITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIA 592
                  +  G  ++   E ++   K     N + KF    +  +   G   S G++Q +A
Sbjct: 1327 LLWESLVKAGAIDSQELETVKSQDKNSDAKN-LHKF--HLNQSVDEDGNNFSLGERQVLA 1383

Query: 593  IARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENI 652
            + RAL+++  IL+LDEATS++D E++  I             TI+ IAHRL TI   + I
Sbjct: 1384 LTRALVRQSKILILDEATSSVDYETDAKIQNLIATAF--NHCTILCIAHRLKTILNYDRI 1441

Query: 653  IVLGNDGSVVETGKFKELFAD 673
            +VL   G V E      LF +
Sbjct: 1442 LVL-EKGEVAEFDTPWNLFNN 1461

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 100/214 (46%), Gaps = 21/214 (9%)

Query: 460 IFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRR 519
           +  +++  IP G  V V GP G GK+++   L       SG++   G D+    I     
Sbjct: 624 LLSNINFTIPKGEFVVVTGPVGSGKTSLLFALAGLMEQLSGEMNHSG-DLLLCGI----- 677

Query: 520 HIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQ 579
                   P + + T+RDNI +G    P+    + V   C   + +   P    T +G +
Sbjct: 678 --------PWVQNATIRDNILFGSPYDPTF--YKRVLHVCALESDLENLPAHDKTEVGER 727

Query: 580 GALLSGGQKQRIAIARALIKKPTILVLDEATSALDVE-SEGAINYTFGQLMKSKSVTIVS 638
           G  LSGGQK RI++ARA+ K   I + D+  SA+D       ++Y     +  K+  + +
Sbjct: 728 GVTLSGGQKARISLARAVYKNKDIYLFDDVLSAVDARVGRHIMDYCMNDHLSDKTRILAT 787

Query: 639 IAHRLSTIRRSENIIVL--GNDGSVVETGKFKEL 670
             H+LS + +++ IIVL    D    E G FKEL
Sbjct: 788 --HQLSLVEKADRIIVLSTSKDAPHFEIGTFKEL 819

>Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa] {ON}
            YGR281W (YOR1) - ABC transporter [contig 363] FULL
          Length = 1471

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 123/557 (22%), Positives = 220/557 (39%), Gaps = 74/557 (13%)

Query: 159  FMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFDR 218
            F G S   ++G +   + F   A   +  +L  +       L    +K+ +H    F D 
Sbjct: 920  FRGRSTSFYMGLYTFFVFFNYFATTSQFSVLCYMGLSAAKWLNLKAVKRLLHTPMSFLDT 979

Query: 219  HKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICXXXXXXXXXSISPQLSGLLLLFTPPV 278
              +G +++R   D   +   +T+ V      L            I      + +++ P  
Sbjct: 980  TPIGRVLNRFTKDTDTLDTELTESVR-----LFLFQASNIVGVVI------MCIIYLPWF 1028

Query: 279  LFSASIFGRKIRDTSTDLQEATGQLTRVS-----------EEQLSGVRTVQSFVAEQKEI 327
              +           +   Q ++ ++ R+             E LSG+ T++++  E + +
Sbjct: 1029 AIAVPFLLLIFAAVADHYQSSSREIKRLEAVQRSHVFNNFNEVLSGMDTIRAYRGEARFL 1088

Query: 328  HRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAF 387
             +    I  +   G     I      A   +  ++F +++   + L +    +I   +  
Sbjct: 1089 TKSDFLINKMNEAGYVVVAIQRWVSIALDMIA-MAFALII---TLLCVTRQFSISAASVG 1144

Query: 388  MLYTEYTGSSVFGLTSFYSELMQG---VGAATRL--------FELTDRVPSIKPTTGKKF 436
            +L T Y       L +    + QG   + +A RL         E   R P   P      
Sbjct: 1145 VLLT-YVLQLPGLLNTLMRAMTQGENDMNSAERLISYATDLPLEAAYRRPETSPPES--- 1200

Query: 437  VPGKGEIVFKDVTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFY 495
             P +G I F  V+ +Y  RPG  ++  D+ + +  G  + + G +G GKSTI   L R  
Sbjct: 1201 WPSEGAIDFDHVSLAY--RPGLPLVLHDVSLHVRGGEKIGICGRTGAGKSTIMSALYRMI 1258

Query: 496  NPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMV 555
                G I IDG DI++L +  LR  + ++ Q+PVL  G +R N+      + ++    +V
Sbjct: 1259 ELHDGSITIDGIDIAQLGLYELRSKLAIIPQDPVLFKGDVRKNLDPFHERSDNELWDALV 1318

Query: 556  AKQCFC---------------------HNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIA 594
                                       H F +      +  +   G+  S G++Q +A+ 
Sbjct: 1319 RAGAIATEDEAAARAVTRATAGALTNLHKFHL------EQEVEEDGSNFSLGERQLLALT 1372

Query: 595  RALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIV 654
            RAL++   IL+LDEATS++D E++  I             T++ IAHRL+TI   + I+V
Sbjct: 1373 RALVRSSRILILDEATSSVDYETDAKIQARIADAF--SECTVLCIAHRLNTILDYDRILV 1430

Query: 655  LGNDGSVVETGKFKELF 671
            L + G V E      LF
Sbjct: 1431 L-DQGRVCEFDTPHALF 1446

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 77/244 (31%), Positives = 114/244 (46%), Gaps = 26/244 (10%)

Query: 431 TTGKKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALL 490
           TT ++ V  +   V  D + S   +     F++++I+I  G  V V G  G GKS++   
Sbjct: 564 TTREESVDSQKNDVSSDTSSSNEPKVNFKGFKNLNIEIAKGELVIVTGSVGTGKSSLLAA 623

Query: 491 LLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYG--LTETPS 548
           +  F    SG I+ +G         SL     L+   P + + T++DNI +G    E   
Sbjct: 624 MSGFMKKKSGDIYKNG---------SL-----LLCGYPWIQNTTVKDNILFGSPFDEARY 669

Query: 549 KEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDE 608
           KE IR+    C     +   P G  T IG +G  LSGGQK RI +AR++ KK  I + D+
Sbjct: 670 KETIRV----CSLQADLDLLPAGDKTEIGERGITLSGGQKARINLARSVYKKKDIYLFDD 725

Query: 609 ATSALDVESEGAI--NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGK 666
             SA+D      I      G L      T V   H+LS I R+  +I +  DG+ V++G 
Sbjct: 726 VLSAVDARVGKHIMDECMMGAL---DGKTRVLATHQLSLIARASKVIFIDLDGT-VDSGT 781

Query: 667 FKEL 670
             EL
Sbjct: 782 LDEL 785

>YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}
           NFT1Putative transporter of the multidrug
           resistance-associated protein (MRP) subfamily; adjacent
           ORFs YKR103W and YKR104W are merged in different strain
           backgrounds.
          Length = 1218

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 69/227 (30%), Positives = 116/227 (51%), Gaps = 9/227 (3%)

Query: 445 FKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFI 504
           F+D +  +     +   +++ I     S   ++GP+G GKS++ L LL   N  SG+I++
Sbjct: 653 FEDASMEWEAAETSFKLKNISIDFKLNSLNAIIGPTGSGKSSLLLGLLGELNLLSGKIYV 712

Query: 505 ---DGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFC 561
              + +D  ++    +   +    Q P L+SGT++DN+ +G  E  +K++   V K C  
Sbjct: 713 PTVESRDDLEIGKDGMTNSMAYCSQTPWLISGTIKDNVVFG--EIFNKQKFDDVMKSCCL 770

Query: 562 HNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAI 621
              I     G  T +G  G  LSGGQ+QRIA+ARA+      L+LD+  SA+D E+   I
Sbjct: 771 DKDIKAMTAGIRTDVGDGGFSLSGGQQQRIALARAIYSSSRYLILDDCLSAVDPETALYI 830

Query: 622 --NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGK 666
                 G +MK ++  I S  H +S + +  + +V+ + G V   GK
Sbjct: 831 YEECLCGPMMKGRTCIITS--HNISLVTKRADWLVILDRGEVKSQGK 875

>Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {ON}
            similar to Ashbya gossypii AGL346W
          Length = 1536

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 64/248 (25%), Positives = 120/248 (48%), Gaps = 30/248 (12%)

Query: 308  EEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVL 367
             E +SGV T++++ AE + + + S  + D  N      Y + ++ +    +  + F +++
Sbjct: 1062 NEVISGVDTIKAYHAEARFLKK-SDILIDRMNEMTFPLYASQRWVSILIGMIAVLFALII 1120

Query: 368  AYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGV-------GAATRLFE 420
               S L + G   I   +  +L T      V  L + ++ L++ +        +A R+  
Sbjct: 1121 ---SILCVTGWFNISPASTGVLLT-----YVLQLPNLFNTLLRAMTQLENDMNSAERVLS 1172

Query: 421  LTD--------RVPSIKPTTGKKFVPGKGEIVFKDVTFSYPTRPG-NVIFRDMDIKIPAG 471
              +        R+P + P    K  P +G I F +V  +Y  RPG  ++ +D+   I +G
Sbjct: 1173 YANSLPKEAPYRIPEMAP---PKAWPERGAITFDNVALAY--RPGLPLVLQDVSFHISSG 1227

Query: 472  SNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLM 531
              + + G +G GKSTI   L R    S+G + IDG DI+ + + +LR  + ++ Q+P+L 
Sbjct: 1228 EKIGICGRTGAGKSTITNALYRLVELSNGSVTIDGVDIATIGLYNLRSKLSIIPQDPLLF 1287

Query: 532  SGTLRDNI 539
             GT+R N+
Sbjct: 1288 RGTIRKNL 1295

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 100/213 (46%), Gaps = 24/213 (11%)

Query: 461 FRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRH 520
           F D+  ++  G  + + G  G GK+++   L  F + ++G I  +G+             
Sbjct: 590 FSDLSFEVKKGELLVITGAIGTGKTSLLNALAGFMHKTNGDIQYNGR------------- 636

Query: 521 IGLVQQEPVLMSGTLRDNITYGLTETPSKEEI-RMVAKQCFCHNFIVKFPHGYDTVIGPQ 579
             L    P + + T+RDNIT+G   +P  E + R V + C     +   P G  T +G +
Sbjct: 637 -MLFCGAPWIQNATIRDNITFG---SPYDENLYREVMRVCSLDRDMSVLPAGDKTEVGER 692

Query: 580 GALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAI--NYTFGQLMKSKSVTIV 637
           G  LSGGQK RI +AR + K   I + D+  SA+D     +I  +   G+L      T +
Sbjct: 693 GITLSGGQKARINLARCVYKVRDIYLFDDILSAVDARVGASIMNDCLLGKLGDK---TRI 749

Query: 638 SIAHRLSTIRRSENIIVLGNDGSVVETGKFKEL 670
              H++S   ++  +I LG DGS  + G   EL
Sbjct: 750 LATHQISLTEQASRVIYLGTDGS-FDIGTVDEL 781

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 56/91 (61%), Gaps = 3/91 (3%)

Query: 573  DTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSK 632
            D  +   G+  S G++Q +A+ARAL+++  IL+LDEATS++D E++  I     Q  + +
Sbjct: 1418 DQTVEEDGSNFSVGERQFLALARALVRQTKILILDEATSSVDYETDAQIQARIVQ--EFQ 1475

Query: 633  SVTIVSIAHRLSTIRRSENIIVLGNDGSVVE 663
              TI+ +AHRL TI   + I+V+   G V E
Sbjct: 1476 HATIMCVAHRLKTILHYDRILVM-EKGRVAE 1505

>YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subunit
           of a heterodimeric peroxisomal ATP-binding cassette
           transporter complex (Pxa1p-Pxa2p), required for import
           of long-chain fatty acids into peroxisomes; similarity
           to human adrenoleukodystrophy transporter ABCD1 and
           ABCD2 and ALD-related proteins; mutations in ABCD1 cause
           X-linked adrenoleukodystrophy (X-ALD), a peroxisomal
           disorder
          Length = 870

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 75/261 (28%), Positives = 128/261 (49%), Gaps = 54/261 (20%)

Query: 425 VPSIKPTTGKKFVPGKGEIVFKDVTFSYP------TRPGNVIFRDM----DIKIP----A 470
           +PS++ + G K +          +TF  P      T   N I +D+    DIK+P    +
Sbjct: 587 IPSVRASEGIKLI--------NKLTFQIPLHIDPITSKSNSI-QDLSKANDIKLPFLQGS 637

Query: 471 GSNVCVVGPSGRGKSTIALLLLRF---YNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQE 527
           GS++ ++GP+G GKS+I  ++      YN  +G + I  ++           +I  + Q+
Sbjct: 638 GSSLLILGPNGCGKSSIQRIIAEIWPVYN-KNGLLSIPSEN-----------NIFFIPQK 685

Query: 528 PVL-MSGTLRDNITYGLTETP-------SKEEIRMVAKQCFCHNFIVKFPHG--YDTVIG 577
           P     GTLRD I Y ++           KE ++++ +     ++++K   G  Y   I 
Sbjct: 686 PYFSRGGTLRDQIIYPMSSDEFFDRGFRDKELVQILVEVKL--DYLLKRGVGLTYLDAIA 743

Query: 578 PQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIV 637
               LLSGG+KQR+  AR +  KP  +VLDEAT+A+ V+ E   +Y F  L+K      +
Sbjct: 744 DWKDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRYRFNFI 799

Query: 638 SIAHRLSTIRRSENIIVLGND 658
           SI+ R + I+  E ++ +G +
Sbjct: 800 SISQRPTLIKYHEMLLEIGEN 820

>Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON}
           YPL147W (REAL)
          Length = 870

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 74/261 (28%), Positives = 128/261 (49%), Gaps = 54/261 (20%)

Query: 425 VPSIKPTTGKKFVPGKGEIVFKDVTFSYP------TRPGNVIFRDM----DIKIP----A 470
           +PS++ + G K +          +TF  P      T   N I +D+    DIK+P    +
Sbjct: 587 IPSVRASEGIKLITK--------LTFQIPLHIDPITSKSNSI-QDLSEANDIKLPFLQGS 637

Query: 471 GSNVCVVGPSGRGKSTIALLLLRF---YNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQE 527
           GS++ ++GP+G GKS+I  ++      YN  +G + I  ++           +I  + Q+
Sbjct: 638 GSSLLILGPNGCGKSSIQRIIAEIWPVYN-KNGLLSIPPEN-----------NIFFIPQK 685

Query: 528 PVL-MSGTLRDNITYGLTETP-------SKEEIRMVAKQCFCHNFIVKFPHG--YDTVIG 577
           P     GTLRD I Y ++           KE ++++ +     ++++K   G  Y   + 
Sbjct: 686 PYFSRGGTLRDQIIYPMSSDEFFDRGFKDKELVQILVEVKL--DYLLKRAVGLTYLDAVA 743

Query: 578 PQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIV 637
               LLSGG+KQR+  AR +  KP  +VLDEAT+A+ V+ E   +Y F  L+K      +
Sbjct: 744 DWKDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRYRFNFI 799

Query: 638 SIAHRLSTIRRSENIIVLGND 658
           SI+ R + I+  E ++ +G +
Sbjct: 800 SISQRPTLIKYHEMLLEIGEN 820

>Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147W
           (REAL)
          Length = 870

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 64/211 (30%), Positives = 110/211 (52%), Gaps = 35/211 (16%)

Query: 465 DIKIP----AGSNVCVVGPSGRGKSTIALLL---LRFYNPSSGQIFIDGQDISKLNIKSL 517
           DIK+P    +GS++ ++GP+G GKS+I  ++      YN  +G + I  ++         
Sbjct: 628 DIKLPFLQGSGSSLLILGPNGCGKSSIQRIIADVWPVYN-KNGLLSIPSEN--------- 677

Query: 518 RRHIGLVQQEPVL-MSGTLRDNITYGLTET-------PSKEEIRMVAKQCFCHNFIVKFP 569
             +I  + Q+P     GTLRD I Y ++           KE ++++A+     ++++K  
Sbjct: 678 --NIFCIPQKPYFSRGGTLRDQIIYPMSSDEFFDRGFKDKELVQILAEVRL--DYLLKRG 733

Query: 570 HG--YDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQ 627
            G  Y   +     LLSGG+KQR+  AR +  KP  +VLDEAT+A+ V+ E   +Y F  
Sbjct: 734 VGLTYLDAVADWKDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN- 789

Query: 628 LMKSKSVTIVSIAHRLSTIRRSENIIVLGND 658
           L+K      +SI+ R + I+  E ++ +G +
Sbjct: 790 LLKRYRFNFISISQRPTLIKYHEMLLEIGEN 820

>Skud_16.135 Chr16 (244860..247472) [2613 bp, 870 aa] {ON} YPL147W
           (REAL)
          Length = 870

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 73/261 (27%), Positives = 127/261 (48%), Gaps = 54/261 (20%)

Query: 425 VPSIKPTTGKKFVPGKGEIVFKDVTFSYP------TRPGNVIFRDM----DIKIP----A 470
           +PS++ + G K +          +TF  P      T   N I +D+    DIK+P    +
Sbjct: 587 IPSVRASEGIKLI--------NKLTFQIPLHIDPITSNSNSI-QDLSKANDIKLPFLQGS 637

Query: 471 GSNVCVVGPSGRGKSTIALLLLRF---YNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQE 527
           GS++ ++GP+  GKS+I  ++      YN  +G + I  ++           +I  + Q+
Sbjct: 638 GSSLLILGPNSCGKSSIQRIIAEIWPVYN-KNGLLSIPSEN-----------NIFCIPQK 685

Query: 528 PVLMSG-TLRDNITYGLTETP-------SKEEIRMVAKQCFCHNFIVKFPHG--YDTVIG 577
           P    G TLRD I Y ++           KE ++++ +     ++++K   G  Y   + 
Sbjct: 686 PYFSKGGTLRDQIIYPMSSDEFFDRGFKDKELVQILVEVRL--DYLLKRGVGLTYLDAVA 743

Query: 578 PQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIV 637
               LLSGG+KQR+  AR +  KP  +VLDEAT+A+ V+ E   +Y F  L+K      +
Sbjct: 744 DWKDLLSGGEKQRVNFARVMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRYRFNFI 799

Query: 638 SIAHRLSTIRRSENIIVLGND 658
           SI+ R + I+  E ++ +G +
Sbjct: 800 SISQRPTLIKYHEMLLEIGEN 820

>Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON}
           complement(1..4131) [4131 nt, 1377 aa]
          Length = 1377

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 69/280 (24%), Positives = 129/280 (46%), Gaps = 21/280 (7%)

Query: 393 YTGSSVFGL--------TSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGKGEIV 444
           +T  S+FGL        +S  + ++Q V +  R+    D  P +               +
Sbjct: 634 FTALSLFGLLKMPLDQLSSTINYIVQSVISLRRIQSFLDE-PDMDKQKNLLLSKDGTYFM 692

Query: 445 FKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFI 504
           F   T  +       I  ++++K  +     V GP+G GKS + + LL   +   G+I +
Sbjct: 693 FSGATIGWSINNKGFILENLNVKFKSKKLNVVAGPTGAGKSLLLMSLLGETHLFKGEIHV 752

Query: 505 DG-QDISKLNIKS--LRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFC 561
                  +L I    L   I    Q P +++ ++++NI +G     + +    V + C  
Sbjct: 753 PSLASKHELMIHGDGLTNSISYCSQIPWIINDSIKNNILFG--SEFNLKRYNDVIRACCL 810

Query: 562 HNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAI 621
            N +     G ++++G +G  LSGGQ+QR+++ARA+  K   ++LD+  SA+D +    I
Sbjct: 811 TNDLRLLQDGDNSIVGDRGQNLSGGQRQRVSLARAIYSKSMHIILDDCLSAVDSKCAKDI 870

Query: 622 NYTF---GQLMKSKSVTIVSIAHRLS-TIRRSENIIVLGN 657
            Y     G LMK ++  +VS  H +   I+++  +++L N
Sbjct: 871 -YDLCLTGPLMKGRTCILVS--HNVELVIKKAAYLLILDN 907

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 83/189 (43%), Gaps = 26/189 (13%)

Query: 309  EQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISF----- 363
            E L+G+ ++++F  E +        I+ IF    R    N  FF    +   +SF     
Sbjct: 1202 ESLAGLVSIRAFGDELR-------FIKVIFT---RVDEYNKSFFYLWEANNWLSFRIELI 1251

Query: 364  --LVVLAYGSYLVLQGGLTIGDLT--AFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLF 419
              + +LA G +L+    +    L    F     +T S+++ +  FY+ +   + +  RL+
Sbjct: 1252 GSITILATGLFLLSNANMVDSGLAGITFTYAIAFTESALW-MIKFYATMEMNMNSVERLY 1310

Query: 420  ELTD--RVPSIKPTTG-KKFVPGKGEIVFKDVTFSY-PTRPGNVIFRDMDIKIPAGSNVC 475
            E T+  + P  +  T      P  G+I FK+VT  Y P  P   + +D+   I     + 
Sbjct: 1311 EYTNLEQEPYSRCITNVDNQWPNSGDIKFKNVTLRYSPELPK--VLQDVTFVIGDKEKIG 1368

Query: 476  VVGPSGRGK 484
            VVG +G GK
Sbjct: 1369 VVGRTGAGK 1377

>KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {ON}
           Anc_8.661 YPL147W
          Length = 876

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 72/259 (27%), Positives = 126/259 (48%), Gaps = 45/259 (17%)

Query: 425 VPSIKPTTGKKFVPGKGEIVFKDVTFSYP-------TRPGNVI-FRDM--DIKIP----A 470
           +PS +   G K +        K +TF  P       +R  +V  F ++  DI IP    A
Sbjct: 592 IPSTRAKNGTKLI--------KKLTFQVPPSIDPLSSRADSVQDFNEITNDISIPFLNSA 643

Query: 471 GSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVL 530
           GS++ ++GP+G GKS+I  ++   + P   +        + L  K    ++  V Q+P  
Sbjct: 644 GSSLLILGPNGCGKSSIQRIIAEIW-PIYNK--------NGLLSKPTEANLLCVPQKPYF 694

Query: 531 MSG-TLRDNITYGLTETPS-----KEEIRMVAKQCFCHNFIVKFPHGY---DTVIGPQGA 581
             G TLRD I Y ++         K+++ +   +    ++++K   G+   DTV      
Sbjct: 695 TRGGTLRDQIIYPMSSDEFFDRGLKDKLLVQVLREVKLDYLLKRDKGWSYLDTV-SDWKD 753

Query: 582 LLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAH 641
           +LSGG+KQR+  AR +  KP  +VLDEAT+A+  + E   +Y F  ++K      ++I+ 
Sbjct: 754 VLSGGEKQRMNFARIMFHKPRFVVLDEATNAISADME---DYLFN-VLKRYRFNFITISQ 809

Query: 642 RLSTIRRSENIIVLGNDGS 660
           R S I+  + ++ + +D S
Sbjct: 810 RPSLIKYHDLLLEISDDNS 828

>SAKL0H21010g Chr8 (1835185..1839528) [4344 bp, 1447 aa] {ON} similar
            to uniprot|P32568 Saccharomyces cerevisiae YDR011W SNQ2
            ABC transporter
          Length = 1447

 Score = 68.2 bits (165), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 114/238 (47%), Gaps = 19/238 (7%)

Query: 440  KGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLL---LRFYN 496
            KG  ++KDV +  P +       D            ++G SG GK+T+  +L   + F  
Sbjct: 799  KGVFMWKDVDYVIPYKGSEKKLLDKVSGFVKPGLTALMGASGAGKTTLLNVLAQRMDFGI 858

Query: 497  PSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSG-TLRDNITYGL-----TETPSKE 550
             SSG+I +D + + +      +R +G VQQ+ +     T+R+++ +          P  E
Sbjct: 859  VSSGEILVDAKPVDR----KFKRSVGYVQQQDIHTQELTVRESLQFSARLRRPDSVPDAE 914

Query: 551  EIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILV-LDEA 609
            ++  V K       ++      D V+G  G  L+  Q+++++I   L+ KPT+L+ LDE 
Sbjct: 915  KMEYVEKIIV----VLGMQDYSDAVVGEAGFGLNVEQRKKLSIGVELVAKPTLLLFLDEP 970

Query: 610  TSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRS-ENIIVLGNDGSVVETGK 666
            TS LD +S  AI     +L ++    + +I    +T+  S + +++L + GSVV  G 
Sbjct: 971  TSGLDSQSSWAILQLLRRLAEAGQAILCTIHQPSATLFESFDRLLLLKDGGSVVYWGN 1028

>ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL147W
           (PXA1)
          Length = 827

 Score = 67.4 bits (163), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 54/191 (28%), Positives = 97/191 (50%), Gaps = 21/191 (10%)

Query: 471 GSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVL 530
           GS++ ++GP+  GKS+I  +L         +I+        ++I +    + + Q+   +
Sbjct: 598 GSSLLILGPNSCGKSSIQRIL--------AEIWPIYNKTGLVSIPAESDLMCIAQRPYFI 649

Query: 531 MSGTLRDNITYGLT-----ETPSKE-EIRMVAKQCFCHNFIVKFPHG--YDTVIGPQGAL 582
             GT RD I Y ++     E   K+ E+  + K+    ++++K   G  Y   +     +
Sbjct: 650 QGGTFRDQIIYPMSVDRFYEKGHKDRELVRILKEVKL-DYLLKRSEGLSYLDFVADWKDI 708

Query: 583 LSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHR 642
           LSGG+KQR+  AR +  +P  LVLDEAT+A+ V+ E   +Y F  L K +    +SI+ R
Sbjct: 709 LSGGEKQRMNFARIMFHRPKFLVLDEATNAISVDME---DYLFNMLRKCR-FNFISISQR 764

Query: 643 LSTIRRSENII 653
            S I+  + ++
Sbjct: 765 PSLIKYHDYLL 775

>NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {ON}
           Anc_1.366
          Length = 755

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 93/203 (45%), Gaps = 32/203 (15%)

Query: 443 IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI 502
           I  +DV+F Y   P +++ +D+++ +   S + +VG +G GK+T+  +++    P+ G +
Sbjct: 535 IQLQDVSFGYD--PESLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEELRPTKGFV 592

Query: 503 FIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSK--EEIRMVAKQCF 560
             +G           R  IG   Q  V      +  + +  T  P K  EE R       
Sbjct: 593 SRNG-----------RLRIGYFTQHHVDSLDLTKSAVDWMSTAYPGKNDEEYR------- 634

Query: 561 CHNFIVKFPHGYDTVIGPQG-ALLSGGQKQRIAIARALIKKPTILVLDE-----ATSALD 614
               +  F  G    +G Q   LLSGGQK R+A A   +  P ILVLDE      TS LD
Sbjct: 635 --RHLGSF--GITGSLGLQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTSGLD 690

Query: 615 VESEGAINYTFGQLMKSKSVTIV 637
              +   N++ G LM S  ++I+
Sbjct: 691 ALEDSLKNFSGGVLMVSHDISII 713

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 583 LSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAH 641
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+++++H
Sbjct: 371 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLTVSH 425

>NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661
          Length = 897

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 101/204 (49%), Gaps = 29/204 (14%)

Query: 470 AGSNVCVVGPSGRGKSTIALLLLRF---YNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQ 526
           +GS++ ++GP+  GK++I  ++      YN  +G + +  Q+           +I  + Q
Sbjct: 664 SGSSLLILGPNSSGKTSIQRIIAEIWPIYN-KNGLLSVPSQE-----------NIFCIPQ 711

Query: 527 EPVLMS-GTLRDNITYGLTETPS-----KEEIRMVAKQCFCHNFIVKFPHG--YDTVIGP 578
            P   S GTLRD I Y ++         K+ + +   +     +++K   G  Y   +  
Sbjct: 712 RPYFTSSGTLRDQIIYPMSSDEFFDRGLKDSLLIQILKEVNLKYLMKRSKGLTYLDTVAD 771

Query: 579 QGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVS 638
              LLSGG+KQRI  AR L  KP  +VLDEAT+A+  + E   +Y F  ++K      ++
Sbjct: 772 WKDLLSGGEKQRINFARILFHKPRFIVLDEATNAISQDME---DYLFN-ILKKYRFNFIT 827

Query: 639 IAHRLSTIRRSENIIVLG--NDGS 660
           I+ R S I+  + ++ +   NDG+
Sbjct: 828 ISQRPSLIKYHDLLLEISDHNDGT 851

>TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {ON}
           Anc_1.366 YFR009W
          Length = 751

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 63/227 (27%), Positives = 102/227 (44%), Gaps = 34/227 (14%)

Query: 443 IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI 502
           I  +DV+F Y  +  N++ +D+++ +   S + +VG +G GK+T+  +++    P  G +
Sbjct: 531 IQLQDVSFGYDEK--NLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMNQLKPLKGYV 588

Query: 503 FIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSK--EEIRMVAKQCF 560
             +G           R  IG   Q  V      +  + +   + P K  EE R       
Sbjct: 589 SSNG-----------RLRIGYFTQHHVDSMDLTKSAVDWMSVKYPGKTDEEYR------- 630

Query: 561 CHNFIVKFPHGYDTVIGPQG-ALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEG 619
               +  F  G    +G Q   LLSGGQK R+A A   +  P ILVLDE ++ LD     
Sbjct: 631 --RHLGSF--GITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDNTGLD 686

Query: 620 AI-----NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSV 661
           A+     N++ G LM S  ++++        I  SEN  V   DG++
Sbjct: 687 ALVESLKNFSGGVLMVSHDISVIDSV--CKEIWVSENGTVRRFDGTI 731

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 583 LSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAH 641
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T++ ++H
Sbjct: 367 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPSTLLVVSH 421

>Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {ON}
           YPL147W (PXA1) - ABC family long-chain fatty acid
           transporter [contig 67] FULL
          Length = 831

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 104/211 (49%), Gaps = 25/211 (11%)

Query: 471 GSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVL 530
           GS++ ++GP+G GK++I  ++         +I+        L++ + R  I + Q+   +
Sbjct: 601 GSSMLILGPNGSGKTSIQRII--------AEIWPIYNKNGLLSVPAERELICIPQKPYFI 652

Query: 531 MSGTLRDNITYGLTETP------SKEEIRMVAKQCFCHNFIVKFPHG--YDTVIGPQGAL 582
             GT R+ I Y ++           +E+  V K+     +++K   G  Y   +     +
Sbjct: 653 QGGTFREQIIYPMSADQYFDLGYRDKELVHVLKEVKLE-YLLKRDKGWRYLDAVAEWKDV 711

Query: 583 LSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHR 642
           LSGG++QR+  AR +  KP  +VLDEAT+A+  + E   +Y F  ++K      ++I+ R
Sbjct: 712 LSGGERQRMNFARIMFHKPKFVVLDEATNAISADME---DYLFN-MLKRYRFNFITISQR 767

Query: 643 LSTIRRSENIIVLGNDGSVVETGKFKELFAD 673
            S I+  +  + +G D    E+ + ++L  D
Sbjct: 768 PSLIKYHDLALEIGAD----ESWRLQDLGTD 794

>ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly
           similar to uniprot|P43535 Saccharomyces cerevisiae
           YFR009W GCN20 Positive regulator of the Gcn2p kinase
           activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 70/265 (26%), Positives = 115/265 (43%), Gaps = 51/265 (19%)

Query: 414 AATRLFELTDRVPSIKPTTGKKFVPGKGE---------IVFKDVTFSYPTRPGNVIFRDM 464
           A +R+ +L +++P ++P  G+K V  K           I  +DVTF Y     N++ +D+
Sbjct: 495 AQSRIKKL-EKLPVLEPPEGEKSVSFKFPECSKLSPPIIQLQDVTFGY--NENNLLLKDV 551

Query: 465 DIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLV 524
           ++ +   S + +VG +G GK+T+  +++    P  G +            ++ R  +G  
Sbjct: 552 NLDVQLNSRIALVGANGCGKTTLLKIMMETLTPLKGYVS-----------RNPRLRLGYF 600

Query: 525 QQEPVLMSGTLRDNITYGLTETP--SKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQG-A 581
            Q  V         + +     P  S EE R           +  F  G    +G Q   
Sbjct: 601 AQHHVDAMDLNASAVEWMSKTFPGRSDEEYR---------RHLGSF--GITGSLGLQRME 649

Query: 582 LLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAI-----NYTFGQLMKSKSVTI 636
           LLSGGQK R+A A   +  P +L+LDE ++ LD     A+     N+T G LM       
Sbjct: 650 LLSGGQKSRVAFAALCLNNPHVLILDEPSNHLDTSGIDALVDALKNFTGGVLM------- 702

Query: 637 VSIAHRLSTIRRSENIIVLGNDGSV 661
             ++H +S I    N I +  DGS 
Sbjct: 703 --VSHDISVINSVCNEIWVSEDGSA 725

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 583 LSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAH 641
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +KS   TI+ ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKSYPSTILVVSH 422

>ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} similar
           to uniprot|P25371 Saccharomyces cerevisiae YCR011C ADP1
           Shows homology to ATP-dependent permeases Active
           transport ATPase
          Length = 1062

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 67/241 (27%), Positives = 114/241 (47%), Gaps = 29/241 (12%)

Query: 443 IVFKDVTFSYPTRPGN--VIFRDMDIKIPAGSNVCVVGPSGRGKSTIA--LLLLRFYNPS 498
           + FKD+ +  P    N   +  ++   +  G  + ++G SG GK+T+   L + +     
Sbjct: 396 LTFKDIVYQVPINRDNSETVLNEVSGVVQPGEMMALLGGSGAGKTTLLDILAMKKKAGKV 455

Query: 499 SGQIFIDGQDISKLNIKSLRRHIGLVQQ-----------EPVLMSGTLRDNITYGLTETP 547
           SGQI ++G+ ISK   K   + IG V Q           E VL S  LR  +   L    
Sbjct: 456 SGQIKVNGKSISK---KDYTKLIGFVDQDDYLLQTLTVFETVLNSALLR--LPRALPFEA 510

Query: 548 SKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGAL-LSGGQKQRIAIARALIKKPTILVL 606
            +  +  V ++       ++     D +IG +    +SGG+K+R++IA  L+  P IL L
Sbjct: 511 KRSRVYKVLEE-------LRILDIKDKIIGNEFERGISGGEKRRVSIACELVTSPLILFL 563

Query: 607 DEATSALDVESEGAINYTFGQLMKSKSVTIV-SIAHRLSTIRRSENIIVLGNDGSVVETG 665
           DE TS LD  +   +     +L ++   T+V SI    S I +  + +VL ++G +V +G
Sbjct: 564 DEPTSGLDANNASNVVDCLVRLARNYGRTLVLSIHQPRSNIFQMFDKLVLLSNGEMVYSG 623

Query: 666 K 666
           +
Sbjct: 624 E 624

>KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 63.9 bits (154), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 102/231 (44%), Gaps = 41/231 (17%)

Query: 443 IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI 502
           I  +DV+F Y  +  +++ +D+++ +   S + +VG +G GK+T+  +++    P+SG +
Sbjct: 532 IQLQDVSFGYEEQ--SLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPTSGYV 589

Query: 503 FIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSK--EEIRMVAKQCF 560
             +G           R  IG   Q  V         + +     P K  EE R       
Sbjct: 590 SRNG-----------RLRIGYFTQHHVDSMDLNTSAVDWMSKTYPGKTDEEYR------- 631

Query: 561 CHNFIVKFPHGYDTVIG-PQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEG 619
               +  F  G    +G  Q  LLSGGQK R+A A   +  P ILVLDE ++ LD     
Sbjct: 632 --RHLGAF--GITGTLGLQQMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTTGLE 687

Query: 620 AI-----NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETG 665
           A+      +T G LM         ++H +S I    N I +  DG+V + G
Sbjct: 688 ALVDALKKFTGGVLM---------VSHDISVIDSVCNEIWVSEDGNVKKFG 729

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 583 LSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAH 641
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPSTVLTVSH 422

>KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 63.9 bits (154), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 109/243 (44%), Gaps = 46/243 (18%)

Query: 443 IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI 502
           I  +DV+F Y  +  N++ +D+++ +   S + +VG +G GK+T+  +++    P  G +
Sbjct: 532 IQLQDVSFGYDEK--NLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPLQGYV 589

Query: 503 FIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSK--EEIRMVAKQCF 560
             +G           R  IG   Q  V         + +     P K  EE R       
Sbjct: 590 SRNG-----------RLRIGYFTQHHVDSMDLTTSAVDWMSKTFPGKNDEEYR------- 631

Query: 561 CHNFIVKFPHGYDTVIGPQG-ALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEG 619
               +  F  G    +G Q   LLSGGQK R+A A   +  P IL+LDE ++ LD     
Sbjct: 632 --RHLGAF--GITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNHLDTTGLD 687

Query: 620 AI-----NYTFGQLMKSKSVTIV-SIAHRL-----STIRR--------SENIIVLGNDGS 660
           A+     N++ G LM S  ++++ S+ + +      T+++         ++II L ND  
Sbjct: 688 ALIDALKNFSGGVLMVSHDISVINSVCNEIWVSEEGTVKKFGGSIYDYRDHIISLANDAG 747

Query: 661 VVE 663
           VV+
Sbjct: 748 VVK 750

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 583 LSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAH 641
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T++ ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATLLVVSH 422

>KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.661
           YPL147W
          Length = 871

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 98/197 (49%), Gaps = 20/197 (10%)

Query: 471 GSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVL 530
            S++ ++GP+G GKS+I  ++   +   +    +   D S L        + + Q+    
Sbjct: 640 ASSLLILGPNGCGKSSIQRIIAEIWPIYNKNGLLSKPDSSSL--------LCIPQKPYFT 691

Query: 531 MSGTLRDNITYGLT-----ETPSKEEIRMVAKQCFCHNFIVKFPHGYDTV--IGPQGALL 583
             GT RD I Y ++     +   K+++ +        ++++K   G+  +  +     +L
Sbjct: 692 RGGTFRDQIIYPMSSDEFFDNGFKDKVLVWILSEVHLDYLLKRAPGWSYLDEVTEWKDVL 751

Query: 584 SGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRL 643
           SGG+KQR+  AR L  KP  +VLDEAT+A+  + E   +Y F  L K +  + ++I+ R 
Sbjct: 752 SGGEKQRMNFARILFHKPKFIVLDEATNAISADME---DYLFNMLKKFR-FSFITISQRP 807

Query: 644 STIRRSENIIVLGN-DG 659
           S I+  + ++ + + DG
Sbjct: 808 SLIKYHDMLLEIADRDG 824

>CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} highly
           similar to uniprot|P43535 Saccharomyces cerevisiae
           YFR009w GCN20 positive effector of GCN2P
          Length = 752

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 92/204 (45%), Gaps = 32/204 (15%)

Query: 443 IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI 502
           I  +DV+F Y   P  ++ +D+++ I   S + +VG +G GK+T+  ++L    P SG +
Sbjct: 532 IQLQDVSFGYS--PDKLLLKDVNLDIQMDSRIALVGANGCGKTTLLKVMLEQLRPLSGYV 589

Query: 503 FIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSK--EEIRMVAKQCF 560
                       ++ R  IG   Q  V         + +     P K  EE R       
Sbjct: 590 -----------SRNPRLRIGYFTQHHVDSMDLSTSAVDWMSKTFPGKTDEEYR------- 631

Query: 561 CHNFIVKFPHGYDTVIGPQG-ALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEG 619
               +  F  G    +G Q   LLSGGQK R+A A   +  P IL+LDE ++ LD     
Sbjct: 632 --RHLGSF--GITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNHLDTTGID 687

Query: 620 AI-----NYTFGQLMKSKSVTIVS 638
           A+     N+T G LM S  +++++
Sbjct: 688 ALVDAMKNFTGGILMVSHDISVIN 711

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 583 LSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAH 641
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +KS   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKSYPSTVLTVSH 422

>SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {ON}
           highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 107/230 (46%), Gaps = 36/230 (15%)

Query: 443 IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI 502
           I  +DV+F Y     + + +D+++ +   S + +VG +G GK+T+  +++    P+ G +
Sbjct: 532 IQLQDVSFGY--EENSPLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPTKGYV 589

Query: 503 FIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTET-PSK--EEIRMVAKQC 559
                       ++ R  IG   Q  V  S  L  +    +++T P K  EE R      
Sbjct: 590 S-----------RNPRLRIGYFTQHHV-DSMDLNTSAVDWMSKTFPGKTDEEYR------ 631

Query: 560 FCHNFIVKFPHGYDTVIGPQG-ALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESE 618
                +  F  G    +G Q   LLSGGQK R+A A   +  P ILVLDE ++ LD    
Sbjct: 632 ---RHLGAF--GITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTAGL 686

Query: 619 GAI-----NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVE 663
            A+     N+T G LM S  +++  I H  S I  SE+  V   DG++ +
Sbjct: 687 DALIDALKNFTGGVLMVSHDISV--IDHVCSEIWVSEDGTVKRFDGTIYD 734

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 583 LSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAH 641
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T++ ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVLVVSH 422

>KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {ON}
           similar to uniprot|P41909 Saccharomyces cerevisiae
           YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
           peroxisomal ATP-binding cassette transporter necessary
           for transport of long-chain fatty acids into peroxisomes
           ABC family long-chain fatty acid transporter
          Length = 830

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 96/200 (48%), Gaps = 25/200 (12%)

Query: 471 GSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVL 530
           GS++ ++GP+G GK++I  ++   +   +    +     S L           V Q+P  
Sbjct: 600 GSSMLILGPNGSGKTSIQRIIAEIWPIYNKNGLLSIPPASDL---------FCVPQKPYF 650

Query: 531 MSG-TLRDNITYGLTETP-------SKEEIRMVAKQCFCHNFIVKFPHG--YDTVIGPQG 580
           + G T R+ I Y ++           KE   ++ +     ++++K   G  Y   +    
Sbjct: 651 IQGGTFREQIIYPMSADQYFDMGYRDKELTHILGEVKL--DYLLKRDKGWRYLDAVAEWK 708

Query: 581 ALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIA 640
            +LSGG++QRI  AR +  KP  +VLDEAT+A+  + E   +Y FG L+K      ++I+
Sbjct: 709 DVLSGGERQRINFARIMFHKPRFVVLDEATNAISADME---DYLFG-LLKRYRFNFITIS 764

Query: 641 HRLSTIRRSENIIVLGNDGS 660
            R S I+  +  + +  DG+
Sbjct: 765 QRPSLIKYHDLALDISTDGT 784

>Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {ON}
           complement(86642..88900) [2259 nt, 753 aa]
          Length = 752

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 63/229 (27%), Positives = 103/229 (44%), Gaps = 34/229 (14%)

Query: 443 IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI 502
           I  +DV+F Y  +  N++  D+++ +   S + +VG +G GK+T+  +++    P  G +
Sbjct: 532 IQLQDVSFGYNEK--NLLLADVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPLKGYV 589

Query: 503 FIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSK--EEIRMVAKQCF 560
             +G           R  IG   Q  V      +  + +  T  P K  EE R       
Sbjct: 590 SQNG-----------RLRIGYFTQHHVDSLDLTKSAVDWMSTAYPGKTDEEYR------- 631

Query: 561 CHNFIVKFPHGYDTVIGPQG-ALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEG 619
               +  F  G    +  Q   LLSGGQK R+A A   +  P IL+LDE ++ LD     
Sbjct: 632 --RHLGAF--GITGSLSLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNHLDTSGID 687

Query: 620 AI-----NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVE 663
           A+      +T G LM S  ++++S  +  + I  SEN  V   DG++ +
Sbjct: 688 ALVDAMKKFTGGILMVSHDISVIS--NVCNEIWVSENGTVKRFDGTIYD 734

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 583 LSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAH 641
            SGG + R+++ARAL  +P +L+LDE T+ LDV S   I Y   + +K+   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPTNMLDVPS---IAY-LSEYLKTYPSTVLTVSH 422

>TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]
           {ON} Anc_1.427 YCR011C
          Length = 1119

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 79/290 (27%), Positives = 140/290 (48%), Gaps = 38/290 (13%)

Query: 403 SFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGK--GEIVFKDVTFSYPTRPGNVI 460
           SF ++L Q +   T +F LT    +        F+  K    + F++++++ P+   N  
Sbjct: 394 SFTNKLTQVI---TTIFGLTAVADTSIQGRDDDFLTSKHVAALSFENISYNVPSISDNNS 450

Query: 461 FRDMDIKIPA----GSNVCVVGPSGRGKSTIALLLLRFYNPS---SGQIFIDGQDISKLN 513
            RD+   +      G  + ++G SG GK+T+ L +L F   S   SG I I+G+++S+  
Sbjct: 451 ERDILKNVSGIVKPGEIMAILGGSGAGKTTL-LDILAFKRKSGHVSGDIKINGKNVSR-- 507

Query: 514 IKSLRRHIGLVQQ-----------EPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCH 562
            + + + IG V Q           E VL S  LR  +   +T    ++ +  V ++   +
Sbjct: 508 -EIISKMIGFVDQDDFLFPTLTVYEAVLNSALLR--LPNSMTFYQKQQRVFQVLEELRIY 564

Query: 563 NFIVKFPHGYDTVIGPQGAL-LSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAI 621
           N  +K     D +IG      +SGG+K+R++IA  L+  P IL LDE TS LD  +   +
Sbjct: 565 N--IK-----DRLIGDDFERGISGGEKRRVSIACELVTSPLILFLDEPTSGLDSNNANNV 617

Query: 622 NYTFGQLMKSKSVTIVSIAHR-LSTIRRSENIIVLGNDGSVVETGKFKEL 670
                +L K+ + T+V   H+  S I    + +VL + G +V +G+ + +
Sbjct: 618 VECLVRLAKNYNRTLVLTIHQPRSNIFHLFSKLVLLSSGEMVYSGEIRRV 667

>KLLA0F11484g Chr6 (1052991..1055528) [2538 bp, 845 aa] {ON} similar
           to uniprot|P41909 Saccharomyces cerevisiae YPL147W PXA1
           Pxa1p and Pxa2p appear to be subunits of a peroxisomal
           ATP-binding cassette transporter necessary for transport
           of long-chain fatty acids into peroxisomes ABC family
           long-chain fatty acid transporter
          Length = 845

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 96/223 (43%), Gaps = 59/223 (26%)

Query: 471 GSNVCVVGPSGRGKSTIALLLLRFY----------NPSSGQIFIDGQDISKLNIKSLRRH 520
           GS++ ++GP+  GKS+I  +L   +           P S  +F                 
Sbjct: 615 GSSLLILGPNSCGKSSIERILTEIWPIYNKNGLLSTPPSHDLFC---------------- 658

Query: 521 IGLVQQEPVLMSG-TLRDNITYGLTETPSKE-------------EIRMVAKQCFCHNFIV 566
              V Q P  + G T RD I Y +T     E             E+R+        ++++
Sbjct: 659 ---VPQRPYFIQGGTFRDQIIYPMTYEQFHERGHKDTYLVQILREVRL--------DYLL 707

Query: 567 KFPHG--YDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYT 624
           K   G  Y   I     +LSGG+KQR+   R +  +P  +VLDEAT+A+ V+ E  + +T
Sbjct: 708 KRDRGLNYFDAIADWKDVLSGGEKQRMNFTRIMFHRPRFVVLDEATNAISVDMEDHL-FT 766

Query: 625 FGQLMKSKSVTIVSIAHRLSTIRRSENIIVL--GNDGSVVETG 665
              ++K      +SI+ R S I+  + ++ L  G D S+   G
Sbjct: 767 ---MLKRYRFNFISISQRPSLIKYHDYLLELTNGTDWSLQALG 806

>TDEL0A03640 Chr1 (646252..650781) [4530 bp, 1509 aa] {ON} Anc_5.500
            YDR406W
          Length = 1509

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 60/220 (27%), Positives = 101/220 (45%), Gaps = 19/220 (8%)

Query: 460  IFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPS--SGQIFIDGQDISKLNIKSL 517
            I  ++D  +  G+   ++G SG GK+T+   L         +G+IF++G    +L  +S 
Sbjct: 881  ILNNVDGWVKPGTLTALMGASGAGKTTLLDCLADRTTMGVITGEIFVNG----RLRDESF 936

Query: 518  RRHIGLVQQEPV-LMSGTLRDNITY-GLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTV 575
             R IG  QQ+ + L + T+R+++ +      P+K  I    K       I++  H  D V
Sbjct: 937  PRTIGYCQQQDLHLKTSTVRESLRFSAYLRQPAKVSIEEKNKYVEEVIKILEMEHYADAV 996

Query: 576  IGPQGALLSGGQKQRIAIARALIKKPTILV-LDEATSALDVESEGAINYTFGQLMKSKSV 634
            +G  G  L+  Q++R+ I   L+ KP +LV LDE TS LD ++  +I     +L      
Sbjct: 997  VGVAGEGLNVEQRKRLTIGVELVAKPALLVFLDEPTSGLDSQTAWSICQLMRKLANHGQA 1056

Query: 635  TIVSIAH----------RLSTIRRSENIIVLGNDGSVVET 664
             + +I            RL  +RR    +  G+ G    T
Sbjct: 1057 ILCTIHQPSAMLMQEFDRLLFMRRGGETVYFGDLGEGCTT 1096

>Kpol_1012.10 s1012
           complement(20013..20741,21318..21326,21750..21968,
           21970..23580) [2568 bp, 855 aa] {ON}
           complement(20013..20741,21318..21326,21750..21968,
           21970..23580) [2568 nt, 856 aa]
          Length = 855

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 48/147 (32%), Positives = 76/147 (51%), Gaps = 14/147 (9%)

Query: 524 VQQEPVLM-SGTLRDNITYGLTETPS-----KEEIRMVAKQCFCHNFIVKFPHG--YDTV 575
           + Q+P     GTLRD I Y +T         K+++ +         +++K   G  Y  V
Sbjct: 667 IPQKPYFARGGTLRDQIIYPMTSDEFFDRGLKDKLLVQILSEVKLEYLLKRAKGWSYLDV 726

Query: 576 IGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVT 635
           +     +LSGG+KQR+  AR L  KP  +VLDEAT+A+ V+ E   +Y F  L K +   
Sbjct: 727 VADWKDVLSGGEKQRMNFARILFHKPRFVVLDEATNAISVDME---DYLFNLLRKYR-FN 782

Query: 636 IVSIAHRLSTIRRSENIIVL--GNDGS 660
            +SI+ R S I+  + ++ +   NDG+
Sbjct: 783 FISISQRPSLIKYHDQLLEISESNDGT 809

>NCAS0A08570 Chr1 (1693304..1696486) [3183 bp, 1060 aa] {ON}
           Anc_1.427
          Length = 1060

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 70/250 (28%), Positives = 114/250 (45%), Gaps = 46/250 (18%)

Query: 445 FKDVTFSYPTRPGN---------VIFRDMDIKIPAGSNVCVVGPSGRGKSTIA--LLLLR 493
           F+++T+  P+   N          + + +D  +  G    ++G SG GK+T+   L + R
Sbjct: 392 FENITYEVPSLNKNHKSQPNSNVKVLKSIDGIVKPGQIFAIMGGSGAGKTTLLDILAMKR 451

Query: 494 FYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQ-----------EPVLMSGTLRDNITYG 542
                 G+I ++G  +S+   KS  + IG V Q           E VL S  LR   T  
Sbjct: 452 KTGQVGGEIKVNGNIMSR---KSYSKLIGFVDQNDYLHPTLTVYETVLNSALLRLPRTMS 508

Query: 543 LTETPSK-----EEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGAL-LSGGQKQRIAIARA 596
                S+     EE+R+         F +K     D +IG      +SGG+K+R++IA  
Sbjct: 509 FESKQSRVFQILEELRI---------FDIK-----DRIIGNDFERGISGGEKRRVSIACE 554

Query: 597 LIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHR-LSTIRRSENIIVL 655
           L+  P IL LDE TS LD  +   +  +  +L K+ + T++   H+  S I    N +VL
Sbjct: 555 LVTSPLILFLDEPTSGLDANNANNVITSLVRLAKNYNRTLILTIHQPRSNIFNQFNKLVL 614

Query: 656 GNDGSVVETG 665
            + G +V +G
Sbjct: 615 LSQGEMVFSG 624

>Suva_6.84 Chr6 complement(145289..147547) [2259 bp, 752 aa] {ON}
           YFR009W (REAL)
          Length = 752

 Score = 62.0 bits (149), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 90/204 (44%), Gaps = 32/204 (15%)

Query: 443 IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI 502
           I  +DV F Y     N++ RD+++ +   S + +VG +G GK+T+  +++    P+ G  
Sbjct: 532 IQLQDVFFGY--NENNLLLRDVNLDVQMDSRIALVGANGCGKTTLLKIMMEQLRPTKG-- 587

Query: 503 FIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSK--EEIRMVAKQCF 560
           F+          ++ R  IG   Q  V         + +     P K  EE R       
Sbjct: 588 FVS---------RNPRLRIGYFTQHHVDSMDLTTSAVDWMSNSFPGKTDEEYR------- 631

Query: 561 CHNFIVKFPHGYDTVIGPQG-ALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEG 619
               +  F  G    +G Q   LLSGGQK R+A A   +  P ILVLDE ++ LD     
Sbjct: 632 --RHLGSF--GITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTTGLD 687

Query: 620 AI-----NYTFGQLMKSKSVTIVS 638
           A+     N+  G LM S  ++++ 
Sbjct: 688 ALVDALKNFNGGVLMVSHDISVID 711

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 583 LSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAH 641
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   TI++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPNTILTVSH 422

>KNAG0K00950 Chr11 complement(186381..190235) [3855 bp, 1284 aa]
           {ON} Anc_3.133 YOL075C
          Length = 1284

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 63/263 (23%), Positives = 110/263 (41%), Gaps = 36/263 (13%)

Query: 438 PGKGEIVFKDVTFSYP---------------TRPGNVIFRDMDIKIPAGSNVCVVGPSGR 482
           P + E+  KD+T +                  R    I R ++     G    ++GPSG 
Sbjct: 659 PYEVEVSLKDITLTVDYIHVQGISQWRNKIINRERKKILRSVNATFKPGMVNAIMGPSGS 718

Query: 483 GKSTI---------ALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSG 533
           GKST+         + L  RF     G +  +G ++S+   K +  ++   Q +  L+S 
Sbjct: 719 GKSTLLNLISGRVKSTLFSRF--TKDGSMSFNGAEVSETMFKQICSYVS--QDDDHLLSK 774

Query: 534 -TLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKF--PHGYDTVIGPQGAL-LSGGQKQ 589
            T+R+  T+          +    ++   +N I+     H  DT+IG +    +SGG+K+
Sbjct: 775 LTVRE--TFKFASDLRLHHLNAKEREAKRNNLIIALGLKHCEDTIIGNEFVKGISGGEKR 832

Query: 590 RIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAH--RLSTIR 647
           R+ +   L+  P IL+LDE TS LD  +   I      L +    T++   H  R    +
Sbjct: 833 RVTMGIQLLNDPPILLLDEPTSGLDSFTSSTILEILSNLCQEYGKTVILTIHQPRAELFK 892

Query: 648 RSENIIVLGNDGSVVETGKFKEL 670
           +  N+++L   G     G   E+
Sbjct: 893 KFGNVLLLAKSGRTAFNGSPDEM 915

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 100/230 (43%), Gaps = 48/230 (20%)

Query: 460 IFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRR 519
           + +   + +P+GS + V+G SG GK+T   LL    +  SG +   G+      I  +R 
Sbjct: 36  LVKSFSLDLPSGSIMAVMGGSGSGKTT---LLNVLASKISGGLKTVGE------INYIRE 86

Query: 520 HIG--------------LVQQEPVLMSGTLRDNITYGLT---ETPSKEEIRMVA------ 556
             G              L QQ+ +    T RD + +      + P  E++++V       
Sbjct: 87  DCGVNDGDHPEHAVMTYLPQQDVLPARLTCRDTMMFAADLKLDKPKHEKVQIVEQLIDEL 146

Query: 557 --KQCFCHNFIVKFPHGYDTVIGPQGAL-LSGGQKQRIAIARALIKKPTILVLDEATSAL 613
             K C             DT+IG      LSGG+K+R++I   +I  P+I+ LDE T+ L
Sbjct: 147 GLKDC------------ADTIIGDSSHRGLSGGEKRRLSIGTQMIANPSIMFLDEPTTGL 194

Query: 614 DVESEGAINYTFGQLMKSKS-VTIVSIAHRLSTIRRSENIIVLGNDGSVV 662
           D  S   +  T  +L +    + I+SI    S I    + + + + G++V
Sbjct: 195 DAYSAYLVVKTIRKLAEDDGRIFIMSIHQPRSDIMFLLDKVCILSKGNIV 244

>TDEL0A06070 Chr1 complement(1064071..1066689) [2619 bp, 872 aa]
           {ON} Anc_8.661 YPL147W
          Length = 872

 Score = 62.0 bits (149), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 65/257 (25%), Positives = 108/257 (42%), Gaps = 62/257 (24%)

Query: 425 VPSIKPTTGKKFVPGKGEIVFKDVTFSYP-----TRPGNVIFRDM----DIKIP----AG 471
           +PS++   G K +        K +TF  P     T       +D+    D+ +P     G
Sbjct: 589 IPSVRAGEGIKLI--------KKLTFQVPPQIEPTSSAANSVQDLKKMFDVSLPFFEGPG 640

Query: 472 SNVCVVGPSGRGKSTIALLLLRF---YN-------PSSGQIFIDGQDISKLNIKSLRRHI 521
           +++ ++GP+  GKS+I  ++      YN       PS G +F                  
Sbjct: 641 ASLLILGPNSCGKSSIQRIIAEIWPVYNKNGLLSIPSEGNLFC----------------- 683

Query: 522 GLVQQEPVLM-SGTLRDNITYGLTETP-------SKEEIRMVAKQCFCHNFIVKFPHGYD 573
             V Q+P     GTLRD I Y ++           K  ++++ +    +    K    Y 
Sbjct: 684 --VPQKPYFTRGGTLRDQIIYPMSSDEFFDRGFKDKHLVQILGEVRLEYLLKRKKGWTYL 741

Query: 574 TVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKS 633
             +     +LSGG+KQR+  AR +  KP  +VLDE T+A+  + E   +Y F  L+K   
Sbjct: 742 DAVADWKDVLSGGEKQRMNFARIMFHKPRFVVLDEGTNAISADME---DYLFN-LLKRYR 797

Query: 634 VTIVSIAHRLSTIRRSE 650
              +SI+ R S I+  +
Sbjct: 798 FNFISISQRPSLIKYHD 814

>Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar to
           Ashbya gossypii ACR128C
          Length = 828

 Score = 61.6 bits (148), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 95/191 (49%), Gaps = 21/191 (10%)

Query: 471 GSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVL 530
           GS++ ++GP+  GKS+I  ++         +I+        L+I S    + + Q+   +
Sbjct: 598 GSSLLILGPNSCGKSSIQRII--------AEIWPIYNKTGLLSIPSESDMMCIAQRPYFI 649

Query: 531 MSGTLRDNITYGL-----TETPSKE-EIRMVAKQCFCHNFIVKFPHGYDTV--IGPQGAL 582
             GT RD I Y +      E   K+ E+  V K+    ++++K     + +  +     +
Sbjct: 650 QGGTFRDQIIYPMFVDTFYEKGHKDRELVRVLKEVKL-DYLLKRADALNYLDHVADWKDV 708

Query: 583 LSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHR 642
           LSGG+KQR+  AR +  +P  +VLDEAT+A+  + E   +Y F  L K +    +SI+ R
Sbjct: 709 LSGGEKQRMNFARIMFHRPKFIVLDEATNAISADME---DYLFNMLKKFR-FNFISISQR 764

Query: 643 LSTIRRSENII 653
            S I+  + ++
Sbjct: 765 PSLIKYHDYLL 775

>SAKL0H06908g Chr8 (605838..608348) [2511 bp, 836 aa] {ON} similar
           to uniprot|P41909 Saccharomyces cerevisiae YPL147W PXA1
           Pxa1p and Pxa2p appear to be subunits of a peroxisomal
           ATP-binding cassette transporter necessary for transport
           of long-chain fatty acids into peroxisomes ABC family
           long-chain fatty acid transporter
          Length = 836

 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 93/187 (49%), Gaps = 19/187 (10%)

Query: 471 GSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVL 530
           GS++ ++GP+  GKS+I  ++         +I+        L+I +      + Q+   L
Sbjct: 606 GSSLLILGPNSCGKSSIQRII--------AEIWPIYNKNGLLSIPTSVNLFCIPQKPYFL 657

Query: 531 MSGTLRDNITYGLT-----ETPSKEEIRMVAKQCFCHNFIVKFPHGYDTV--IGPQGALL 583
             GTLRD I Y ++     +   K++  + A Q     +++K   G+  +  +     +L
Sbjct: 658 QGGTLRDQIIYPMSTDEFFDRGHKDKDLVQALQEVKLEYLLKRDRGWKYLDAVADWKDVL 717

Query: 584 SGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRL 643
           SGG++QR+  AR +  +P  +VLDEAT+A+  + E   +Y F  ++K      ++I+ R 
Sbjct: 718 SGGERQRMNFARIMFHRPRFVVLDEATNAISADME---DYLFN-MLKRYRFNFITISQRP 773

Query: 644 STIRRSE 650
           S I+  +
Sbjct: 774 SLIKYHD 780

>YDR406W Chr4 (1279210..1283799) [4590 bp, 1529 aa] {ON}  PDR15Plasma
            membrane ATP binding cassette (ABC) transporter,
            multidrug transporter and general stress response factor
            implicated in cellular detoxification; regulated by
            Pdr1p, Pdr3p and Pdr8p; promoter contains a PDR
            responsive element
          Length = 1529

 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 68/247 (27%), Positives = 117/247 (47%), Gaps = 29/247 (11%)

Query: 440  KGEIVF--KDVTFSYPTRPGNV-IFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYN 496
            K E +F  +D+ +  P + G   I  ++D  +  G+   ++G SG GK+T+   L     
Sbjct: 879  KSEAIFHWRDLCYDVPIKGGQRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVT 938

Query: 497  PS--SGQIFIDGQDISKLNIKSLRRHIGLVQQEPV-LMSGTLRDNITY-GLTETPS---- 548
                +G IF+DG    +L  +S  R IG  QQ+ + L + T+R+++ +      PS    
Sbjct: 939  MGVITGNIFVDG----RLRDESFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPSSVSI 994

Query: 549  KEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILV-LD 607
            +E+ R V +       I++     D V+G  G  L+  Q++R+ I   L  +P +LV LD
Sbjct: 995  EEKNRYVEEVI----KILEMQQYSDAVVGVAGEGLNVEQRKRLTIGVELAARPKLLVFLD 1050

Query: 608  EATSALDVESEGAINYTFGQLMK---SKSVTIVSIAHRLSTI--RRSENIIVLGNDGSVV 662
            E TS LD ++     +   QLM+   +    I+   H+ S I  ++ + ++ L   G  V
Sbjct: 1051 EPTSGLDSQTA----WDTCQLMRKLATHGQAILCTIHQPSAILMQQFDRLLFLQKGGQTV 1106

Query: 663  ETGKFKE 669
              G   E
Sbjct: 1107 YFGDLGE 1113

>Smik_4.678 Chr4 (1200036..1204637) [4602 bp, 1533 aa] {ON} YDR406W
            (REAL)
          Length = 1533

 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 66/243 (27%), Positives = 113/243 (46%), Gaps = 21/243 (8%)

Query: 440  KGEIVF--KDVTFSYPTRPGNV-IFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYN 496
            K E +F  +D+ +  P + G   I  ++D  +  G+   ++G SG GK+T+   L     
Sbjct: 883  KSEAIFHWRDLCYDVPVKGGQRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVT 942

Query: 497  PS--SGQIFIDGQDISKLNIKSLRRHIGLVQQEPV-LMSGTLRDNITY-GLTETPSKEEI 552
                +G IF+DG    +L  +S  R IG  QQ+ + L + T+R+++ +      PS   I
Sbjct: 943  MGVITGNIFVDG----RLRDESFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPSSVSI 998

Query: 553  RMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILV-LDEATS 611
                K       I++     D V+G  G  L+  Q++R+ I   L  +P +LV LDE TS
Sbjct: 999  EEKNKYVEEVIKILEMEKYSDAVVGIAGEGLNVEQRKRLTIGVELAARPKLLVFLDEPTS 1058

Query: 612  ALDVESEGAINYTFGQLMK---SKSVTIVSIAHRLSTI--RRSENIIVLGNDGSVVETGK 666
             LD ++     +   QLM+   +    I+   H+ S I  ++ + ++ +   G  V  G 
Sbjct: 1059 GLDSQTA----WDTCQLMRKLATHGQAILCTIHQPSAILMQQFDRLLFMQRGGQTVYFGD 1114

Query: 667  FKE 669
              E
Sbjct: 1115 LGE 1117

>TPHA0A02310 Chr1 (483447..485705) [2259 bp, 752 aa] {ON} Anc_1.366
           YFR009W
          Length = 752

 Score = 61.2 bits (147), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 90/204 (44%), Gaps = 32/204 (15%)

Query: 443 IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI 502
           I  +DV F Y  +   ++  D+++ I   S + +VG +G GK+T+  +++    P  G +
Sbjct: 532 IQLQDVDFGYDNKE--LLLNDVNLDIQMDSRIALVGANGCGKTTLLKVMMEQLRPVKGYV 589

Query: 503 FIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSK--EEIRMVAKQCF 560
             +G           R  IG   Q  V      +  + +  T  P K  EE R       
Sbjct: 590 SRNG-----------RLRIGYFTQHHVDSMDLDKSAVDWMSTAFPGKTDEEYR------- 631

Query: 561 CHNFIVKFPHGYDTVIGPQG-ALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEG 619
               +  F  G    +  Q   LLSGGQK R+A A   ++ P ILVLDE ++ LD     
Sbjct: 632 --RHLGAF--GITGSLSLQKIQLLSGGQKSRVAFAALCLENPHILVLDEPSNHLDTAGID 687

Query: 620 AI-----NYTFGQLMKSKSVTIVS 638
           A+     N+T G LM S  ++++ 
Sbjct: 688 ALVDALKNFTGGVLMVSHDISVID 711

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 583 LSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAH 641
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPSTVLTVSH 422

>ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} similar
            to uniprot|Q04182 Saccharomyces cerevisiae YDR406W PDR15
            ATP binding cassette (ABC) transporter of the plasma
            membrane general stress response factor implicated in
            cellular detoxification target of Pdr1p Pdr3p and Pdr8p
            transcription regulators promoter contains a PDR
            responsive element
          Length = 1498

 Score = 61.2 bits (147), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 60/223 (26%), Positives = 106/223 (47%), Gaps = 20/223 (8%)

Query: 455  RPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPS--SGQIFIDGQDISKL 512
            R    I  ++D  +  G+   ++G SG GK+T+   L         +G IF+DG    KL
Sbjct: 866  RESKRILNNIDGWVKPGTLTALMGASGAGKTTLLDCLAERVTTGVITGGIFVDG----KL 921

Query: 513  NIKSLRRHIGLVQQEPV-LMSGTLRDNITYGL-----TETPSKEEIRMVAKQCFCHNFIV 566
              +S  R IG  QQ+ + L + T+R+++ +          P+ E+ + V +     N + 
Sbjct: 922  RDESFPRSIGYCQQQDLHLKTATVRESLLFSAMLRQPKSVPASEKRKYVEEVI---NVLE 978

Query: 567  KFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILV-LDEATSALDVESEGAINYTF 625
              P+  D ++G  G  L+  Q++R+ I   L+ KP +L+ LDE TS LD ++  +I    
Sbjct: 979  MEPYA-DAIVGVAGEGLNVEQRKRLTIGVELVAKPKLLIFLDEPTSGLDSQTAWSICQLI 1037

Query: 626  GQLMKSKSVTIVSIAHRLST--IRRSENIIVLGNDGSVVETGK 666
             +L       + +I H+ S   I+  + ++ L   G  V  G+
Sbjct: 1038 RKLANRGQAILCTI-HQPSAVLIQEFDRLLFLQKGGETVYFGE 1079

>ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {ON}
           similar to uniprot|P41909 Saccharomyces cerevisiae
           YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
           peroxisomal ATP-binding cassette transporter necessary
           for transport of long-chain fatty acids into peroxisomes
           ABC family long-chain fatty acid transporter
          Length = 861

 Score = 61.2 bits (147), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 63/261 (24%), Positives = 112/261 (42%), Gaps = 51/261 (19%)

Query: 425 VPSIKPTTGKKFVPGKGEIVFKDVTFSYPTRPGNVI---FRDMDIKIP----AGSNVCVV 477
           +PS +   G K +   G + F+  +   P+   + I    ++ D  +P     G+++ ++
Sbjct: 581 IPSRRAGRGAKLI---GTLTFQIPSVIEPSSKSSSIQDFKKNFDPNVPLIDSTGASLLIL 637

Query: 478 GPSGRGKSTIALLLLRF---YN-------PSSGQIFIDGQDISKLNIKSLRRHIGLVQQE 527
           GP+  GKS+I  ++      YN       P+   +F                    V Q 
Sbjct: 638 GPNSCGKSSIQRIITEVWPVYNKNGLLSIPAPSNLFC-------------------VPQR 678

Query: 528 PVLM-SGTLRDNITYGLTETP-------SKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQ 579
           P     GT RD I Y ++           K   R++ +    +    +    Y   +   
Sbjct: 679 PYFTRGGTFRDQIIYPMSSDEFFDRGLKDKNLARILKEVHLDYLLDREIGCSYMDAVADW 738

Query: 580 GALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSI 639
             +LSGG+KQR+  AR L  +P  +VLDEAT+A+ V+ E   +Y F  L+K      ++I
Sbjct: 739 KDVLSGGEKQRMNFARILFHRPRFVVLDEATNAISVDME---DYLFN-LLKRYRFNFITI 794

Query: 640 AHRLSTIRRSENIIVLGNDGS 660
           + R S I+  + ++ + + GS
Sbjct: 795 SQRPSLIKYHDMLLEVDSSGS 815

>TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON}
           Anc_1.427 YCR011C
          Length = 1036

 Score = 61.2 bits (147), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 67/242 (27%), Positives = 114/242 (47%), Gaps = 38/242 (15%)

Query: 445 FKDVTFSYPT-RPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIA--LLLLRFYNPSSGQ 501
           F+++T++  + +    I + +   I  G  + ++G SG GK+T+   L + R     +G 
Sbjct: 379 FENITYNVSSSKTDENILKGISGIIKPGQMMALLGGSGAGKTTLLDILAMKRKTGQVTGS 438

Query: 502 IFIDGQDISKLNIKSLRRHIGLVQQ-----------EPVLMSGTLRDNITYGLTETPSK- 549
           I ++G DI +   K   + IG V Q           E VL S  LR   ++      ++ 
Sbjct: 439 IKVNGSDIPR---KDFTKLIGFVDQDDYLLPTLTVYETVLNSALLRLPRSFSFAAKQTRV 495

Query: 550 ----EEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGAL-LSGGQKQRIAIARALIKKPTIL 604
               EE+R++  +              D VIG      +SGG+K+R++IA  L+  P IL
Sbjct: 496 YQVLEELRILDIK--------------DRVIGNDFERGISGGEKRRVSIACELVTSPLIL 541

Query: 605 VLDEATSALDVESEGAINYTFGQLMKSKSVTIV-SIAHRLSTIRRSENIIVLGNDGSVVE 663
            LDE TS LD  +   +     +L K+ + T+V SI    S I +  + +VL ++G +V 
Sbjct: 542 FLDEPTSGLDANNANNVVECLVRLAKTYNRTLVLSIHQPRSNIFQLFDKLVLLSNGEMVY 601

Query: 664 TG 665
           +G
Sbjct: 602 SG 603

>YOL075C Chr15 complement(189658..193542) [3885 bp, 1294 aa] {ON}
           Putative ABC transporter
          Length = 1294

 Score = 61.2 bits (147), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 59/247 (23%), Positives = 110/247 (44%), Gaps = 32/247 (12%)

Query: 445 FKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLL---------LRFY 495
           +K+  F + T+    I + ++     G    ++GPSG GKS++  L+          +F 
Sbjct: 697 WKEGNFHHETKE---ILQSVNAIFKPGMINAIMGPSGSGKSSLLNLISGRLKSSVFAKF- 752

Query: 496 NPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYG-------LTETPS 548
             +SG I  +   +S+L  K++  ++     + +L + T+++ + Y        LTE   
Sbjct: 753 -DTSGSIMFNDIQVSELMFKNVCSYVS-QDDDHLLAALTVKETLKYAAALRLHHLTEAER 810

Query: 549 KEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGAL-LSGGQKQRIAIARALIKKPTILVLD 607
            E    + +        +   H  + +IG +    +SGG+K+R+ +   L+  P IL+LD
Sbjct: 811 MERTDNLIRS-------LGLKHCENNIIGNEFVKGISGGEKRRVTMGVQLLNDPPILLLD 863

Query: 608 EATSALDVESEGAINYTFGQLMKSKSVTIVSIAH--RLSTIRRSENIIVLGNDGSVVETG 665
           E TS LD  +   I     +L + +  TI+   H  R    +R  N+++L   G     G
Sbjct: 864 EPTSGLDSFTSATILEILEKLCREQGKTIIITIHQPRSELFKRFGNVLLLAKSGRTAFNG 923

Query: 666 KFKELFA 672
              E+ A
Sbjct: 924 SPDEMIA 930

 Score = 52.0 bits (123), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 96/217 (44%), Gaps = 37/217 (17%)

Query: 454 TRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLL-------------LRFYNPSSG 500
           ++    +     + +P+GS + V+G SG GK+T+  +L             +R+    +G
Sbjct: 38  SKTNTTLVNTFSMDLPSGSVMAVMGGSGSGKTTLLNVLASKISGGLTHNGSIRYVLEDTG 97

Query: 501 ---------QIFIDGQDISKLNIKSLRRHI---GLVQQEPVLMSGTLRDNITYG--LTET 546
                    +  +DGQD        +++H+    L QQ+ +    T R+ + +   L   
Sbjct: 98  SEPNETEPKRAHLDGQD------HPIQKHVIMAYLPQQDVLSPRLTCRETLKFAADLKLN 151

Query: 547 PSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGAL-LSGGQKQRIAIARALIKKPTILV 605
            S+   +++ +Q       +      DT++G      LSGG+K+R++I   +I  P+I+ 
Sbjct: 152 SSERTKKLMVEQLIEE---LGLKDCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIMF 208

Query: 606 LDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHR 642
           LDE T+ LD  S   +  T  +L K    T +   H+
Sbjct: 209 LDEPTTGLDAYSAFLVIKTLKKLAKEDGRTFIMSIHQ 245

>ZYRO0D11836g Chr4 (993707..998095) [4389 bp, 1462 aa] {ON} similar to
            uniprot|Q04182 Saccharomyces cerevisiae YDR406W PDR15 ATP
            binding cassette (ABC) transporter of the plasma membrane
            general stress response factor implicated in cellular
            detoxification target of Pdr1p Pdr3p and Pdr8p
            transcription regulators promoter contains a PDR
            responsive element
          Length = 1462

 Score = 61.2 bits (147), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 61/220 (27%), Positives = 107/220 (48%), Gaps = 26/220 (11%)

Query: 460  IFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPS--SGQIFIDGQDISKLNIKSL 517
            I  ++D  +  G+   ++G +G GK+T+   L +       +G IF+DG    KL  +S 
Sbjct: 837  ILDNIDGWVKPGTLTALMGATGAGKTTLLDSLAQRVTTGVLTGSIFVDG----KLRDESF 892

Query: 518  RRHIGLVQQEPV-LMSGTLRDNITYGLT-----ETPSKEEIRMVAKQCFCHNFIVKFPHG 571
             R IG  QQ+ + L + T+R+++ +          P+ E+ + V +     N +   P+ 
Sbjct: 893  ARSIGYCQQQDLHLTTATVRESLLFSAMLRQPKSVPASEKRKYVEEVI---NVLEMEPYA 949

Query: 572  YDTVIGPQGALLSGGQKQRIAIARALIKKPTILV-LDEATSALDVESEGAINYTFGQLMK 630
             D ++G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD ++  +I     QLMK
Sbjct: 950  -DAIVGVAGEGLNVEQRKRLTIGVELAAKPNLLLFLDEPTSGLDSQTAWSI----CQLMK 1004

Query: 631  ---SKSVTIVSIAHRLST--IRRSENIIVLGNDGSVVETG 665
               ++   I+   H+ S   I+  + ++ L   G  V  G
Sbjct: 1005 KLANRGQAILCTIHQPSAMLIQEFDRLLFLQKGGQTVYFG 1044

>Kpol_1049.23 s1049 complement(67726..68058) [333 bp, 110 aa] {ON}
           complement(67726..68058) [333 nt, 111 aa]
          Length = 110

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 49/73 (67%), Gaps = 3/73 (4%)

Query: 591 IAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSE 650
           I +ARAL++   IL++DEAT+++D E++  +  T     + + VTIV+IAHRL TI   +
Sbjct: 2   ICLARALLRSTKILLIDEATASIDYEADAKLQETIQ--TEFQDVTIVAIAHRLQTIIDYD 59

Query: 651 NIIVLGNDGSVVE 663
            I+VL + G V+E
Sbjct: 60  KILVL-DAGQVIE 71

>YDR011W Chr4 (465919..470424) [4506 bp, 1501 aa] {ON}  SNQ2Plasma
            membrane ATP-binding cassette (ABC) transporter,
            multidrug transporter involved in multidrug resistance
            and resistance to singlet oxygen species
          Length = 1501

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/240 (25%), Positives = 113/240 (47%), Gaps = 20/240 (8%)

Query: 437  VPGKGEIVFKDVTFSYPTRPGNVIFRD--MDIKIPAGSNVCVVGPSGRGKST-IALLLLR 493
            +  KG  ++KDV F+ P   G  +  D      IP G+   ++G SG GK+T +  L  R
Sbjct: 847  LEAKGVFIWKDVCFTIPYEGGKRMLLDNVSGYCIP-GTMTALMGESGAGKTTLLNTLAQR 905

Query: 494  FYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSG-TLRDNITYGL-----TETP 547
                 +G + ++G+ I      S  R  G VQQ+ + ++  T+R+++ +          P
Sbjct: 906  NVGIITGDMLVNGRPID----ASFERRTGYVQQQDIHIAELTVRESLQFSARMRRPQHLP 961

Query: 548  SKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILV-L 606
              E++  V K       ++      + ++G  G  L+  Q+++++I   L+ KP +L+ L
Sbjct: 962  DSEKMDYVEKII----RVLGMEEYAEALVGEVGCGLNVEQRKKLSIGVELVAKPDLLLFL 1017

Query: 607  DEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTI-RRSENIIVLGNDGSVVETG 665
            DE TS LD +S  AI     +L K+    + +I    +T+    + +++L   G  V  G
Sbjct: 1018 DEPTSGLDSQSSWAIIQLLRKLSKAGQSILCTIHQPSATLFEEFDRLLLLRKGGQTVYFG 1077

>Smik_7.313 Chr7 (524077..526335) [2259 bp, 752 aa] {ON} YFR009W
           (REAL)
          Length = 752

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 91/204 (44%), Gaps = 32/204 (15%)

Query: 443 IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI 502
           I  +DV+F Y  +  N++ +D+++ +   S + +VG +G GK+T+  +++    P  G  
Sbjct: 532 IQLQDVSFGYDEK--NLLLKDVNLDVQMDSRIALVGANGCGKTTLLKIMMEQLRPLKG-- 587

Query: 503 FIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSK--EEIRMVAKQCF 560
           F+          ++ R  IG   Q  V         + +     P K  EE R       
Sbjct: 588 FVS---------RNPRLRIGYFTQHHVDSMDLTTSAVDWMSKSFPGKTDEEYR------- 631

Query: 561 CHNFIVKFPHGYDTVIGPQG-ALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEG 619
               +  F  G    +G Q   LLSGGQK R+A A   +  P ILVLDE ++ LD     
Sbjct: 632 --RHLGSF--GITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTTGLD 687

Query: 620 AI-----NYTFGQLMKSKSVTIVS 638
           A+     N+  G LM S  ++++ 
Sbjct: 688 ALVDALKNFNGGVLMVSHDISVID 711

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 583 LSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAH 641
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPNTVLTVSH 422

>TBLA0C01780 Chr3 complement(421045..423711) [2667 bp, 888 aa] {ON}
           Anc_8.661 YPL147W
          Length = 888

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 95/190 (50%), Gaps = 27/190 (14%)

Query: 472 SNVCVVGPSGRGKSTIALLLLRF---YNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEP 528
           S++ ++G +  GK++I  ++ +    YN  SG + I   D           ++  + Q+P
Sbjct: 648 SSLLILGSNSCGKTSIQRIIAKLWPIYN-KSGLLSIPTDD-----------NLLFIPQKP 695

Query: 529 VLMSG-TLRDNITYGLT-----ETPSKEEIRMVAKQCFCHNFIVKFPHGYDTV--IGPQG 580
             + G TLRD I Y ++     +    +++ +        ++++K   G+  +  I    
Sbjct: 696 YFLKGGTLRDQIIYPMSPDEFFDIGLNDKLLIDILTDVKLDYLIKRDQGWMYLDHIAEWK 755

Query: 581 ALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIA 640
            LLSGG+KQR+  AR L  +P  ++LDEAT+A+ ++ E   +Y F  L+K      V+I+
Sbjct: 756 DLLSGGEKQRMNFARILFHRPKFIILDEATNAISIDME---DYLFN-LLKRYRFNFVTIS 811

Query: 641 HRLSTIRRSE 650
            R S I+  +
Sbjct: 812 QRPSLIKYHD 821

>TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON} 
          Length = 1551

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 98/201 (48%), Gaps = 20/201 (9%)

Query: 460  IFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPS--SGQIFIDGQDISKLNIKSL 517
            I  ++D  +  G+   ++G SG GK+T+   L         +G +FIDG    K   +S 
Sbjct: 911  ILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDVFIDG----KPRDESF 966

Query: 518  RRHIGLVQQEPV-LMSGTLRDNITY-GLTETPSKEEIRMVAKQCFCHNFI--VKFPHGYD 573
             R IG  QQ+ + L + T+R+++ +      P+  E+ +  K  +  + I  ++     D
Sbjct: 967  PRSIGYCQQQDLHLKTATVRESLRFSAYLRQPA--EVSIAEKNAYVEDIIKILEMEKYAD 1024

Query: 574  TVIGPQGALLSGGQKQRIAIARALIKKPTILV-LDEATSALDVESEGAINYTFGQLMK-- 630
             ++G  G  L+  Q++R+ I   L  KP +LV LDE TS LD ++  AI     QLM+  
Sbjct: 1025 AIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAI----CQLMRKL 1080

Query: 631  -SKSVTIVSIAHRLSTIRRSE 650
             ++   I+   H+ S I   E
Sbjct: 1081 CNQGQAILCTIHQPSAILMQE 1101

>KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1513

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/218 (27%), Positives = 102/218 (46%), Gaps = 14/218 (6%)

Query: 460  IFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPS--SGQIFIDGQDISKLNIKSL 517
            I  ++D  +  G+   ++G SG GK+T+   L         +G IF+DG   ++    S 
Sbjct: 887  ILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAERVTMGVITGDIFVDGLPRNE----SF 942

Query: 518  RRHIGLVQQEPV-LMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFI--VKFPHGYDT 574
             R IG  QQ+ + L + T+R+++ +       KE + +  K  +    I  ++     D 
Sbjct: 943  PRSIGYCQQQDLHLKTSTVRESLRFSAYLRQPKE-VSVEEKNAYVEEIIKILEMEKYADA 1001

Query: 575  VIGPQGALLSGGQKQRIAIARALIKKPTILV-LDEATSALDVESEGAINYTFGQLMKSKS 633
            ++G  G  L+  Q++R+ I   L  KP +LV LDE TS LD ++  AI     +L K   
Sbjct: 1002 IVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAICQLMKKLCKHGQ 1061

Query: 634  VTIVSIAHRLSTIRRSE--NIIVLGNDGSVVETGKFKE 669
              + +I H+ S I   E   ++ +   G  V  G+  E
Sbjct: 1062 AILCTI-HQPSAILMQEFDRLLFMQKGGKTVYFGELGE 1098

>ZYRO0D11858g Chr4 (998646..1003157) [4512 bp, 1503 aa] {ON} highly
            similar to gnl|GLV|CAGL0M01760g Candida glabrata
            CAGL0M01760g and similar to YOR153W uniprot|P33302
            Saccharomyces cerevisiae YOR153W PDR5 Short- lived
            membrane ABC (ATP-binding cassette) transporter actively
            exports various drugs expression regulated by Pdr1p also
            involved in steroid transport cation resistance and
            cellular detoxification during exponential growth
          Length = 1503

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 108/228 (47%), Gaps = 34/228 (14%)

Query: 460  IFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPS--SGQIFIDGQDISKLNIKSL 517
            I  ++D  +  G+   ++G SG GK+T+   L         +G IF++G    KL  +S 
Sbjct: 866  ILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAERVTMGVITGDIFVNG----KLRDESF 921

Query: 518  RRHIGLVQQEPV-LMSGTLRDNITYGL-----TETPSKEEIRMVAKQCFCHNFIVKF--- 568
             R IG  QQ+ + L + T+R+++ +          P+ E+ + V +       ++K    
Sbjct: 922  PRSIGYCQQQDLHLKTATVRESLLFSAMLRQPKSVPASEKRKYVEE-------VIKILEM 974

Query: 569  -PHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILV-LDEATSALDVESEGAINYTFG 626
             P+  D ++G  G  L+  Q++R+ I   L+ KP +LV LDE TS LD ++  +I     
Sbjct: 975  EPYA-DAIVGVAGEGLNVEQRKRLTIGVELVAKPKLLVFLDEPTSGLDSQTAWSI----C 1029

Query: 627  QLMKSKS---VTIVSIAHRLSTIRRSE--NIIVLGNDGSVVETGKFKE 669
            QLMK  S     I+   H+ S +   E   ++ L   G  V  G+  E
Sbjct: 1030 QLMKKLSNHGQAILCTIHQPSAMLMQEFDRLLFLQKGGKTVYFGELGE 1077

>TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {ON}
           Anc_8.661 YPL147W
          Length = 915

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 98/200 (49%), Gaps = 29/200 (14%)

Query: 471 GSNVCVVGPSGRGKSTIALLLLRF---YNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQE 527
           GS++ ++GP+  GKS+I  ++      YN + G + I  +D            +  + Q 
Sbjct: 683 GSSLLILGPNSCGKSSIQRIIAEIWPIYNKN-GLMSIPAED-----------ELMCIPQR 730

Query: 528 PVLMSG-TLRDNITYGL-----TETPSKEEIRMVAKQCFCHNFIVKFPHGY---DTVIGP 578
           P    G T RD I Y +      +   K+++ +         +++K   G+   D V   
Sbjct: 731 PYFSKGGTFRDQIIYPMGSDEFFDRGLKDKLLVQILADVKLEYLLKRDKGWSYFDAVFDW 790

Query: 579 QGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVS 638
           +  +LSGG+KQR+  AR L  KP  ++LDEAT+A+ V+ E   +Y F +++K      +S
Sbjct: 791 KD-VLSGGEKQRMNFARILFHKPRFVILDEATNAISVDME---DYLF-KMLKKYRFNFIS 845

Query: 639 IAHRLSTIRRSENIIVLGND 658
           I+ R S ++  + ++ +  D
Sbjct: 846 ISQRPSLVKYHDLLLEISED 865

>YFR009W Chr6 (162488..164746) [2259 bp, 752 aa] {ON}  GCN20Positive
           regulator of the Gcn2p kinase activity, forms a complex
           with Gcn1p; proposed to stimulate Gcn2p activation by an
           uncharged tRNA
          Length = 752

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 89/204 (43%), Gaps = 32/204 (15%)

Query: 443 IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI 502
           I  +DV+F Y     N++ +D+++ +   S + +VG +G GK+T+  +++    P  G  
Sbjct: 532 IQLQDVSFGYD--ENNLLLKDVNLDVQMDSRIALVGANGCGKTTLLKIMMEQLRPLKG-- 587

Query: 503 FIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSK--EEIRMVAKQCF 560
           F+          ++ R  IG   Q  V         + +     P K  EE R       
Sbjct: 588 FVS---------RNPRLRIGYFTQHHVDSMDLTTSAVDWMSKSFPGKTDEEYR------- 631

Query: 561 CHNFIVKFPHGYDTVIGPQG-ALLSGGQKQRIAIARALIKKPTILVLDE-----ATSALD 614
               +  F  G    +G Q   LLSGGQK R+A A   +  P ILVLDE      T+ LD
Sbjct: 632 --RHLGSF--GITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTTGLD 687

Query: 615 VESEGAINYTFGQLMKSKSVTIVS 638
              E   N+  G LM S  ++++ 
Sbjct: 688 ALVEALKNFNGGVLMVSHDISVID 711

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 583 LSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAH 641
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPNTVLTVSH 422

>NCAS0B05300 Chr2 (980856..984677) [3822 bp, 1273 aa] {ON} Anc_3.133
           YOL075C
          Length = 1273

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 98/205 (47%), Gaps = 23/205 (11%)

Query: 454 TRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKL- 512
           ++   V+     + +P+GS + V+G SG GK+T+  +L    +  SG +  DG DI  + 
Sbjct: 30  SKTDTVLVNSFSLDLPSGSVMAVMGGSGSGKTTLLNVLA---SKISGGLKTDG-DIHYIL 85

Query: 513 ---------NIKSLRRHIGLV---QQEPVLMSGTLRDNITYG--LTETPSKEEIRMVAKQ 558
                      + ++ H+ +    QQ+ +    T R+ + Y   L    SKEE ++V  Q
Sbjct: 86  EEKPQRDSEQEQEVQDHVKMAYLPQQDVLSARLTCRETLMYAADLKLDRSKEEKKLVVDQ 145

Query: 559 CFCHNFIVKFPHGYDTVIGPQGAL-LSGGQKQRIAIARALIKKPTILVLDEATSALDVES 617
              H   +K     +T++G      LSGG+K+R+++   +I  P+I+ LDE T+ LD  S
Sbjct: 146 -LIHELGLK--DCAETLVGDNTHRGLSGGEKRRLSVGTQMISNPSIMFLDEPTTGLDAYS 202

Query: 618 EGAINYTFGQLMKSKSVTIVSIAHR 642
              +  T  +L K    T +   H+
Sbjct: 203 AYLVVKTLKKLAKEDGRTFIMSIHQ 227

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/245 (24%), Positives = 102/245 (41%), Gaps = 29/245 (11%)

Query: 445 FKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLL-----RFYN--P 497
           F D+           I + ++     G    ++GPSG GKST+  L+       F+    
Sbjct: 674 FSDIKTGLYHHQSKQILQSINATFKPGMINAIMGPSGSGKSTLLNLVSGRIESSFFAKFA 733

Query: 498 SSGQIFIDGQDISKLNIKSLRRHIG---------LVQQEPVLMSGTLR-DNITYGLTETP 547
           ++G I  +   IS+   K++  ++          L  +E    +  LR  N+T       
Sbjct: 734 TTGSIMFNDVQISEEMFKNVCSYVSQDDDHLLAKLTVRETFKFAADLRLHNLTEEQRVIK 793

Query: 548 SKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLD 607
           S E IR +  +  C N I+    G + + G     +SGG+K+R+ +   L+  P I++LD
Sbjct: 794 SDELIRALGLK-HCENNII----GNEFIKG-----ISGGEKRRVTMGIQLLNDPPIVLLD 843

Query: 608 EATSALDVESEGAINYTFGQLMKSKSVTIVSIAH--RLSTIRRSENIIVLGNDGSVVETG 665
           E TS LD  +   I     +L      TI+   H  R    ++  N+++L   G     G
Sbjct: 844 EPTSGLDSFTSATILEILKKLSVEYGKTIIITIHQPRSELFKQFGNVLLLAKSGRTAFNG 903

Query: 666 KFKEL 670
              E+
Sbjct: 904 SPNEM 908

>NCAS0B01530 Chr2 complement(249743..252349) [2607 bp, 868 aa] {ON}
           Anc_8.661
          Length = 868

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 100/200 (50%), Gaps = 27/200 (13%)

Query: 471 GSNVCVVGPSGRGKSTIALLLLRF---YNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQE 527
           GS++ ++GP+  GK++I  ++      YN  +G + I  +D           ++  V Q+
Sbjct: 637 GSSLLILGPNSCGKTSIQRIIAEIWPIYN-KNGLLSIPAED-----------NLFCVPQK 684

Query: 528 PVLM-SGTLRDNITYGLTETPSKE----EIRMVAKQCFCH-NFIVKFPHGYDTV--IGPQ 579
           P     GTLRD I Y ++     +    + ++V      H ++++K   G+  +  +   
Sbjct: 685 PYFTRGGTLRDQIIYPMSSDEFYDRGIKDAQLVQIMAEVHLDYLLKRGTGFSYLDNVADW 744

Query: 580 GALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSI 639
             +LSGG+KQR+  AR L  KP  +VLDEAT+A+  + E   ++ F  ++K      ++I
Sbjct: 745 KDVLSGGEKQRMNFARILFHKPRFVVLDEATNAISADME---DHLFN-ILKKYRFNFITI 800

Query: 640 AHRLSTIRRSENIIVLGNDG 659
           + R + I   + ++ +  +G
Sbjct: 801 SQRPALIEYHDLLLEILEEG 820

>ZYRO0B05588g Chr2 (440556..444368) [3813 bp, 1270 aa] {ON} similar
           to uniprot|Q08234 Saccharomyces cerevisiae YOL075C
           Hypothetical ORF
          Length = 1270

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 103/230 (44%), Gaps = 29/230 (12%)

Query: 460 IFRDMDIKIPAGSNVCVVGPSGRGKSTI---------ALLLLRFYNPSSGQIFIDGQDIS 510
           I +D++     G    ++GPSG GKS++         + LL++F+  S+G I ++   IS
Sbjct: 687 ILQDVNAVFKPGMINAIMGPSGSGKSSLLNLISGRSNSSLLVKFH--STGSILLNTNSIS 744

Query: 511 KLNIKSLRRHIGLVQQEPVLMSGTLRDNITYG-------LTETPSKEEIRMVAKQCFCHN 563
           K   KS+  ++     + +L S T+R+   +        +T    + +I  +        
Sbjct: 745 KEMFKSVCSYVS-QDDDHLLASLTVRETFEFAAALRLHYMTSQQRRSKIDEIL------- 796

Query: 564 FIVKFPHGYDTVIGPQGAL-LSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAIN 622
             +   H  +TVIG +    +SGG+K+R+ I   L+    IL+LDE TS LD  +  AI 
Sbjct: 797 LALGLTHCENTVIGNEFVKGISGGEKRRVTIGVQLLNNSPILLLDEPTSGLDSFTSAAIL 856

Query: 623 YTFGQLMKSKSVTIVSIAH--RLSTIRRSENIIVLGNDGSVVETGKFKEL 670
                L      T++   H  R    ++  ++++L   G     G   E+
Sbjct: 857 EILENLCTEDGKTVIITIHQPRSELFQKFGHVLLLARSGRAAFNGSPNEM 906

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/233 (24%), Positives = 108/233 (46%), Gaps = 12/233 (5%)

Query: 446 KDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPS---SGQI 502
           ++VT S  ++   V+     + +P+GS + V+G SG GK+T+  +L    +      G+I
Sbjct: 24  RNVTIS-ASKTNKVLVNSFSVDLPSGSVMAVMGGSGSGKTTLLNVLASKVSKGLQLDGEI 82

Query: 503 FIDGQDISKLNIKSLRRHIGLVQQEPVLMSG-TLRDN--ITYGLTETPSKEEIRMVAKQC 559
               +D S+         +  + Q  VL +  T R+   I   L    S E+   +  Q 
Sbjct: 83  HYALEDNSEHFNADTEASMAYLPQHDVLPARLTCRETLMIAADLKLKSSLEKKNEIVDQL 142

Query: 560 FCHNFIVKFPHGYDTVIG-PQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESE 618
                 +      +T++G  +   LSGG+K+R+++A  L+  P+ + LDE T+ LD  S 
Sbjct: 143 LLE---LGLRDCANTLVGDARNRGLSGGEKRRLSVATQLVSNPSFMFLDEPTTGLDAYSA 199

Query: 619 GAINYTFGQLMKS-KSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKEL 670
             +  +  +L +  +   I+S+    S I    + + + + G+VV  GK  E+
Sbjct: 200 FLLVKSLKKLARDGQKSFIMSVHQPRSDIMFLLDSVCILSKGNVVYCGKTTEM 252

>TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1595

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 98/201 (48%), Gaps = 20/201 (9%)

Query: 460  IFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPS--SGQIFIDGQDISKLNIKSL 517
            I  ++D  +  G+   ++G SG GK+T+   L         +G +FIDG    K   +S 
Sbjct: 969  ILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDVFIDG----KPRDESF 1024

Query: 518  RRHIGLVQQEPV-LMSGTLRDNITY-GLTETPSKEEIRMVAKQCFCHNFI--VKFPHGYD 573
             R IG  QQ+ + L + T+R+++ +      P+  E+ +  K  +  + I  ++     D
Sbjct: 1025 PRSIGYCQQQDLHLKTATVRESLRFSAYLRQPA--EVSIAEKNAYVEDIIKILEMEKYAD 1082

Query: 574  TVIGPQGALLSGGQKQRIAIARALIKKPTILV-LDEATSALDVESEGAINYTFGQLMK-- 630
             ++G  G  L+  Q++R+ I   L  KP +LV LDE TS LD ++  AI     QLM+  
Sbjct: 1083 AIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAI----CQLMRKL 1138

Query: 631  -SKSVTIVSIAHRLSTIRRSE 650
             ++   I+   H+ S I   E
Sbjct: 1139 CNQGQAILCTIHQPSAILMQE 1159

>YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}
           ARB1ATPase of the ATP-binding cassette (ABC) family
           involved in 40S and 60S ribosome biogenesis, has
           similarity to Gcn20p; shuttles from nucleus to
           cytoplasm, physically interacts with Tif6p, Lsg1p
          Length = 610

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/241 (23%), Positives = 104/241 (43%), Gaps = 54/241 (22%)

Query: 443 IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI 502
           + F D++F Y + P   ++  ++  +   S + +VGP+G GKST+  ++     P SG++
Sbjct: 393 LAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 503 --------------FIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPS 548
                           D  D++K  ++ +R     + Q+     G L     YGLT    
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQFWRGQLG---RYGLT---- 505

Query: 549 KEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDE 608
                                 G    +  Q A LS GQ+ R+  A   +++P +L+LDE
Sbjct: 506 ----------------------GEGQTV--QMATLSEGQRSRVVFALLALEQPNVLLLDE 541

Query: 609 ATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGN------DGSVV 662
            T+ LD+ +  ++     +   +  V +VS   RL   + +++I V+ N      DGS++
Sbjct: 542 PTNGLDIPTIDSLADAINEF--NGGVVVVSHDFRLLD-KIAQDIFVVENKTATRWDGSIL 598

Query: 663 E 663
           +
Sbjct: 599 Q 599

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 81/170 (47%), Gaps = 10/170 (5%)

Query: 457 GNVIFRDMDIKIPAGSNVCVVGPSGRGKSTI--ALLLLRFYNPSSGQIFI-----DGQDI 509
           G V+ +D  +++  G    ++G +G GKST   AL    +  P    I++     +  ++
Sbjct: 93  GKVLIQDSGLELNYGRRYGLLGENGCGKSTFLKALATREYPIPEHIDIYLLDEPAEPSEL 152

Query: 510 SKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCF-CHNFIVKF 568
           S L+         L + E ++    L D     L E P  E +  +    F     I+  
Sbjct: 153 SALDYVVTEAQHELKRIEDLVEKTILEDGPESELLE-PLYERMDSLDPDTFESRAAIILI 211

Query: 569 PHGYDT-VIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVES 617
             G++   I  +   +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+
Sbjct: 212 GLGFNKKTILKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>Suva_2.583 Chr2 (1030711..1035324) [4614 bp, 1537 aa] {ON} YDR406W
            (REAL)
          Length = 1537

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/241 (26%), Positives = 114/241 (47%), Gaps = 25/241 (10%)

Query: 440  KGEIVF--KDVTFSYPTRPGNV-IFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYN 496
            K E +F  +D+ +  P + G   I  ++D  +  G+   ++G SG GK+T+   L     
Sbjct: 886  KSEAIFHWRDLCYDVPVKGGERRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVT 945

Query: 497  PS--SGQIFIDGQDISKLNIKSLRRHIGLVQQEPV-LMSGTLRDNITY-GLTETPSKEEI 552
                +G IF+DG    +L  +S  R IG  QQ+ + L + T+R+++ +      PS   +
Sbjct: 946  MGVITGNIFVDG----RLRDESFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPS--SV 999

Query: 553  RMVAKQCFCHNF--IVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILV-LDEA 609
             +  K  +      I++     D V+G  G  L+  Q++R+ I   L  +P +LV LDE 
Sbjct: 1000 SLEEKDKYVEEVIKILEMEKYSDAVVGVAGEGLNVEQRKRLTIGVELAARPKLLVFLDEP 1059

Query: 610  TSALDVESEGAINYTFGQLMK---SKSVTIVSIAHRLSTI--RRSENIIVLGNDGSVVET 664
            TS LD ++     +   QLM+   +    I+   H+ S I  ++ + ++ L   G  V  
Sbjct: 1060 TSGLDSQTA----WDTCQLMRKLATHGQAILCTIHQPSAILMQQFDRLLFLQRGGQTVYF 1115

Query: 665  G 665
            G
Sbjct: 1116 G 1116

>ZYRO0B14762g Chr2 (1201028..1205575) [4548 bp, 1515 aa] {ON} similar
            to uniprot|P32568 Saccharomyces cerevisiae YDR011W SNQ2
            ABC transporter
          Length = 1515

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 115/238 (48%), Gaps = 13/238 (5%)

Query: 440  KGEIVFKDVTFSYPTRPGNVIFRD-MDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPS 498
            KG  +++DV +  P +    I  D +   +  G+   ++G SG GK+T+   L +  N  
Sbjct: 866  KGVFIWQDVRYVIPYQGTEKILLDNVTGYVAPGTMTALMGESGAGKTTLLNTLAKRANVG 925

Query: 499  --SGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSG-TLRDNITYG--LTETPSKEEIR 553
              +G + I+G+ +      S  R  G VQQ+ + ++  T+R+++ +   L    S  +  
Sbjct: 926  IVTGDMSINGKPVD----SSFERRTGYVQQQDIHIAEMTVRESLVFSARLRRPQSIPDAE 981

Query: 554  MVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILV-LDEATSA 612
             VA        +    +G D ++G  GA L+  Q+++++I   L+ KP +L+ LDE TS 
Sbjct: 982  KVADAETVMKLLDMEEYG-DALVGGLGAGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSG 1040

Query: 613  LDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTI-RRSENIIVLGNDGSVVETGKFKE 669
            LD +S  AI     ++ K+    + +I    +T+  + + +++L   G  V  G   E
Sbjct: 1041 LDSQSSWAIVQLLRRIAKAGQCILCTIHQPSATLFEQFDRLLLLKKGGQTVYFGDIGE 1098

>Kwal_0.327 s0 complement(154643..157702) [3060 bp, 1019 aa] {ON}
           YCR011C (ADP1) - Active transport ATPase [contig 86]
           FULL
          Length = 1019

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/235 (27%), Positives = 116/235 (49%), Gaps = 14/235 (5%)

Query: 440 KGEIVFKDVTFSYPTRPGN-VIFRDMDIKIPAGSNVCVVGPSGRGKSTIA--LLLLRFYN 496
           K  + F+++ ++  +  G  +I   +   +  G  + ++G SG GK+T+   L +     
Sbjct: 363 KSTLTFENIEYNIRSEKGERMILNGISGSVKPGEIMALMGGSGAGKTTLLDILAMKDKAG 422

Query: 497 PSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLM-SGTLRDNI-TYGLTETPSKEEIRM 554
            +SG I I+G +I+K N   L +  G V QE  L+ + T+ + +    L   P K  +  
Sbjct: 423 KASGSIKINGSEITKQN---LSKIAGFVDQENFLLPTLTVYETVLNSALLRLPRK--LSF 477

Query: 555 VAKQCFCHNFI--VKFPHGYDTVIGPQGAL-LSGGQKQRIAIARALIKKPTILVLDEATS 611
           V KQ   +  +  ++     D +IG      +SGG+K+R++IA  L+  P++L LDE TS
Sbjct: 478 VQKQKRVYQVLEELRILDIKDRIIGDDLERGISGGEKRRVSIACELVTSPSVLFLDEPTS 537

Query: 612 ALDVESEGAINYTFGQL-MKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETG 665
            LD  +   +     +L +      I+SI    S I +S + +VL + G +V +G
Sbjct: 538 GLDSNNANNVIECLVRLALHYNRTLILSIHQPRSNIFKSFDKLVLLSQGEMVFSG 592

>Ecym_8014 Chr8 (37756..42309) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR326WABR125C/AGL142C/ABR126W
          Length = 1517

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 62/236 (26%), Positives = 112/236 (47%), Gaps = 27/236 (11%)

Query: 445  FKDVTFSYPTRPGN-VIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPS--SGQ 501
            +++V +S   +  N +I   +D  +  G+   ++G SG GK+T+   L         +G 
Sbjct: 870  WRNVCYSVKIKDENRLILDHVDGWVKPGTLTALMGASGAGKTTLLDCLASRVTTGVLTGS 929

Query: 502  IFIDGQDISKLNIKSLRRHIGLVQQEPVLMS-GTLRDNITYGL-----TETPSKEEIRMV 555
            +F++G     L  KS  R IG  QQ+ + +S  T+++++ +        + P +E+ R V
Sbjct: 930  MFVNG----NLRDKSFPRSIGYCQQQDLHLSTATVKESLRFSAYLRQSADIPKEEKDRYV 985

Query: 556  AKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILV-LDEATSALD 614
             +       I+      D V+G  G  L+  Q++R+ I   L+ KP +L+ LDE TS LD
Sbjct: 986  DEVIK----ILDMEQYVDAVVGVAGEGLNVEQRKRLTIGVELVAKPKLLLFLDEPTSGLD 1041

Query: 615  VESEGAINYTFGQLMKS---KSVTIVSIAHRLSTIRRSE--NIIVLGNDGSVVETG 665
             ++  +I     QLM+S       ++   H+ S +   E   +++L   G  V  G
Sbjct: 1042 SQTAWSI----CQLMRSLADHGQAVLCTIHQPSALLMQEFDRLLLLQKHGQTVYFG 1093

>KAFR0C01200 Chr3 (240350..244171) [3822 bp, 1273 aa] {ON} Anc_3.133
           YOL075C
          Length = 1273

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 97/216 (44%), Gaps = 33/216 (15%)

Query: 476 VVGPSGRGKSTI---------ALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIG---- 522
           ++GPSG GKST+         + +  +F    SG I  +G ++S+   K++  ++     
Sbjct: 705 IMGPSGSGKSTLLNIISGRVKSSIFAKF--DKSGSIMFNGNEVSEHMFKNVCSYVSQDDD 762

Query: 523 -----LVQQEPVLMSGTLR-DNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVI 576
                L  +E    +  LR  N+TY    T + E IR +  +  C N I+    G + V 
Sbjct: 763 HLLSKLTVKETFKFAADLRLHNMTYEQRSTKTDELIRALGLK-HCENNII----GDEFVK 817

Query: 577 GPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTI 636
           G     +SGG+K+R+ +   L   P I++LDE TS LD  +   I     +L  +   TI
Sbjct: 818 G-----ISGGEKRRVTMGIQLQNDPPIILLDEPTSGLDSFTSSTILEILKKLAVNYGKTI 872

Query: 637 VSIAH--RLSTIRRSENIIVLGNDGSVVETGKFKEL 670
           +   H  R    ++  N+++L   G     G   E+
Sbjct: 873 ILTIHQPRAELFKQFGNVLLLAKSGRTAFNGSPNEM 908

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 92/205 (44%), Gaps = 23/205 (11%)

Query: 454 TRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKL- 512
           ++ G  +     I + +GS + V+G SG GK+T   LL    +  SG + ++G DI  + 
Sbjct: 30  SKSGKQLIDSFSIDLHSGSVMAVMGGSGSGKTT---LLNVLASKISGGLTVEG-DIKYVL 85

Query: 513 ---------NIKSLRRHIGLV---QQEPVLMSGTLRDNITYG--LTETPSKEEIRMVAKQ 558
                    +  S+  H+ +    QQ+ +    T R+ +     L    SK+E   +  Q
Sbjct: 86  EENNGMMDDDDSSIEEHVKMAYLPQQDILPARLTCRETLMCAADLKLNKSKQEKINIVNQ 145

Query: 559 CFCHNFIVKFPHGYDTVIG-PQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVES 617
                  +      DT++G  +   LSGG+K+R++I   ++  P+I+ LDE T+ LD  S
Sbjct: 146 LIDE---LGLKDCADTLVGDSKHKGLSGGEKRRLSIGTQMVSNPSIMFLDEPTTGLDSYS 202

Query: 618 EGAINYTFGQLMKSKSVTIVSIAHR 642
              +  T  +L K      +   H+
Sbjct: 203 AYLVIKTIKKLAKDDGRIFIMSIHQ 227

>Smik_4.244 Chr4 (445916..450421) [4506 bp, 1501 aa] {ON} YDR011W
            (REAL)
          Length = 1501

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 62/240 (25%), Positives = 113/240 (47%), Gaps = 20/240 (8%)

Query: 437  VPGKGEIVFKDVTFSYPTRPGNVIFRD--MDIKIPAGSNVCVVGPSGRGKST-IALLLLR 493
            +  KG  ++KDV F+ P   G  +  D      IP G+   ++G SG GK+T +  L  R
Sbjct: 847  LEAKGVFIWKDVCFTIPYEGGKRMLLDNVSGYCIP-GTMTALMGESGAGKTTLLNTLAQR 905

Query: 494  FYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSG-TLRDNITYGL-----TETP 547
                 +G + ++G+ I      S  R  G VQQ+ + ++  T+R+++ +          P
Sbjct: 906  NVGIITGDMLVNGRPID----ASFERRTGYVQQQDIHIAELTVRESLQFSARMRRPQSLP 961

Query: 548  SKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILV-L 606
              E++  V K       ++      + ++G  G  L+  Q+++++I   L+ KP +L+ L
Sbjct: 962  DCEKMDYVEKII----RVLGMEEYAEALVGEVGCGLNVEQRKKLSIGVELVAKPDLLLFL 1017

Query: 607  DEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTI-RRSENIIVLGNDGSVVETG 665
            DE TS LD +S  AI     +L K+    + +I    +T+    + +++L   G  V  G
Sbjct: 1018 DEPTSGLDSQSSWAIIQLLRKLSKAGQSILCTIHQPSATLFEEFDRLLLLRKGGQTVYFG 1077

>Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 80/187 (42%), Gaps = 45/187 (24%)

Query: 443 IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI 502
           + F D++F Y + P   ++ +++  +   S + +VGP+G GKST+  ++     P SG++
Sbjct: 393 LAFDDISFHYESNPSENLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 503 --------------FIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPS 548
                           D  D++K  ++ +R     V Q+     G L     YGLT    
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPSVSQDFQYWRGQLG---RYGLT---- 505

Query: 549 KEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDE 608
                                 G    +  Q A LS GQ+ R+  A   +++P +L+LDE
Sbjct: 506 ----------------------GEGQTV--QMATLSEGQRSRVVFALLALEQPNVLLLDE 541

Query: 609 ATSALDV 615
            T+ LD+
Sbjct: 542 PTNGLDI 548

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 82/170 (48%), Gaps = 10/170 (5%)

Query: 457 GNVIFRDMDIKIPAGSNVCVVGPSGRGKSTI--ALLLLRFYNPSSGQIFI-----DGQDI 509
           G V+ +D  +++  G    ++G +G GKST   AL    +  P    I++     +  ++
Sbjct: 93  GKVLIQDSGLELNYGRRYGLLGENGCGKSTFLKALATREYPIPEPIDIYLLDEPAEPSEL 152

Query: 510 SKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCF-CHNFIVKF 568
           S L+         L + E ++    L D     L E P  E +  +    F     I+  
Sbjct: 153 SALDYVVTEAQNELKRIEDLVEKTILEDGPESELLE-PLYERMDSLDPDTFESRAAIILI 211

Query: 569 PHGYD-TVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVES 617
             G++ T I  +   +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+
Sbjct: 212 GLGFNKTTILKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>NCAS0E00480 Chr5 (81549..83381) [1833 bp, 610 aa] {ON} 
          Length = 610

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 57/241 (23%), Positives = 104/241 (43%), Gaps = 54/241 (22%)

Query: 443 IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI 502
           + F  ++FSY   P N ++ ++D  +   S + +VGP+G GKST+  ++     P SG++
Sbjct: 393 LAFDSISFSYDGNPENNLYENLDFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 503 --------------FIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPS 548
                           D  D++K  ++ +R     + Q+     G L     YGLT    
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPNISQDFQYWRGQLG---RYGLT---- 505

Query: 549 KEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDE 608
                                 G    +  Q   LS GQ+ R+  A   +++P +L+LDE
Sbjct: 506 ----------------------GEGQTV--QMGTLSEGQRSRVVFALLALEQPNVLLLDE 541

Query: 609 ATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGN------DGSVV 662
            T+ LD+ +  ++     +   +  V +VS   RL   + +++I V+ N      +GS++
Sbjct: 542 PTNGLDIPTIDSLAEAINEF--NGGVVVVSHDFRLLD-KIAKDIFVVENKTATRWNGSIL 598

Query: 663 E 663
           E
Sbjct: 599 E 599

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 78/169 (46%), Gaps = 8/169 (4%)

Query: 457 GNVIFRDMDIKIPAGSNVCVVGPSGRGKSTI--ALLLLRFYNPSSGQIFIDGQDISKLNI 514
           G V+ +D  +++  G    ++G +G GKST   AL    +  P +  I++  +       
Sbjct: 93  GKVLIQDSQLELNYGRRYGLLGENGCGKSTFLKALATREYPIPENIDIYLLDEPAEPSEY 152

Query: 515 KSLRRHIGLVQQEPVLMSGTLRDNITYGLTET----PSKEEIRMVAKQCF-CHNFIVKFP 569
            +L   +   Q E   +   +   I     E     P  E +  +    F     ++   
Sbjct: 153 SALEYVVREAQNELKRLEDLVEKYIVEEGPECELLEPLYERMDSLDPDTFESRAAVILIG 212

Query: 570 HGYDT-VIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVES 617
            G+++  I  +   +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+
Sbjct: 213 LGFNSKTILKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar to
           Ashbya gossypii AFR232C
          Length = 609

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 80/187 (42%), Gaps = 45/187 (24%)

Query: 443 IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI 502
           + F +++FSY  +P N ++ +++  +   S V +VGP+G GKST+  ++     P  G++
Sbjct: 392 LAFDEISFSYDEKPENNLYENLNFGVDMDSRVALVGPNGVGKSTLLKIMTGELTPQGGRV 451

Query: 503 --------------FIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPS 548
                           D  D++K  ++ +R   G + ++     G L     YGLT    
Sbjct: 452 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYGHISEDFQYWRGQLG---RYGLT---- 504

Query: 549 KEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDE 608
                                 G    +  Q   LS GQ+ R+  A   + +P +L+LDE
Sbjct: 505 ----------------------GEGQTV--QMGTLSEGQRSRVVFALLALDQPNVLLLDE 540

Query: 609 ATSALDV 615
            T+ LD+
Sbjct: 541 PTNGLDI 547

 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 29/35 (82%)

Query: 583 LSGGQKQRIAIARALIKKPTILVLDEATSALDVES 617
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+
Sbjct: 226 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 260

>KLLA0A10857g Chr1 complement(941784..944042) [2259 bp, 752 aa] {ON}
           highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 61/222 (27%), Positives = 100/222 (45%), Gaps = 31/222 (13%)

Query: 443 IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI 502
           I  +DV+FSY  +  + +  D+++ +   S + +VG +G GK+T+  +++    P+ G  
Sbjct: 532 IQLQDVSFSY--KESDPLLTDVNLDVQMDSRISLVGANGCGKTTLLKVMMEQLRPTKG-- 587

Query: 503 FIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSK--EEIRMVAKQCF 560
           F+          ++ R  IG   Q  V      +  + +  T  P K  EE R       
Sbjct: 588 FVS---------RNPRLRIGYFTQHHVDSMDLNQSAVDWMSTAFPGKTDEEYR------- 631

Query: 561 CHNFIVKFPHGYDTVIGPQG-ALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEG 619
               +  F  G    +G Q   LLSGGQK R+A A   +  P ILVLDE ++ LD     
Sbjct: 632 --RHLGAF--GISGSLGIQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTAGLD 687

Query: 620 AINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSV 661
           A+       +KS +  ++ ++H +S I    N I +   G V
Sbjct: 688 AL----VDALKSFNGGVLMVSHDISVINSVCNEIWVSEGGKV 725

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 583 LSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAH 641
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T++ ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLVVSH 422

>Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 79/187 (42%), Gaps = 45/187 (24%)

Query: 443 IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI 502
           + F D++F Y + P   ++  ++  +   S + +VGP+G GKST+  ++     P SG++
Sbjct: 393 LAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 503 --------------FIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPS 548
                           D  D++K  ++ +R     + Q+     G L     YGLT    
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQFWRGQLG---RYGLT---- 505

Query: 549 KEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDE 608
                                 G    +  Q A LS GQ+ R+  A   +++P +L+LDE
Sbjct: 506 ----------------------GEGQTV--QMATLSEGQRSRVVFALLALEQPNVLLLDE 541

Query: 609 ATSALDV 615
            T+ LD+
Sbjct: 542 PTNGLDI 548

 Score = 48.5 bits (114), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 81/170 (47%), Gaps = 10/170 (5%)

Query: 457 GNVIFRDMDIKIPAGSNVCVVGPSGRGKSTI--ALLLLRFYNPSSGQIFI-----DGQDI 509
           G V+ +D  +++  G    ++G +G GKST   AL    +  P    I++     +  ++
Sbjct: 93  GKVLIQDSGLELNYGRRYGLLGENGCGKSTFLKALATREYPIPEHIDIYLLDEPAEPSEL 152

Query: 510 SKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCF-CHNFIVKF 568
           S L+         L + E ++    L D     L E P  E +  +    F     I+  
Sbjct: 153 SALDYVVTEAQNELKRIEDLVEKTILEDGPESELLE-PLYERMDSLDPDTFESRAAIILI 211

Query: 569 PHGYDT-VIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVES 617
             G++   I  +   +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+
Sbjct: 212 GLGFNKKTILKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {ON}
           highly similar to uniprot|P40024 Saccharomyces
           cerevisiae YER036C
          Length = 610

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 52/242 (21%), Positives = 105/242 (43%), Gaps = 56/242 (23%)

Query: 443 IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI 502
           + F +++F+Y   P + ++ +++  +   S + +VGP+G GKST+  ++     P +G++
Sbjct: 393 LAFDEISFAYDGNPEHNLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGDLTPQAGRV 452

Query: 503 --------------FIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPS 548
                           D  D++K  ++ +R     + Q+     G L     YGLT    
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVREKYSHISQDFQYWRGQLG---RYGLTGDGQ 509

Query: 549 KEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDE 608
           K                             Q   LS GQ+ R+  A   ++ P IL+LDE
Sbjct: 510 K----------------------------AQMGTLSEGQRSRVVFALLALQAPNILLLDE 541

Query: 609 ATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRR-SENIIVLGN------DGSV 661
            T+ LD+ +  ++     + + + +  +V ++H    + + +++I V+ N      DGS+
Sbjct: 542 PTNGLDIPTIDSL----AEAINTFNGGVVVVSHDFRLLDKIAQDIFVVENKTAYRWDGSI 597

Query: 662 VE 663
           +E
Sbjct: 598 LE 599

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 29/35 (82%)

Query: 583 LSGGQKQRIAIARALIKKPTILVLDEATSALDVES 617
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>AGL142C Chr7 complement(434247..438740) [4494 bp, 1497 aa] {ON}
            Non-syntenic homolog of Saccharomyces cerevisiae YPL058C
            (PDR12)
          Length = 1497

 Score = 58.9 bits (141), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 59/218 (27%), Positives = 100/218 (45%), Gaps = 14/218 (6%)

Query: 460  IFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPS--SGQIFIDGQDISKLNIKSL 517
            I  ++D  +  G+   ++G SG GK+T+  +L         +G IF+DG     L   S 
Sbjct: 860  ILTNVDGWVKPGTLTALMGYSGAGKTTLLDVLANRVRVGVVTGNIFVDGH----LRDTSF 915

Query: 518  RRHIGLVQQEPVL-MSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFI--VKFPHGYDT 574
            +R  G  QQ+ +   + T+RD + +        + I    K  +  + I  +      D 
Sbjct: 916  QRKTGYCQQQDLHGRTQTVRDALKFS-AYLRQPQSISRAEKNAYVEDIIKLLGMEAYADA 974

Query: 575  VIGPQGALLSGGQKQRIAIARALIKKPTILV-LDEATSALDVESEGAINYTFGQLMKSKS 633
            V+G  G  L+  Q++R+ I   L+ KP +L+ LDE TS LD ++  +I     +L+    
Sbjct: 975  VVGVTGEGLNVEQRKRLTIGVELVAKPELLLFLDEPTSGLDSQTAWSICQLIKKLVNHGQ 1034

Query: 634  VTIVSIAHRLSTIRRSE--NIIVLGNDGSVVETGKFKE 669
              + +I H+ S I   E   +++L N G  V  G   E
Sbjct: 1035 AILCTI-HQPSAILMQEFDRLLLLSNGGRTVYFGPLGE 1071

>Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 58.5 bits (140), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 79/187 (42%), Gaps = 45/187 (24%)

Query: 443 IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI 502
           + F D++F Y + P   ++  ++  +   S + +VGP+G GKST+  ++     P SG++
Sbjct: 393 LAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 503 --------------FIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPS 548
                           D  D++K  ++ +R     + Q+     G L     YGLT    
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQFWRGQLG---RYGLT---- 505

Query: 549 KEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDE 608
                                 G    +  Q A LS GQ+ R+  A   +++P +L+LDE
Sbjct: 506 ----------------------GEGQTV--QMATLSEGQRSRVVFALLALEQPNVLLLDE 541

Query: 609 ATSALDV 615
            T+ LD+
Sbjct: 542 PTNGLDI 548

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 81/170 (47%), Gaps = 10/170 (5%)

Query: 457 GNVIFRDMDIKIPAGSNVCVVGPSGRGKSTI--ALLLLRFYNPSSGQIFI-----DGQDI 509
           G V+ +D  +++  G    ++G +G GKST   AL    +  P    I++     +  ++
Sbjct: 93  GKVLIQDSGLELNYGRRYGLLGENGCGKSTFLKALATREYPIPEPIDIYLLDEPAEPSEL 152

Query: 510 SKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCF-CHNFIVKF 568
           S L+         L + E ++    L D     + E P  E +  +    F     I+  
Sbjct: 153 SALDYVVTEAQNELKRIEDLVEKTILEDGPESEILE-PLYERMDSLDPDTFESRAAIILI 211

Query: 569 PHGYD-TVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVES 617
             G++   I  +   +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+
Sbjct: 212 GLGFNKNTILKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_5.500
            YDR406W
          Length = 1499

 Score = 58.5 bits (140), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 65/252 (25%), Positives = 118/252 (46%), Gaps = 24/252 (9%)

Query: 431  TTGKKFVPGKGEIVFKDVTFSYPTRPGNV-IFRDMDIKIPAGSNVCVVGPSGRGKSTIAL 489
            T G + +  +    ++++ +  P + G   +  ++D  +  G+   ++G SG GK+T+  
Sbjct: 839  TNGARLLKSQAVFHWRNLCYDIPIKHGTRRLLDNVDGWVKPGTLTALMGASGAGKTTLLD 898

Query: 490  LLLRFYNPS--SGQIFIDGQDISKLNIKSLRRHIGLVQQEPV-LMSGTLRDNITY-GLTE 545
             L         +G + +DG+   +    S  R IG  QQ+ + L + T+R+++ +     
Sbjct: 899  CLAERVTMGVITGDVLVDGRPRDE----SFPRSIGYCQQQDLHLKTSTVRESLRFSAYLR 954

Query: 546  TPSKEEIRMVAKQCFCHNFI--VKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTI 603
             P+  E+ +  K  +    I  ++     D V+G  G  L+  Q++R+ I   L  KP +
Sbjct: 955  QPA--EVSVEEKDAYVEEVIKILEMEKYADAVVGVAGEGLNVEQRKRLTIGVELAAKPKL 1012

Query: 604  LV-LDEATSALDVESEGAINYTFGQLMK---SKSVTIVSIAHRLSTIRRSE-NIIVLGND 658
            LV LDE TS LD ++  +I     QLM+   S    I+   H+ S I   E + ++   D
Sbjct: 1013 LVFLDEPTSGLDSQTAWSI----CQLMRKLASHGQAILCTIHQPSAILMQEFDRLLFLQD 1068

Query: 659  GSVVETGKFKEL 670
            G   +T  F EL
Sbjct: 1069 GG--QTTYFGEL 1078

>Skud_6.95 Chr6 complement(175462..177720) [2259 bp, 752 aa] {ON}
           YFR009W (REAL)
          Length = 752

 Score = 58.2 bits (139), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 86/211 (40%), Gaps = 46/211 (21%)

Query: 443 IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI 502
           I  +DV F Y  +  N++  D+++ +   S + +VG +G GK+T+               
Sbjct: 532 IQLQDVFFGYDEK--NLLLEDVNLDVQMDSRIALVGANGCGKTTLL-------------- 575

Query: 503 FIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCH 562
                   K+ ++ LR   G V + P L  G    +    +  T S       A      
Sbjct: 576 --------KIMMEQLRPLKGFVSRNPRLRIGYFTQHHVDSMDLTTS-------AVDWMSR 620

Query: 563 NFIVKFPHGYDTVIGPQG----------ALLSGGQKQRIAIARALIKKPTILVLDEATSA 612
           +F  K    Y   +G  G           LLSGGQK R+A A   +  P ILVLDE ++ 
Sbjct: 621 SFPGKTDEEYRRHLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 613 LDVESEGAI-----NYTFGQLMKSKSVTIVS 638
           LD     A+     N+  G LM S  ++++ 
Sbjct: 681 LDTTGLDALVDALKNFNGGVLMVSHDISVID 711

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 583 LSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAH 641
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPNTVLTVSH 422

>KAFR0E03460 Chr5 complement(695361..700001) [4641 bp, 1546 aa] {ON} 
          Length = 1546

 Score = 58.2 bits (139), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 63/219 (28%), Positives = 102/219 (46%), Gaps = 24/219 (10%)

Query: 460  IFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPS--SGQIFIDGQDISKLNIKSL 517
            +  ++D  +  G+   ++G SG GK+T+   L         +G IF+DG    +L  +S 
Sbjct: 921  LLSNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGNIFVDG----RLRDESF 976

Query: 518  RRHIGLVQQEPV-LMSGTLRDNITYGLT----ETPSKEEIRMVAKQCFCHNFIVKFPHGY 572
             R IG  QQ+ + L + T+R+++ +        + SKEE     +Q      I++     
Sbjct: 977  PRSIGYCQQQDLHLKTATVRESLRFSAYLRQPASVSKEEKDHYVEQVIK---ILEMETYA 1033

Query: 573  DTVIGPQGALLSGGQKQRIAIARALIKKPTILV-LDEATSALDVESEGAINYTFGQLMK- 630
            D V+G  G  L+  Q++R+ I   L  KP +LV LDE TS LD ++  A      QLM+ 
Sbjct: 1034 DAVVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAT----CQLMRK 1089

Query: 631  --SKSVTIVSIAHRLSTIRRSE--NIIVLGNDGSVVETG 665
              +    I+   H+ S I   E   ++ L   G  V  G
Sbjct: 1090 LANHGQAILCTIHQPSAILMQEFDRLLFLQKGGQTVYFG 1128

>ZYRO0A04114g Chr1 complement(328582..333138) [4557 bp, 1518 aa] {ON}
            similar to uniprot|P32568 Saccharomyces cerevisiae
            YDR011W SNQ2 ABC transporter
          Length = 1518

 Score = 58.2 bits (139), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 57/244 (23%), Positives = 116/244 (47%), Gaps = 25/244 (10%)

Query: 440  KGEIVFKDVTFSYPTRPGN-VIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPS 498
            KG  ++K++ +  P + G   +  ++   +  G+   ++G SG GK+T+   L +  N  
Sbjct: 869  KGIFIWKNICYVIPYKGGERTLLDNVTGYVAPGTMTALMGESGAGKTTLLNTLAKRVNVG 928

Query: 499  --SGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSG-TLRDNITYGL-----TETPSKE 550
              +G + I+G+ +      S  R  G VQQ+ + ++  T+R+++ +          P  E
Sbjct: 929  VVTGDMLINGKPVD----SSFERRTGYVQQQDIHIAEMTVRESLIFSARLRRPQSIPDAE 984

Query: 551  EI---RMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILV-L 606
            ++     V K       ++      D ++G  GA L+  Q+++++I   L+ KP +L+ L
Sbjct: 985  KVADAETVMK-------LLDMEEYADALVGGLGAGLNVEQRKKLSIGVELVSKPDLLLFL 1037

Query: 607  DEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTI-RRSENIIVLGNDGSVVETG 665
            DE TS LD +S  AI     ++ ++    + +I    +T+  + + +++L   G  V  G
Sbjct: 1038 DEPTSGLDSQSSWAIVQLLKRISRAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFG 1097

Query: 666  KFKE 669
               E
Sbjct: 1098 DIGE 1101

>TPHA0D04700 Chr4 (1026978..1031510) [4533 bp, 1510 aa] {ON} 
          Length = 1510

 Score = 57.8 bits (138), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 60/217 (27%), Positives = 101/217 (46%), Gaps = 18/217 (8%)

Query: 460  IFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPS--SGQIFIDG--QDISKLNIK 515
            I  ++D  +  G+   ++G SG GK+T+   L         +G IF+DG  +D S     
Sbjct: 886  ILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAERVTMGVITGDIFVDGLPRDTS----- 940

Query: 516  SLRRHIGLVQQEPV-LMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFI--VKFPHGY 572
               R IG  QQ+ + L + T+R+++ +   E     ++ +  K  +    I  ++     
Sbjct: 941  -FPRSIGYCQQQDLHLTTATVRESLRFS-AELRQPADVSVSEKHAYVEEVIKILEMEKYA 998

Query: 573  DTVIGPQGALLSGGQKQRIAIARALIKKPTILV-LDEATSALDVESEGAINYTFGQLMKS 631
            D V+G  G  L+  Q++R+ I   L  KP +LV LDE TS LD ++  +I     +L K 
Sbjct: 999  DAVVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSICQLMKKLAKF 1058

Query: 632  KSVTIVSIAHRLSTIRRSE--NIIVLGNDGSVVETGK 666
                + +I H+ S I   E   ++ L   G  V  G+
Sbjct: 1059 GQAILCTI-HQPSAILMQEFDRLLFLQKGGKTVYFGE 1094

>Ecym_2714 Chr2 (1380718..1382964) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii AEL032W
          Length = 748

 Score = 57.4 bits (137), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 66/267 (24%), Positives = 116/267 (43%), Gaps = 56/267 (20%)

Query: 414 AATRLFELTDRVPSIKPTTGKKFVPGKGE---------IVFKDVTFSYPTRPGNVIFRDM 464
           A +R+ +L +++P ++P   +K V  K           I  ++V+F Y  +   ++ +D+
Sbjct: 492 AQSRIKKL-EKLPVLEPPEEEKSVNFKFADCEKLSPPIIQLQEVSFGYEDQ---LLLKDV 547

Query: 465 DIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLV 524
            + +   S + +VG +G GK+T+  +++    P SG  F+          ++ R  IG  
Sbjct: 548 SLDVQMDSRIALVGANGCGKTTLLKIMMEQLTPLSG--FVS---------RNPRLRIGYF 596

Query: 525 QQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQG---- 580
            Q  V       D++           ++ M +      NF  K    Y   +G  G    
Sbjct: 597 TQHHV-------DSM-----------DLTMSSVDWMSKNFPGKSDEEYRRHLGAFGITGS 638

Query: 581 ------ALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSV 634
                  LLSGGQK R+A A   +  P ILVLDE ++ LD     A+       +K+ S 
Sbjct: 639 LGLQRIQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTAGLDAL----VDALKAFSG 694

Query: 635 TIVSIAHRLSTIRRSENIIVLGNDGSV 661
            ++ ++H +S I    N I +   G+V
Sbjct: 695 GVLMVSHDISVIDSVCNEIWVSEKGTV 721

 Score = 40.0 bits (92), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 583 LSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAH 641
            SGG + R++++RAL  +P +L+LDE ++ LDV S   I Y     +K+   T++ ++H
Sbjct: 365 FSGGWRMRLSLSRALFCQPDLLLLDEPSNMLDVPS---IAY-LSNYLKTYPATVLVVSH 419

>AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR009W (GCN20)
          Length = 753

 Score = 57.4 bits (137), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 107/234 (45%), Gaps = 36/234 (15%)

Query: 443 IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI 502
           I  +DV+F Y      ++ +D+++ +   S + +VG +G GK+T+  +++    P +G +
Sbjct: 533 IQLQDVSFGYD--ESQLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPITGHV 590

Query: 503 FIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTET-PSK--EEIRMVAKQC 559
                       ++ R  IG   Q  +  S  L  +    +++T P K  EE R      
Sbjct: 591 -----------SRNPRLRIGYFTQHHI-DSMDLNASAVDWMSKTFPGKTDEEYR------ 632

Query: 560 FCHNFIVKFPHGYDTVIGPQG-ALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESE 618
                +  F  G    +G Q   LLSGGQK R+A A   +  P IL+LDE ++ LD    
Sbjct: 633 ---RHLGAF--GITGSLGLQKMQLLSGGQKSRVAFAALCLNSPHILILDEPSNHLDTAGL 687

Query: 619 GAI-----NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKF 667
            A+     N++ G LM S  ++++        I  SE+  V   DG++ +  K+
Sbjct: 688 DALVQALKNFSGGVLMVSHDISVIDSV--CDEIWVSESGTVKRFDGNIHDYKKY 739

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 39/62 (62%), Gaps = 4/62 (6%)

Query: 583 LSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHR 642
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T++ ++H 
Sbjct: 369 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLVVSHD 424

Query: 643 LS 644
            S
Sbjct: 425 RS 426

>KLLA0D04554g Chr4 complement(385733..388801) [3069 bp, 1022 aa]
           {ON} similar to uniprot|P25371 Saccharomyces cerevisiae
           YCR011C ADP1 Shows homology to ATP-dependent permeases
           Active transport ATPase
          Length = 1022

 Score = 57.8 bits (138), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 67/236 (28%), Positives = 119/236 (50%), Gaps = 21/236 (8%)

Query: 443 IVFKDVTFSYPTRPG-NV---IFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPS 498
           + F+++T  Y   P  NV   +  ++   +  G  + ++G SG GK+T+ L +L   N +
Sbjct: 370 LTFENIT--YEVSPAKNVTADVLNEVTGSVKPGEMLAIMGGSGAGKTTL-LDILAMKNKT 426

Query: 499 ---SGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLM-SGTLRDNI-TYGLTETPSKEEIR 553
              +G I ++G DI K       + IG V QE  L+ + T+ + +    L   P   ++ 
Sbjct: 427 GKVTGSIKVNGVDIDK---DKYSKIIGFVDQEDYLLPTLTVYETVLNSALLRLP--RQLS 481

Query: 554 MVAKQCFCHNFI--VKFPHGYDTVIGPQGAL-LSGGQKQRIAIARALIKKPTILVLDEAT 610
             AKQ   ++ +  ++     D VIG +    +SGG+K+R++IA  L+  P +L LDE T
Sbjct: 482 FSAKQRRVYDVLEELRIFDIRDRVIGSEYERGISGGEKRRVSIACELVTSPQVLFLDEPT 541

Query: 611 SALDVESEGAINYTFGQLMKSKSVTIV-SIAHRLSTIRRSENIIVLGNDGSVVETG 665
           S LD  +   +     +L    + T+V SI    S+I +  + +VL ++G +V +G
Sbjct: 542 SGLDANNANNVIECLVRLANHYNKTLVLSIHQPRSSIFQLFDKLVLLSNGKMVYSG 597

>NCAS0A12060 Chr1 (2388467..2393098) [4632 bp, 1543 aa] {ON} Anc_5.500
          Length = 1543

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 63/236 (26%), Positives = 110/236 (46%), Gaps = 15/236 (6%)

Query: 440  KGEIVF--KDVTFSYPTRPG-NVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYN 496
            K E +F  +D+ +  P +     I  ++D  +  G+   ++G SG GK+T+   L     
Sbjct: 873  KSEAIFHWRDLCYDVPIKKEVRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVT 932

Query: 497  PSS--GQIFIDGQDISKLNIKSLRRHIGLVQQEPV-LMSGTLRDNITY-GLTETPSKEEI 552
              +  G I++DG    +L  +S  R IG  QQ+ + L + T+R+++ +      P+   I
Sbjct: 933  MGTITGNIYVDG----RLRDESFPRSIGYCQQQDLHLKTSTVRESLRFSAYLRQPAAVSI 988

Query: 553  RMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILV-LDEATS 611
                K       I++     D V+G  G  L+  Q++R+ I   L  KP +LV LDE TS
Sbjct: 989  EEKNKYVEEVIRILEMEAYADAVVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTS 1048

Query: 612  ALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTI--RRSENIIVLGNDGSVVETG 665
             LD ++  A      +L ++    + +I H+ S I  +  + ++ L   G  V  G
Sbjct: 1049 GLDSQTAWATCQLMRKLAENGQAILCTI-HQPSAILMQDFDRLLFLQKGGQTVYFG 1103

>KLTH0H13442g Chr8 complement(1175860..1178118) [2259 bp, 752 aa]
           {ON} highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 98/240 (40%), Gaps = 48/240 (20%)

Query: 443 IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI 502
           I  +DV+F +   P  ++ +D+++ +   S + +VG +G GK+T+  +L+          
Sbjct: 532 IQLQDVSFGFD--PSQLLLKDVNLDVQMDSRIAIVGANGCGKTTLLKILM---------- 579

Query: 503 FIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCH 562
                       + LR   G V + P L        + Y         ++   A     +
Sbjct: 580 ------------EQLRPLQGYVSRNPRL-------RVAYFTQHHVDSMDLNASAVDWMSN 620

Query: 563 NFIVKFPHGYDTVIGPQG----------ALLSGGQKQRIAIARALIKKPTILVLDEATSA 612
            F  +    Y   +G  G           LLSGGQK R+A A   +  P ILVLDE ++ 
Sbjct: 621 TFPGRTDEEYRRHLGAFGITGSLGLQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 613 LDVESEGAI-----NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKF 667
           LD     A+      +T G LM S  ++++      + I  SEN  V   +G++ +   +
Sbjct: 681 LDTAGLDALMDALKKFTGGVLMVSHDISVIDGV--CNEIWVSENGTVRRFEGTIFDYKNY 738

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 583 LSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAH 641
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+V ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVVVVSH 422

>KAFR0E03450 Chr5 complement(689571..694232) [4662 bp, 1553 aa] {ON} 
          Length = 1553

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 102/219 (46%), Gaps = 24/219 (10%)

Query: 460  IFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPS--SGQIFIDGQDISKLNIKSL 517
            +  ++D  +  G+   ++G SG GK+T+   L         +G IF+DG    +L  +S 
Sbjct: 926  LLNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGNIFVDG----RLRDESF 981

Query: 518  RRHIGLVQQEPV-LMSGTLRDNITYGLT----ETPSKEEIRMVAKQCFCHNFIVKFPHGY 572
             R IG  QQ+ + L + T+R+++ +        + +KEE     +Q      I++     
Sbjct: 982  PRSIGYCQQQDLHLKTATVRESLRFSAYLRQPASVTKEEKDHYVEQVIK---ILEMETYA 1038

Query: 573  DTVIGPQGALLSGGQKQRIAIARALIKKPTILV-LDEATSALDVESEGAINYTFGQLMK- 630
            D V+G  G  L+  Q++R+ I   L  KP +LV LDE TS LD ++  A      QLM+ 
Sbjct: 1039 DAVVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAT----CQLMRK 1094

Query: 631  --SKSVTIVSIAHRLSTIRRSE--NIIVLGNDGSVVETG 665
              +    I+   H+ S I   E   ++ L   G  V  G
Sbjct: 1095 LANHGQAILCTIHQPSAILMQEFDRLLFLQKGGKTVYFG 1133

>Kwal_47.19116 s47 complement(1101559..1103382) [1824 bp, 607 aa]
           {ON} YER036C (KRE30) - Hypothetical ORF [contig 188]
           FULL
          Length = 607

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/234 (24%), Positives = 101/234 (43%), Gaps = 40/234 (17%)

Query: 443 IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI 502
           + F D++F+Y  +P N ++  ++  +   S V +VGP+G GKST+  ++       SG++
Sbjct: 390 LAFDDISFAYDGKPENNLYEHLNFGVDMDSRVALVGPNGVGKSTLLKIMTGELATQSGRV 449

Query: 503 FIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCH 562
                        S   H+ L         G    +    L  T S  E          H
Sbjct: 450 -------------SRHTHVKL---------GVYSQHSQDQLDLTKSPLEFVRDKYSHISH 487

Query: 563 NFIVKFPHGYDTVIG-------PQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDV 615
           +F  ++  G     G        Q A LS GQ+ R+  A   ++ P +L+LDE T+ LD+
Sbjct: 488 DF--QYWRGQLGRYGLTGEGQTSQMATLSEGQRSRVVFALLALQAPNVLLLDEPTNGLDI 545

Query: 616 ESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGN------DGSVVE 663
            +  ++     +   +  V +VS   RL   + +++I V+ N      DGS+++
Sbjct: 546 ATIDSLADAINEF--NGGVVVVSHDFRLLD-KIAKDIFVVENKTATRWDGSILD 596

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 76/169 (44%), Gaps = 8/169 (4%)

Query: 457 GNVIFRDMDIKIPAGSNVCVVGPSGRGKSTI--ALLLLRFYNPSSGQIFIDGQDISKLNI 514
           G V+ +D  +++  G    ++G +G GKST   +L    +  P    +++  +       
Sbjct: 90  GKVLIQDSQLELNYGRRYGLLGENGCGKSTFLKSLATKEYPIPEHIDVYLLDEPAEPSEF 149

Query: 515 KSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNF-----IVKFP 569
            +L   +   Q E   +   +   I     E+   E I           F     ++   
Sbjct: 150 SALEYVVNEAQNELKRLEDLVEKTILEDGPESDVLEGIYERMDSLDPSTFESRAAVILIG 209

Query: 570 HGYDT-VIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVES 617
            G+++  I  +   +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+
Sbjct: 210 LGFNSKTINKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 258

>YOR328W Chr15 (931803..936497) [4695 bp, 1564 aa] {ON}
            PDR10ATP-binding cassette (ABC) transporter, multidrug
            transporter involved in the pleiotropic drug resistance
            network; regulated by Pdr1p and Pdr3p
          Length = 1564

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 111/234 (47%), Gaps = 21/234 (8%)

Query: 445  FKDVTFSYPTRPGNV-IFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPS--SGQ 501
            +K++ +  P + G   I  ++D  +  G+   ++G SG GK+T+   L         +G 
Sbjct: 925  WKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGD 984

Query: 502  IFIDGQDISKLNIKSLRRHIGLVQQEPV-LMSGTLRDNITYGLTETPSKEEIRMVAKQCF 560
            +F+DG+   +    S  R IG  QQ+ + L + T+R+++ +        +++ +  K  +
Sbjct: 985  VFVDGRPRDQ----SFPRSIGYCQQQDLHLKTATVRESLRFS-AYLRQADDVSIEEKDKY 1039

Query: 561  CHNFI--VKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILV-LDEATSALDVES 617
                I  ++     D ++G  G  L+  Q++R+ I   L  KP +LV LDE TS LD ++
Sbjct: 1040 VEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQT 1099

Query: 618  EGAINYTFGQLMK---SKSVTIVSIAHRLSTIRRSE--NIIVLGNDGSVVETGK 666
                 ++  QLMK   S+   I+   H+ S +   E   ++ L   G  V  G+
Sbjct: 1100 A----WSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGE 1149

>Suva_15.91 Chr15 complement(162469..166377) [3909 bp, 1302 aa] {ON}
           YOL075C (REAL)
          Length = 1302

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 94/214 (43%), Gaps = 29/214 (13%)

Query: 476 VVGPSGRGKSTI---------ALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQ 526
           ++GPSG GKS++         + L  +F   +SG I  +   +S+L  K++  ++     
Sbjct: 733 IMGPSGSGKSSLLNLISGRLKSSLFAKF--DTSGTIMFNDIQVSELMFKNVCSYVS-QDD 789

Query: 527 EPVLMSGTLRDNITYG-------LTETPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQ 579
           + +L + T+++ + Y        L E    E    + +        +   H  + +IG +
Sbjct: 790 DHLLATLTVKETLKYAAALRLHHLNEAERTERTDNLIRS-------LGLKHCENNIIGNE 842

Query: 580 GAL-LSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVS 638
               +SGG+K+R+ +   L+  P IL+LDE TS LD  +   I      L K    T++ 
Sbjct: 843 FVKGISGGEKRRVTMGVQLLSDPPILLLDEPTSGLDSFTSATILEILENLCKEHGKTVII 902

Query: 639 IAH--RLSTIRRSENIIVLGNDGSVVETGKFKEL 670
             H  R    +R  N+++L   G     G   E+
Sbjct: 903 TIHQPRSELFKRFGNVLLLAKSGRTAFNGSPDEM 936

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 94/218 (43%), Gaps = 32/218 (14%)

Query: 454 TRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLL-------------LRFY----N 496
           ++    +     + +P+GS + V+G SG GK+T+  +L             +R+      
Sbjct: 38  SKTNTTLVNSFSMDLPSGSVMAVMGGSGSGKTTLLNVLASKISGGLRHEGSIRYVLEDSE 97

Query: 497 PSSGQIFIDGQDISKLNIK------SLRRHI---GLVQQEPVLMSGTLRDNITYG--LTE 545
           P SG    +  D+   N +        ++H+    L QQ+ +    T R+ + +   L  
Sbjct: 98  PGSGYGSEESVDVKAKNSRLDGEDHHTQKHVIMAYLPQQDVLSPRLTCRETLNFAADLKL 157

Query: 546 TPSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGAL-LSGGQKQRIAIARALIKKPTIL 604
             S    +++ +Q       +      DT++G      LSGG+K+R++I   +I  P+I+
Sbjct: 158 NSSSRTKKLMVEQLIEE---LGLRDCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIM 214

Query: 605 VLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHR 642
            LDE T+ LD  S   +  T  +L K    T +   H+
Sbjct: 215 FLDEPTTGLDAYSAFLVIKTLKKLAKEDGRTFIMSIHQ 252

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 65,975,511
Number of extensions: 2580807
Number of successful extensions: 9377
Number of sequences better than 10.0: 499
Number of HSP's gapped: 8999
Number of HSP's successfully gapped: 887
Length of query: 739
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 622
Effective length of database: 40,065,477
Effective search space: 24920726694
Effective search space used: 24920726694
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 70 (31.6 bits)