Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G046506.6ON62623097e-39
Kwal_56.223336.6ON62622255e-26
Kthe_YGOB_Anc_6.66.6ON62622152e-24
Sklu_YGOB_Anc_6.66.6ON61622152e-24
Klac_YGOB_Anc_6.66.6ON61622143e-24
CAGL0A01111g6.6ON69602092e-23
ZYRO0F00418g6.6ON62602022e-22
Kpol_1045.826.6ON62621986e-22
NDAI0I027406.6ON66611987e-22
Skud_16.66.6ON62601987e-22
TBLA0A072006.6ON65621979e-22
Suva_16.346.6ON62601901e-20
Smik_6.4796.6ON62601891e-20
YPL271W (ATP15)6.6ON62601849e-20
NCAS0D022006.6ON85601851e-19
KNAG0E027906.6ON65611831e-19
TPHA0J002306.6ON62621788e-19
Ecym_30086.6ON61621691e-17
KAFR0B064906.6ON66611581e-15
ACR021W6.6ON62621432e-13
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G04650
         (62 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6 Y...   123   7e-39
Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON} ...    91   5e-26
Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON} ANN...    87   2e-24
Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa] ...    87   2e-24
Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa] ...    87   3e-24
CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly s...    85   2e-23
ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON} ...    82   2e-22
Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON} (192423...    81   6e-22
NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}...    81   7e-22
Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)       81   7e-22
TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa] {O...    80   9e-22
Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W (REAL)    78   1e-20
Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON} ...    77   1e-20
YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon ...    75   9e-20
NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6 Y...    76   1e-19
KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6 Y...    75   1e-19
TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON} ...    73   8e-19
Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON} sim...    70   1e-17
KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa] {O...    65   1e-15
ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic homo...    60   2e-13

>TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6
          YPL271W
          Length = 62

 Score =  123 bits (309), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 62/62 (100%), Positives = 62/62 (100%)

Query: 1  MAAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPL 60
          MAAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPL
Sbjct: 1  MAAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPL 60

Query: 61 QE 62
          QE
Sbjct: 61 QE 62

>Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON}
          YPL271W (ATP15) - nuclear gene for ATP synthase epsilon
          subunit [contig 186] FULL
          Length = 62

 Score = 91.3 bits (225), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 42/62 (67%), Positives = 54/62 (87%)

Query: 1  MAAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPL 60
          M+AWRKAGLTYN Y+++AA+TVR+ALK E Q ARVL RSKT+AR+VKYE G+A ++S PL
Sbjct: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPL 60

Query: 61 QE 62
          +E
Sbjct: 61 KE 62

>Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 62

 Score = 87.4 bits (215), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 54/62 (87%)

Query: 1  MAAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPL 60
          M+AWRKAGLTYN Y+++AA+TVR+ALK +LQ A+VL RSKT+AR++KYEKG+  +++ PL
Sbjct: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPL 60

Query: 61 QE 62
          + 
Sbjct: 61 KN 62

>Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score = 87.4 bits (215), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 39/62 (62%), Positives = 54/62 (87%), Gaps = 1/62 (1%)

Query: 1  MAAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPL 60
          M+AWRKAGLTYN YLS+AA+TVRAALK E Q A+VL+RSK++A+++K+E G+  SD +PL
Sbjct: 1  MSAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGT-PSDPIPL 59

Query: 61 QE 62
          ++
Sbjct: 60 KK 61

>Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score = 87.0 bits (214), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 40/62 (64%), Positives = 52/62 (83%), Gaps = 1/62 (1%)

Query: 1  MAAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPL 60
          M+ WRKAGLT+N Y+SVAA TVRAALKPELQ   VLARSK++A+++K+E G  AS+ VPL
Sbjct: 1  MSTWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENG-VASEPVPL 59

Query: 61 QE 62
          ++
Sbjct: 60 KK 61

>CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271w ATP15
          Length = 69

 Score = 85.1 bits (209), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 48/60 (80%)

Query: 3  AWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPLQE 62
          AWRKAGL+Y+++L++AARTVR +LK ELQ   V+ R KTDA Y KYEKGS  SD +PLQE
Sbjct: 10 AWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPLQE 69

>ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON}
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271W ATP15 Epsilon subunit of the F1 sector of
          mitochondrial F1F0 ATP synthase which is a large
          evolutionarily conserved enzyme complex required for
          ATP synthesis
          Length = 62

 Score = 82.4 bits (202), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 47/60 (78%)

Query: 1  MAAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPL 60
          M+AWRKAGLTYN YLSVAA+TVR+ALKPE Q A VL+R + D++Y K+EKG    +  PL
Sbjct: 1  MSAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60

>Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON}
          (192423..192611) [189 nt, 63 aa]
          Length = 62

 Score = 80.9 bits (198), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 50/62 (80%)

Query: 1  MAAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPL 60
          M+AWRKAG+TYN Y+++AA+TVR ALK EL+   VLARSKT+A++V +E G+   + VP+
Sbjct: 1  MSAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPI 60

Query: 61 QE 62
          Q+
Sbjct: 61 QQ 62

>NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}
          Anc_6.6 YPL271W
          Length = 66

 Score = 80.9 bits (198), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 39/61 (63%), Positives = 49/61 (80%)

Query: 2  AAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPLQ 61
          A WRKAG+TY+ YLS+AART+RAALKPELQ A V+ARS TDA + KY+ G+ AS+   LQ
Sbjct: 5  AVWRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPESLQ 64

Query: 62 E 62
          +
Sbjct: 65 K 65

>Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)
          Length = 62

 Score = 80.9 bits (198), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 37/60 (61%), Positives = 50/60 (83%)

Query: 1  MAAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPL 60
          M+AWRKAG++Y  YL+VAA+T+R++LK ELQ A VL+RSKTDA Y KY+ G+AAS+  P+
Sbjct: 1  MSAWRKAGISYAAYLNVAAQTIRSSLKTELQTASVLSRSKTDAFYTKYKNGAAASEPTPI 60

>TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa]
          {ON} Anc_6.6 YPL271W
          Length = 65

 Score = 80.5 bits (197), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 49/62 (79%)

Query: 1  MAAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPL 60
          M+AWRKAG+TYN Y+++AA+TVR ALKPELQ A V+ RS T+AR+ KY KGS  +D   L
Sbjct: 1  MSAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADPALL 60

Query: 61 QE 62
          +E
Sbjct: 61 KE 62

>Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W
          (REAL)
          Length = 62

 Score = 77.8 bits (190), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 50/60 (83%)

Query: 1  MAAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPL 60
          M+AWRKAG++Y  YL+VAA+T+R++LK ELQ A VL+RS+TDA Y KY+ G+AAS+ V +
Sbjct: 1  MSAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEPVSI 60

>Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON}
          YPL271W (REAL)
          Length = 62

 Score = 77.4 bits (189), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 49/60 (81%)

Query: 1  MAAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPL 60
          M+AWRKAG++Y  YL+VAA+ +R++LK ELQ A VL+RSKTDA Y +Y+ G+AAS+  P+
Sbjct: 1  MSAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPI 60

>YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon
          subunit of the F1 sector of mitochondrial F1F0 ATP
          synthase, which is a large, evolutionarily conserved
          enzyme complex required for ATP synthesis;
          phosphorylated
          Length = 62

 Score = 75.5 bits (184), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 34/60 (56%), Positives = 48/60 (80%)

Query: 1  MAAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPL 60
          M+AWRKAG++Y  YL+VAA+ +R++LK ELQ A VL RS+TDA Y +Y+ G+AAS+  P+
Sbjct: 1  MSAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPI 60

>NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6
          YPL271W
          Length = 85

 Score = 75.9 bits (185), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 44/60 (73%)

Query: 2  AAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPLQ 61
          A  RKAG+TY  YL VA+RT+RA+LK ELQ   V+ARS TDA Y KYEKGS  +D  PLQ
Sbjct: 22 ATLRKAGVTYAQYLCVASRTLRASLKTELQTPVVMARSNTDAYYTKYEKGSPIADPAPLQ 81

>KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6
          YPL271W
          Length = 65

 Score = 75.1 bits (183), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 45/61 (73%)

Query: 2  AAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPLQ 61
          A W+KAG+TY TYL+V A+T+R+ALK ELQ   VL+R  TDA Y  YEKG+  +D  PLQ
Sbjct: 3  AYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQPLQ 62

Query: 62 E 62
          E
Sbjct: 63 E 63

>TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON}
          Anc_6.6 YPL271W
          Length = 62

 Score = 73.2 bits (178), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 47/62 (75%)

Query: 1  MAAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPL 60
          M+ WRKAGLTY+ YL+VAA+TVR +LK +L+   VL+RSKTD +Y  +EKG+A S+   +
Sbjct: 1  MSTWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSI 60

Query: 61 QE 62
           +
Sbjct: 61 SD 62

>Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON}
          similar to Ashbya gossypii ACR021W
          Length = 61

 Score = 69.7 bits (169), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/62 (64%), Positives = 55/62 (88%), Gaps = 1/62 (1%)

Query: 1  MAAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPL 60
          M+AWRKAGL+YNTY++VAAR VR+ALKPEL++A VL+RS T+A+ + Y+ G AASD+VPL
Sbjct: 1  MSAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDG-AASDAVPL 59

Query: 61 QE 62
          ++
Sbjct: 60 KK 61

>KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa]
          {ON} Anc_6.6 YPL271W
          Length = 66

 Score = 65.5 bits (158), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 42/61 (68%)

Query: 2  AAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPLQ 61
          + WRKAGLTY +YLS+A++T+R  LK E Q A V +RS T+A    Y+ GS  SD  PLQ
Sbjct: 3  SVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPLQ 62

Query: 62 E 62
          +
Sbjct: 63 K 63

>ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YPL271W (ATP15)
          Length = 62

 Score = 59.7 bits (143), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 50/62 (80%)

Query: 1  MAAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPL 60
          M+AWRKAGLTYN+YL+VAARTVRAALK ELQ   VL RS T+A+ + Y    +A+++VPL
Sbjct: 1  MSAWRKAGLTYNSYLAVAARTVRAALKKELQSPAVLNRSVTEAKVIDYASKGSAAEAVPL 60

Query: 61 QE 62
          ++
Sbjct: 61 RK 62

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.123    0.335 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 5,273,085
Number of extensions: 123092
Number of successful extensions: 220
Number of sequences better than 10.0: 20
Number of HSP's gapped: 220
Number of HSP's successfully gapped: 20
Length of query: 62
Length of database: 53,481,399
Length adjustment: 35
Effective length of query: 27
Effective length of database: 49,468,089
Effective search space: 1335638403
Effective search space used: 1335638403
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 59 (27.3 bits)