Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G046306.8ON50350326380.0
SAKL0E00792g6.8ON51150514550.0
Kpol_1045.796.8ON50850714160.0
NDAI0G00860singletonON52353013141e-177
TPHA0J002606.8ON51551212821e-173
TPHA0M001806.8ON50351712371e-166
KNAG0E027706.8ON50851512351e-166
Skud_16.56.8ON51552012251e-164
CAGL0A01089g6.8ON53554612061e-161
Suva_16.336.8ON51852511951e-159
YPL272C6.8ON51752511781e-157
Smik_6.4806.8ON51652511761e-157
KAFR0B065106.8ON50851911401e-151
NCAS0D021806.8ON5155248861e-113
TBLA0A072206.8ON5095278811e-112
Ecym_30116.8ON5095108331e-105
KLTH0C11572g6.8ON5185127803e-97
Kwal_56.223416.8ON5195156994e-85
ACR018C6.8ON4784736753e-82
Kpol_1032.1singletonON2462494184e-47
Kpol_191.16.8ON1391301551e-11
Kwal_27.98985.119ON4602991331e-07
TBLA0I032803.518ON33076741.5
KAFR0D002301.14ON418106704.7
SAKL0G15004g5.119ON456223704.9
KAFR0E022805.66ON631110704.9
Kpol_1010.495.119ON481118705.4
ZYRO0C11484g5.78ON256141679.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G04630
         (503 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {O...  1020   0.0  
SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar ...   565   0.0  
Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa] ...   550   0.0  
NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON}              510   e-177
TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8 ...   498   e-173
TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8 ...   481   e-166
KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8...   480   e-166
Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON} YP...   476   e-164
CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {...   469   e-161
Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}...   464   e-159
YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON} Pu...   458   e-157
Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C ...   457   e-157
KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa] ...   443   e-151
NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8      345   e-113
TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6...   343   e-112
Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to ...   325   e-105
KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {...   305   3e-97
Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C ...   273   4e-85
ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON} S...   264   3e-82
Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741...   165   4e-47
Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON} compl...    64   1e-11
Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W...    56   1e-07
TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON...    33   1.5  
KAFR0D00230 Chr4 complement(28545..29801) [1257 bp, 418 aa] {ON}...    32   4.7  
SAKL0G15004g Chr7 (1288241..1289611) [1371 bp, 456 aa] {ON} simi...    32   4.9  
KAFR0E02280 Chr5 (458594..460489) [1896 bp, 631 aa] {ON} Anc_5.6...    32   4.9  
Kpol_1010.49 s1010 (113037..114482) [1446 bp, 481 aa] {ON} (1130...    32   5.4  
ZYRO0C11484g Chr3 (890770..891540) [771 bp, 256 aa] {ON} similar...    30   9.2  

>TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {ON}
           Anc_6.8 YPL272C
          Length = 503

 Score = 1020 bits (2638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/503 (97%), Positives = 491/503 (97%)

Query: 1   MSFRSLGGFEKKILSQSLEGHRNGVVFGAMYSTTPEEWSDDATLLTYKDXXXXXXXXXXX 60
           MSFRSLGGFEKKILSQSLEGHRNGVVFGAMYSTTPEEWSDDATLLTYKD           
Sbjct: 1   MSFRSLGGFEKKILSQSLEGHRNGVVFGAMYSTTPEEWSDDATLLTYKDSRLNLSLLSRT 60

Query: 61  XAKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGAPPYLLRHI 120
            AKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGAPPYLLRHI
Sbjct: 61  LAKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGAPPYLLRHI 120

Query: 121 FNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLNSISKSGSKL 180
           FNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLNSISKSGSKL
Sbjct: 121 FNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLNSISKSGSKL 180

Query: 181 STIFKLEKAVLPPFPKSIYDNAKLRLPAKAADLFNLQTQSFFKSLYFNAVKKPLDYINSN 240
           STIFKLEKAVLPPFPKSIYDNAKLRLPAKAADLFNLQTQSFFKSLYFNAVKKPLDYINSN
Sbjct: 181 STIFKLEKAVLPPFPKSIYDNAKLRLPAKAADLFNLQTQSFFKSLYFNAVKKPLDYINSN 240

Query: 241 PPQQLKEYRTRYADILRTDNNLCGTTIFGRILPKRLESLDCIFKQQNICLKSFVCGITML 300
           PPQQLKEYRTRYADILRTDNNLCGTTIFGRILPKRLESLDCIFKQQNICLKSFVCGITML
Sbjct: 241 PPQQLKEYRTRYADILRTDNNLCGTTIFGRILPKRLESLDCIFKQQNICLKSFVCGITML 300

Query: 301 CLKPIVKNYTGSITFCVPVDLRSSLEASSEFGMFYKDIRVECPLSLIDDKNFNSLTVYNG 360
           CLKPIVKNYTGSITFCVPVDLRSSLEASSEFGMFYKDIRVECPLSLIDDKNFNSLTVYNG
Sbjct: 301 CLKPIVKNYTGSITFCVPVDLRSSLEASSEFGMFYKDIRVECPLSLIDDKNFNSLTVYNG 360

Query: 361 YDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALRQRMKAWEKFGFNDDDIKRMKFGSD 420
           YDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALRQRMKAWEKFGFNDDDIKRMKFGSD
Sbjct: 361 YDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALRQRMKAWEKFGFNDDDIKRMKFGSD 420

Query: 421 DTATNTKLIQINDVSDIPVDAHEDISGKFHMRELNMTQSLKPGQLMSLSYTHSEKGLDIC 480
           DTATNTKLIQINDVSDIPVDAHEDISGKFHMRELNMTQSLKPGQLMSLSYTHSEKGLDIC
Sbjct: 421 DTATNTKLIQINDVSDIPVDAHEDISGKFHMRELNMTQSLKPGQLMSLSYTHSEKGLDIC 480

Query: 481 IHYPDGYNMESFVECFQSFIEDA 503
           IHYPDGYNMESFVECFQSFIEDA
Sbjct: 481 IHYPDGYNMESFVECFQSFIEDA 503

>SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar to
           uniprot|Q08984 Saccharomyces cerevisiae YPL272C
           Hypothetical ORF
          Length = 511

 Score =  565 bits (1455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/505 (54%), Positives = 355/505 (70%), Gaps = 7/505 (1%)

Query: 2   SFRSLGGFEKKILSQSLEGHRNGVVFGAMYSTT---PEEWSDDATLLTYKDXXXXXXXXX 58
           SFRSL   EKK+ SQ+L   RNG++F A+YST     E WSD+ATLLT KD         
Sbjct: 6   SFRSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCFDKEETWSDNATLLTVKDQRLSNSLVS 65

Query: 59  XXXAKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGAPPYLLR 118
               K+I+++VEL+TTIN+ LEF PVK I  ++V+  V F SYKDE VNC  G PPYLLR
Sbjct: 66  RALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGVPPYLLR 125

Query: 119 HIFNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLNSISKSGS 178
           HIF++  F+      LWQI +VDET+V+FHGHDVLFDIF+AANFHK+F Q LN + K G 
Sbjct: 126 HIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALNQLPKDGP 185

Query: 179 KLSTIFKLEKAVLPPFPKSIYDNAKLRLPAKAADLFNLQTQSFFKSLYFNAVKKPLDYIN 238
            L  +FK +      FPKSIY+N KLRLPA A DLF LQTQSFFKS+Y   +KKPLD+IN
Sbjct: 186 TLECLFKNDSKA-SFFPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNWTIKKPLDFIN 244

Query: 239 SNPPQQLKEYRTRYADILRTDNNLCGTTIFGRILPKRLESLDCIFKQQNICLKSFVCGIT 298
           +NP   LK Y++ Y DIL   NNLCGTT+FG I  +R+ +L  I KQ+NICL SFVC I 
Sbjct: 245 TNPNSGLKYYQSCYTDILLGANNLCGTTVFGNISAERVCALKKIMKQENICLSSFVCAIA 304

Query: 299 MLCLKPIVKNYTGSITFCVPVDLRSSLEASSEFGMFYKDIRVECPLSLIDDKNFNSLTVY 358
           +LCLKP+V N+  S+TF +PVDLRS++  +S FG+ YK++ VECPL+LIDDK F  L VY
Sbjct: 305 LLCLKPLVNNFGSSVTFSIPVDLRSTIPQASRFGLCYKNVLVECPLTLIDDKVFQGLNVY 364

Query: 359 NGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALRQRMKAWEKFGFNDDDIKRMKFG 418
           NGYD    K   KDP Y+E LLEYQF++   HV   L+QR +AWE+ GFNDDDIKRMKFG
Sbjct: 365 NGYDIRNTKPTNKDPNYEESLLEYQFREACTHVDNTLKQRWRAWERSGFNDDDIKRMKFG 424

Query: 419 SDDTATNTKLIQINDVSDIPVDAHEDISGKFHMRELNMTQSLKPGQLMSLSYTHSEK-GL 477
             +   + ++I++N+V++     H D +  F+++++  T+S      MSLS   SE+ GL
Sbjct: 425 KTEQGKSKRIIEVNNVTEFQF--HVDDNATFNIKDVCFTKSQNLETFMSLSCAFSERSGL 482

Query: 478 DICIHYPDGYNMESFVECFQSFIED 502
           ++CIHYPDGYNM+ FVECFQSF+E+
Sbjct: 483 NVCIHYPDGYNMDVFVECFQSFMEE 507

>Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa]
           {ON} complement(184350..185876) [1527 nt, 509 aa]
          Length = 508

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/507 (53%), Positives = 361/507 (71%), Gaps = 9/507 (1%)

Query: 2   SFRSLGGFEKKILSQSLEGHRNGVVFGAMY-STTPEEWSDDATLLTYKDXXXXXXXXXXX 60
           SFR LG +EKK++ Q+L G  NG++F A Y S   +  +DDATLLT  +           
Sbjct: 3   SFRQLGTYEKKLVGQALAGQSNGIIFSAKYISNAQDGLTDDATLLTNSEPLLLDSRLVNA 62

Query: 61  XAKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGAPPYLLRHI 120
             KM+  H EL TT+NEKLEF  VKEIK  ++I +V F S KDEFVNC  GAPPYLLRHI
Sbjct: 63  LQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNCHLGAPPYLLRHI 122

Query: 121 FNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLNSISKSG-SK 179
           FN+  F PGSG  LW++ V+D++LV+FHG DVLFDIF+AANFHK+FL+TLNS+     + 
Sbjct: 123 FNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFLETLNSMDDEHITD 182

Query: 180 LSTIFKLEKAVLP---PFPKSIYDNAKLRLPAKAADLFNLQTQSFFKSLYFNAVKKPLDY 236
           L  I++ +         FP++IY+N KLR+P K  DL NLQTQSFFKS Y NA+KKPLD 
Sbjct: 183 LEYIYRYDATKSNRSISFPRTIYENPKLRIPGKTIDLVNLQTQSFFKSFYVNAIKKPLDI 242

Query: 237 INSNPPQQLKEYRTRYADILRTDNNLCGTTIFGRILPKRLESLDCIFKQQNICLKSFVCG 296
           I  N  + +K  +    D +   + LCGTT+FG I   R E L+ I + +N+C++SF+CG
Sbjct: 243 ITFNS-EPMKYIKPNEIDFMNEASALCGTTVFGHITTDRFEYLNSIARHENVCIRSFICG 301

Query: 297 ITMLCLKPIVKNYTGSITFCVPVDLRSSLEASSEFGMFYKDIRVECPLSLIDDKNFNSLT 356
           I +LCLK ++K++TGSITF +PV+LR S+E  S+FG+FYK I VECPLSLIDD+ +N++ 
Sbjct: 302 IALLCLKSMIKDFTGSITFSIPVNLRESIEGPSDFGLFYKTILVECPLSLIDDQVYNNIN 361

Query: 357 VYNGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALRQRMKAWEKFGFNDDDIKRMK 416
           VYNGYD+S VK+PE DP ++E+ LEYQFKQ++D V   +++RM+AW + GFNDDDIK+MK
Sbjct: 362 VYNGYDNSNVKVPETDPTFEEKKLEYQFKQISDLVSTTMKERMRAWRRNGFNDDDIKKMK 421

Query: 417 FGSDDTATNTKLIQINDVSDIPVDAHEDISGKFHMRELNMTQSLKPGQLMSLSYTH-SEK 475
           F SDD A+NTK+IQINDVS+  +++ +  S K  ++ELN T S+     MSLSYT+  E 
Sbjct: 422 FTSDDKASNTKIIQINDVSEFKINSSK--SSKVSIKELNFTHSISNSDFMSLSYTYCKET 479

Query: 476 GLDICIHYPDGYNMESFVECFQSFIED 502
           G +ICIHYPD Y+ME FVE FQSF+ D
Sbjct: 480 GSNICIHYPDAYDMEKFVERFQSFVAD 506

>NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON} 
          Length = 523

 Score =  510 bits (1314), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 258/530 (48%), Positives = 360/530 (67%), Gaps = 35/530 (6%)

Query: 1   MSFRSLGGFEKKILSQSLEGHRNGVVFGAMY-----STTPEEWSDDATLLTYKDXXXXXX 55
           MS R+L  FEKK+LSQ+L+  RNG+ + A Y     S++    SD ATLL  KD      
Sbjct: 1   MSIRALSSFEKKVLSQTLDSKRNGISYTARYVSKVGSSSDSTLSDAATLLATKDIRLNIG 60

Query: 56  XXXXXXAKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGAPPY 115
                  ++I  H+EL++TINE  EF  + +IK E+VI+ +TF +YKDE +NC  GAPPY
Sbjct: 61  IVTRVLERLIKKHIELYSTINENYEFQILTKIKPEDVISVITFDTYKDEQINCHSGAPPY 120

Query: 116 LLRHIFNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLN---- 171
           LLRHIFN+  F+      LW++Y++DET+++FHG D+LFDIFSAANFHK+F   LN    
Sbjct: 121 LLRHIFNKEKFELNKP--LWKLYIIDETMIIFHGFDMLFDIFSAANFHKLFFDELNDYFL 178

Query: 172 --SISKSGSK-LSTIFKL---EKAVLP---PFPKSIYDNAKLRLPAKAADLFNLQTQSFF 222
             + SKS SK L  +FK+   +K  +P    FP+SI+DN KL LPA   DLFNLQT+SFF
Sbjct: 179 TNTFSKSNSKPLDVVFKINVSDKNFVPNFEEFPRSIFDNPKLHLPAMTPDLFNLQTKSFF 238

Query: 223 KSLYFNAVKKPLDYINSNPPQ-------QLKEYRTR-YADILRTDNNLCGTTIFGRILPK 274
           K++Y N +KKP+D  N +          QLKEY+T  Y D+L   ++LCGTT+FG + P 
Sbjct: 239 KTIYSNTIKKPIDLFNGSNSHTKNDITSQLKEYQTHNYLDMLGITSSLCGTTVFGTVSPT 298

Query: 275 RLESLDCIFKQQNICLKSFVCGITMLCLKPIVKNYTGSITFCVPVDLRSSLEASSEFGMF 334
           R   L  + KQ  ICL+SF+CGI M+CLKP +KNY+G+I F +P++LR+ ++ +  FG+F
Sbjct: 299 RYNYLKGMMKQDEICLRSFICGIVMICLKPSIKNYSGNIIFSIPINLRNYIDGAKNFGLF 358

Query: 335 YKDIRVECPLSLIDDKNFNSLTVYNGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAA 394
           YKD++++CPLSLIDD+NF     YNGY  S++   E D  + E+LLEYQFKQVT+ +   
Sbjct: 359 YKDVKIDCPLSLIDDRNFK----YNGYKDSSIP-DENDLEFNEKLLEYQFKQVTEFIENV 413

Query: 395 LRQRMKAWEKFGFNDDDIKRMKFGSDDT-ATNTKLIQINDVSDIPVDAHEDISGKFHMRE 453
           + +R+K WEKF FNDDDIKRMKF  D+    N+K+IQIND ++I +  +++ +  F +  
Sbjct: 414 ILERLKIWEKFNFNDDDIKRMKFDHDEVLGQNSKIIQINDTTEIMLGENDNNNKAFTLTN 473

Query: 454 LNMTQSLKPGQLMSLSYTHSEK-GLDICIHYPDGYNMESFVECFQSFIED 502
            N T++L   + MS+S+   E+ GL++CIHYPDGY+ME+FVECFQ+FIE+
Sbjct: 474 PNFTRTLSGNEFMSVSFAICEETGLNVCIHYPDGYSMETFVECFQTFIEE 523

>TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8
           YPL272C
          Length = 515

 Score =  498 bits (1282), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 248/512 (48%), Positives = 347/512 (67%), Gaps = 12/512 (2%)

Query: 1   MSFRSLGGFEKKILSQSLEGHRNGVVFGAMYS--TTPEEWSDDA-TLLTYKDXXXXXXXX 57
           M FR L  +E+ +L +S E   NG +F A Y+   T    +DDA TLLT  +        
Sbjct: 1   MPFRPLASYERNVLIESYENQTNGTIFSAKYTDMQTNSTINDDAATLLTQNEENNMFSRF 60

Query: 58  XXXXAKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGAPPYLL 117
               A +I+++ EL+TTIN KLEF P+ EIK ++VI+++ F S KDEFVNC+ GAPPYLL
Sbjct: 61  INALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAPPYLL 120

Query: 118 RHIFNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLNSISKSG 177
           RHIFN+  F PGSG  LW +Y+VD+++V+FHG DVLFDI+SAA+FH+ F   L   + + 
Sbjct: 121 RHIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKFFAALEGATPTS 180

Query: 178 SKLSTIFKL----EKAVLPPFPKSIYDNAKLRLPAKAADLFNLQTQSFFKSLYFNAVKKP 233
            KL+TIF+L    + A+  PFPKSIYD+  L LPAK  DL +LQT+ F KS+    + KP
Sbjct: 181 EKLTTIFRLSDLSKSALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRFFLKSVVSKTIVKP 240

Query: 234 LDYINSNPPQQLKEYRTRYADILRTDNNLCGTTIFGRILPKRLESLDCIFKQQNICLKSF 293
           L+ I  N         +   DIL   ++LCGTT+FG I  +R + L  I +++N+C KS 
Sbjct: 241 LNIIMFNDEPMKSFTNSDPMDILEKTSSLCGTTVFGNISNERFDYLQSIAEEENVCTKSL 300

Query: 294 VCGITMLCLKPIVKNYTGSITFCVPVDLRSSLEASSEFGMFYKDIRVECPLSLIDDKNFN 353
           VCGITMLCLKP++K+++ +ITF + ++LR S+E S+EFG+FYK++R+E PLS IDD  F 
Sbjct: 301 VCGITMLCLKPLIKDFSSNITFSIAMNLRDSIEESTEFGLFYKNVRIEVPLSFIDDNVFK 360

Query: 354 SLTVYNGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALRQRMKAWEKFGFNDDDIK 413
             T YNGYD+S   + E +P Y+EQL+ YQF Q+   +   L+QRM+AW + GFNDDDIK
Sbjct: 361 LKTSYNGYDASNSNIKETNPNYEEQLIAYQFNQIATFISRNLKQRMRAWRRNGFNDDDIK 420

Query: 414 RMKFGSDDTATNTKLIQINDVSDI---PVDAHEDISGKFHMRELNMTQSLKPGQLMSLSY 470
            MKFGS D  T+ K+IQIND+SD+   P++ + +++    +++L+ T SL P Q MSLSY
Sbjct: 421 MMKFGSKDKNTSAKIIQINDISDLSFCPMNKNGELNS-VSLKDLSFTHSLVPDQFMSLSY 479

Query: 471 THSEK-GLDICIHYPDGYNMESFVECFQSFIE 501
           TH +  G +ICIH+P+ Y++E FVE FQ+FI+
Sbjct: 480 THCKSTGSNICIHFPEVYDLELFVEKFQNFID 511

>TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8
           YPL272C
          Length = 503

 Score =  481 bits (1237), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 251/517 (48%), Positives = 347/517 (67%), Gaps = 29/517 (5%)

Query: 1   MSFRSLGGFEKKILSQSLEGHRNGVVFGAM--YSTTPEEWSDD-ATLLTYKDXXXXXXXX 57
           M FR+LGG+EKK+L+Q++EG RNGVVF +   ++   +E++DD ATL T +         
Sbjct: 1   MPFRALGGYEKKVLAQTIEGRRNGVVFSSQITFNKKSDEFADDNATLYTGRSVNEVSLKS 60

Query: 58  XXXXA--KMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGAPPY 115
               A   +I +HVEL+TTIN++L F PV +I+  +VI  +++   KD+ +  +      
Sbjct: 61  VLCAALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKAL-MKDQISDK 119

Query: 116 LLRHIFNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLNSISK 175
           LLRHIFN+  F+P +G  LWQ  + +++ ++FHGHDVLFDIFS ANF K  L+ +N +  
Sbjct: 120 LLRHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMNDVLN 179

Query: 176 SGSKLSTI-----FKLEKAVLPPFPKSIYDNAKLRLPAKAADLFNLQTQSFFKSLYFNAV 230
           S  KL T+     F  E++ L  +P+SIY+N KL LPA  +DL NLQTQSFFK++Y N +
Sbjct: 180 SNQKLKTVKTLFKFDAERS-LTNYPRSIYENPKLHLPALTSDLLNLQTQSFFKTIYQNTL 238

Query: 231 KKPLDYI---NSNPPQQLKEYRTRYADILRTDNNLCGTTIFGRILPKRLESLDCIFKQQN 287
           KKP+D I   NSN   QL EYRTR  DIL   N+LCG T+ G I  +R + L  + +Q+N
Sbjct: 239 KKPIDLITSANSNNNNQLSEYRTRNTDILSGANSLCGRTVLGEISLERYQHLKMLVEQEN 298

Query: 288 ICLKSFVCGITMLCLKPIVKNYTGSITFCVPVDLRSSLEASSEFGMFYKDIRVECPLSLI 347
           I L+SF+  ITM+CLKPIVKN+ GSI F +PV+LRS +  SS+FG+FYK+I+VECPL LI
Sbjct: 299 ISLRSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSSDFGLFYKNIKVECPLELI 358

Query: 348 DDKNFNSLTVYNGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALRQRMKAWEKFGF 407
           +D+ +        Y +  V    ++      LLE QF++++ HV   + QRMKAWEKFGF
Sbjct: 359 NDEKY--------YTNPEVLHSMQN----NSLLEIQFERISRHVSDVISQRMKAWEKFGF 406

Query: 408 NDDDIKRMKFGSDDTATNTKLIQINDVSDIPVD-AHEDISGKFHMRELNMTQSLKPGQLM 466
           NDDDIKRMKF +D+      +IQINDV++I  D  +++IS  F +  LN T+SL   + M
Sbjct: 407 NDDDIKRMKFSNDEKTGIAPIIQINDVTEISFDFGNDNISYSFSVNNLNFTKSLSCNEFM 466

Query: 467 SLSYTH-SEKGLDICIHYPDGYNMESFVECFQSFIED 502
           SL Y+H ++ GL+ICIHYPDGYNME+FVECFQSFIE+
Sbjct: 467 SLFYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIEN 503

>KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8
           YPL272C
          Length = 508

 Score =  480 bits (1235), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 251/515 (48%), Positives = 335/515 (65%), Gaps = 23/515 (4%)

Query: 2   SFRSLGGFEKKILSQSLEGHRNGVVFGAMYSTTPEEWSDD-ATLLTYKDXXXXXXXXXXX 60
           S R+L  FEKK+L QS++G +NG  FGA YST  E WSD+ ATLLT KD           
Sbjct: 3   SVRALSSFEKKLLLQSVDGLKNGTTFGAEYSTFKEGWSDEEATLLTVKDSRLCLGLLTKA 62

Query: 61  XAKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGAPPYLLRHI 120
              +I  H+ELF TINE+ EF  +K+IK  +VI+ + F S+KDE +NC+ GAPPYLLRHI
Sbjct: 63  LENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQLGAPPYLLRHI 122

Query: 121 FNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLNSIS---KSG 177
           FN   F PGSG  LW++Y++D++L  FHG D LFD+FS ANFH++ L+ +N +S   +  
Sbjct: 123 FNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKEVNLLSSRPQKW 182

Query: 178 SKLSTIFKL---EKAVLPPFPKSIYDNAKLRLPAKAADLFNLQTQSFFKSLYFNAVKKPL 234
            KL  +FK      + +   PKSIYDN KL +P    DLFNLQTQSFFKS+Y N VKKP+
Sbjct: 183 KKLDYVFKFGPDSMSEVKQLPKSIYDNPKLYIPTLNPDLFNLQTQSFFKSIYVNTVKKPI 242

Query: 235 DYINSNPPQQLK-EYRTRYADILRTDNNLCGTTIFGRILPKRLESLDCIFKQQNICLKSF 293
           +++ +     L      +Y DIL  ++ LCG T+FG +  +R + L+ I  Q+ +CLKSF
Sbjct: 243 EFLTNTDVSFLSLNSNMKYNDILDINSKLCGNTVFGCVSNERFKYLNTIINQEGLCLKSF 302

Query: 294 VCGITMLCLKPIVKNYTGSITFCVPVDLRSSLEASSEFGMFYKDIRVECPLSLIDDKNFN 353
           + GI MLCLKP+VKN +G++TF +PVDLRS ++   +FG++YKDIRVECPLSLIDD    
Sbjct: 303 IVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFVDEPRDFGLYYKDIRVECPLSLIDDDKSK 362

Query: 354 SLTVYNGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALRQRMKAWEKFGFNDDDIK 413
                         + E+D  + E+L+EYQFK +T  V   L QR+  + K GFNDDDI+
Sbjct: 363 DCM-------KGASVSEED--FDEKLMEYQFKNITGFVRNHLEQRLTRFSKTGFNDDDIR 413

Query: 414 RMKFGSDDT----ATNTKLIQINDVSDIPVDAHEDISGKFHMRELNMTQSLKPGQLMSLS 469
           RMKF   +T    + N   IQI D S I V+   +    F +R  N+T+SL   +LMSLS
Sbjct: 414 RMKFDDKNTLGGSSNNGTFIQIYDTSLINVNEFGE-PNSFMIRACNLTKSLNSEELMSLS 472

Query: 470 YTHSEK-GLDICIHYPDGYNMESFVECFQSFIEDA 503
           YT+ E+ GL+ICIHYP+ Y MESFVECFQSF+E+ 
Sbjct: 473 YTYCEENGLNICIHYPENYKMESFVECFQSFLEEG 507

>Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON}
           YPL272C (REAL)
          Length = 515

 Score =  476 bits (1225), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 247/520 (47%), Positives = 338/520 (65%), Gaps = 27/520 (5%)

Query: 2   SFRSLGGFEKKILSQSLEGHRNGVVFGAMYSTTPE-----EW-SDDATLLTYK---DXXX 52
           +FR L  FEKK+L+QSL   RNG +F + YS +P      +W SD+ TL T     D   
Sbjct: 3   TFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKDDSRL 62

Query: 53  XXXXXXXXXAKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGA 112
                     ++I     LF T+NE+ EF P+K++K  +++N + F + KD+ VNC +G 
Sbjct: 63  TLPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGV 122

Query: 113 PP-YLLRHIFNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLN 171
           PP YLLRH FN+T F PGS   LW +YV+DE L+VFHGHDVLFDIFSAANFHK+FL+ LN
Sbjct: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELN 182

Query: 172 SIS-KSGSKLSTIFKLEKAVLPP--FPKSIYDNAKLRLPAKAADLFNLQTQSFFKSLYFN 228
           +IS ++ S    +F +    +    FPKSIYD+AKL LPA    +F+ QTQSFFKS+++N
Sbjct: 183 NISLEAHSDDRVLFDISDVNISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIFYN 242

Query: 229 AVKKPLDYINSNP---PQQLKEYRTRYADILRTDNNLCGTTIFGRILPKRLESLDCIFKQ 285
            +K+P  Y+ +     P        +Y DIL   ++LCGTT+FG +  +R   L  I  Q
Sbjct: 243 TLKRPFGYLTNQTSLGPSTSTTQLKKYNDILNAHSSLCGTTVFGIVNNQRFNYLKSIVNQ 302

Query: 286 QNICLKSFVCGITMLCLKPIVKNYTGSITFCVPVDLRSSLEASSEFGMFYKDIRVECPLS 345
           ++ICL+SF+CGI M+CLKP+VK++TG+I F +P+DLR +L+     G+F+K++R+ECPLS
Sbjct: 303 EHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGESLGLFFKELRIECPLS 362

Query: 346 LIDDKNFNSLTVYNGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALRQRMKAWEKF 405
           LIDD+      + N  D       E D  + E+L+EYQF +VT HV   +  ++K+WEK 
Sbjct: 363 LIDDELSADEFLANRNDK------EDDDEFNEKLMEYQFNKVTKHVSDFIMAKLKSWEKN 416

Query: 406 GFNDDDIKRMKFGSDDT---ATNTKLIQINDVSDIPVDAHEDISGKFHMRELNMTQSLKP 462
           GFNDDDI+RMK+ +DD     + TKLIQINDVSDI +  + D    F +     T S+  
Sbjct: 417 GFNDDDIRRMKYDNDDCHIQNSKTKLIQINDVSDISLSMNND-EKAFKIISSGFTSSINR 475

Query: 463 GQLMSLSYTHSEK-GLDICIHYPDGYNMESFVECFQSFIE 501
             LMSLSYT+ E+ GL+ICIHYPD YN+ESFVECF+SFIE
Sbjct: 476 PTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515

>CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272c
          Length = 535

 Score =  469 bits (1206), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 256/546 (46%), Positives = 343/546 (62%), Gaps = 61/546 (11%)

Query: 4   RSLGGFEKKILSQSLEGHRNGVVFGAMY----STTPEE--WSDDATLL---------TYK 48
           RSL  +E+K+LS+ LE ++NG VFGA Y    S T +E  W DD   L         T K
Sbjct: 3   RSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRSTKK 62

Query: 49  DXXXXXXXXXXXXAK-MISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVN 107
                         K +I  + E++TT+N+ LEFAP+KEI+  +VI+ VTF + KDE VN
Sbjct: 63  PALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKVN 122

Query: 108 CRFGAPP-YLLRHIFNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIF 166
           C  G PP YL+RHI     FQPGS   LW +Y++DE+ +VFH  D+LFDIFSAANFHK+F
Sbjct: 123 CHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKLF 182

Query: 167 LQTLNSISKSGSK----LSTIFKLEKAVLPPF--PKSIYDNAKLRLPAKAADLFNLQTQS 220
           L+ L ++ +        L  +FKL+K+    +  PKSIYDN KL LPA   +L NLQTQS
Sbjct: 183 LKELIAVCRPQQSYEKPLEYLFKLQKSFENNYSVPKSIYDNLKLHLPATRPELLNLQTQS 242

Query: 221 FFKSLYFNAVKKPLDYIN--------------------SNPPQQLKEYRTRYADILRTDN 260
           FFKS++ NAVKKPLD+I                     S    QLK +RTRY +IL +  
Sbjct: 243 FFKSIFCNAVKKPLDFIQMPITSITNSSSNSDNSTTVISQEGNQLKLFRTRYTNILTSAT 302

Query: 261 NLCGTTIFGRILPKRLESLDCIFKQQNICLKSFVCGITMLCLKPIVKNYTGSITFCVPVD 320
           + CG TIFG +  +R   L+ + K + ICL+SF+  ITMLCLKP+VK++ G++ F +P++
Sbjct: 303 SNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSMPMN 362

Query: 321 LRSSLEASSEFGMFYKDIRVECPLSLIDDKNFNSLTVYNGYDSSAVKMPEKDPGYKEQLL 380
           LR S+    +FG+ YKDIRVECPLS+IDDK             S   + E DP Y E+LL
Sbjct: 363 LRDSMNEKRDFGLVYKDIRVECPLSMIDDKQ-----------CSVPGLNESDPEYNEKLL 411

Query: 381 EYQFKQVTDHVVAALRQRMKAWEKFGFNDDDIKRMKFGSDDT--ATNTKLIQINDVSDIP 438
           E QF+Q+  +V  ++ QRM  W+K+G+ND+D+KRMKF   D   A NT+LI+INDVS++ 
Sbjct: 412 EIQFQQIATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFAPNTRLIKINDVSEVS 471

Query: 439 VDAHEDISGKF-HMRELNMTQSLKPGQLMSLSYTHSEK-GLDICIHYPDGYNMESFVECF 496
            D   D   +F H++    T SL    LMSLSYTH E+ GL+ICIHYPDGYNME+FV+CF
Sbjct: 472 FD---DNDIRFPHIKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFVDCF 528

Query: 497 QSFIED 502
           +SF+E+
Sbjct: 529 ESFMEE 534

>Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}
           YPL272C (REAL)
          Length = 518

 Score =  464 bits (1195), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 251/525 (47%), Positives = 337/525 (64%), Gaps = 34/525 (6%)

Query: 2   SFRSLGGFEKKILSQSLEGHRNGVVFGAMYST-----TPEEW-SDDATLLTYK---DXXX 52
           +FR L  FEKK+L+QSL   RNG +F + YS         +W SD+ TL T     D   
Sbjct: 3   TFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSSSKEADADWHSDEVTLGTNSSKDDSRL 62

Query: 53  XXXXXXXXXAKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGA 112
                     K+I     LF T+NE  E+AP+K++K  +++N + F + KD+ VNC +G 
Sbjct: 63  TLPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHWGV 122

Query: 113 PP-YLLRHIFNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLN 171
           PP YLLRH FN+T F PGS   LW +YV+DETL+VFHGHDVLFDIFSAANFHK+FL+ LN
Sbjct: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELN 182

Query: 172 SI-SKSGSKLSTIFKLEKAVLP--PFPKSIYDNAKLRLPAKAADLFNLQTQSFFKSLYFN 228
           SI S S S    +F +         FPKSIYD+AKLRLPA    + + QTQSFFKS+++N
Sbjct: 183 SITSVSRSDDRVLFDINDVNFAELSFPKSIYDSAKLRLPAMTPQILHKQTQSFFKSIFYN 242

Query: 229 AVKKPLDYINSN-------PPQQLKEYRTRYADILRTDNNLCGTTIFGRILPKRLESLDC 281
            +K+P  Y+ +        P  QLK    RY DIL T+++LCGTT+FG +  +R   L  
Sbjct: 243 TLKRPFGYLTNQTSFSSPAPTSQLK----RYNDILNTNSSLCGTTVFGIVNNQRFSYLKS 298

Query: 282 IFKQQNICLKSFVCGITMLCLKPIVKNYTGSITFCVPVDLRSSLEASSEFGMFYKDIRVE 341
           I  Q++ICL+SF+CGI M+CLKP+VK+++G+I F +P+DLR  L      G+F+K++R+E
Sbjct: 299 IVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGESLGLFFKELRIE 358

Query: 342 CPLSLIDDKNFNSLTVYNGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALRQRMKA 401
           CPLSLIDD+    L++     +S       +  + E+L+EYQF +VT HV   +  ++K+
Sbjct: 359 CPLSLIDDE----LSINEFLVNSNDNENNDNDEFNEKLMEYQFNKVTKHVSNYIMTKLKS 414

Query: 402 WEKFGFNDDDIKRMKFGSDD----TATNTKLIQINDVSDIPVDAHEDISGKFHMRELNMT 457
           WE+ GFNDDDI+RMK+ +DD      + TKLIQINDVSDI +    D    F +     T
Sbjct: 415 WERNGFNDDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMSND-DKSFKIVSSGFT 473

Query: 458 QSLKPGQLMSLSYTHSEK-GLDICIHYPDGYNMESFVECFQSFIE 501
            S+    LMSLSYT+ E  GL+ICIHYPD YN+ESFVECF+SFIE
Sbjct: 474 NSINRPTLMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518

>YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON}
           Putative protein of unknown function; gene expression
           induced in response to ketoconazole; YPL272C is not an
           essential gene
          Length = 517

 Score =  458 bits (1178), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 248/525 (47%), Positives = 339/525 (64%), Gaps = 35/525 (6%)

Query: 2   SFRSLGGFEKKILSQSLEGHRNGVVFGAMYSTT-----PEEW-SDDATLLTYK---DXXX 52
           +FR L  FEKKIL+QSL   RNG +F + YS +       +W SD+ TL T     D   
Sbjct: 3   TFRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDSRL 62

Query: 53  XXXXXXXXXAKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGA 112
                     ++I     LF T+NE+ EF P+K++K  +++N + F + KD+ VNC +G 
Sbjct: 63  TLPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGV 122

Query: 113 PP-YLLRHIFNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLN 171
           PP YLLRH FN+T F PGS   LW +YV+DE L+VFHGHDVLFDIFSAANFHK+FL+ LN
Sbjct: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELN 182

Query: 172 SISK-SGSKLSTIFKLEKAVLPP--FPKSIYDNAKLRLPAKAADLFNLQTQSFFKSLYFN 228
            IS  + S+   +F +    L    FPKSIYD+AKL LPA    +F+ QTQSFFKS+Y+N
Sbjct: 183 EISTVTHSEDRILFDVNDINLSELKFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIYYN 242

Query: 229 AVKKPLDYI-------NSNPPQQLKEYRTRYADILRTDNNLCGTTIFGRILPKRLESLDC 281
            +K+P  Y+       +S    QLK    +Y DIL    +LCGTT+FG +  +R   L  
Sbjct: 243 TLKRPFGYLTNQTSLSSSVSATQLK----KYNDILNAHTSLCGTTVFGIVNNQRFNYLKS 298

Query: 282 IFKQQNICLKSFVCGITMLCLKPIVKNYTGSITFCVPVDLRSSLEASSEFGMFYKDIRVE 341
           I  Q++ICL+SF+CGI M+CLKP+VK+++G+I F +P++LR+ L      G+F+K++RVE
Sbjct: 299 IVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHLGLGGSLGLFFKELRVE 358

Query: 342 CPLSLIDDKNFNSLTVYNGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALRQRMKA 401
           CPLSLIDD+        N + +++    + D  + E+L+EYQF +VT HV   +  ++++
Sbjct: 359 CPLSLIDDE-----LSANEFLTNSNDNEDNDDEFNERLMEYQFNKVTKHVSGFIMAKLRS 413

Query: 402 WEKFGFNDDDIKRMKFGSDD----TATNTKLIQINDVSDIPVDAHEDISGKFHMRELNMT 457
           WEK GFNDDDI+RMK+ +DD      + TKLIQINDVSDI +  + D    F +     T
Sbjct: 414 WEKNGFNDDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGD-DKSFKIVSTGFT 472

Query: 458 QSLKPGQLMSLSYTHSEK-GLDICIHYPDGYNMESFVECFQSFIE 501
            S+    LMSLSYT+ E+ GL+ICIHYPD YN+ESFVECF+SFIE
Sbjct: 473 SSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517

>Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C
           (REAL)
          Length = 516

 Score =  457 bits (1176), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 245/525 (46%), Positives = 338/525 (64%), Gaps = 36/525 (6%)

Query: 2   SFRSLGGFEKKILSQSLEGHRNGVVFGAMYSTT-----PEEW-SDDATLLTYK---DXXX 52
           +FR L  FEKK+L+QSL   RNG +F + YS +       +W SD+ TL T     D   
Sbjct: 3   TFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKDDSRL 62

Query: 53  XXXXXXXXXAKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGA 112
                     ++I     LF TINE+ EF P++++K  +++N + F + KD+ VNC +G 
Sbjct: 63  TLPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHWGV 122

Query: 113 PP-YLLRHIFNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLN 171
           PP YLLRH FN+T F PGS   LW +YV+DETL+VFHGHDVLFDIFSAANFHK+FL+ LN
Sbjct: 123 PPPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELN 182

Query: 172 SISK-SGSKLSTIFKLEKAVLPP--FPKSIYDNAKLRLPAKAADLFNLQTQSFFKSLYFN 228
           +IS  +  +   +F +    +    FPKSIYD+AKL LPA    +F+ QTQSFFKS+++N
Sbjct: 183 NISSVTHYEDRILFDINNVSISDLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIFYN 242

Query: 229 AVKKPLDYIN-----SNPPQ--QLKEYRTRYADILRTDNNLCGTTIFGRILPKRLESLDC 281
            +K+P  Y+      S+P    QLK    +Y DIL   ++LCGTT+FG +  +R   L  
Sbjct: 243 TLKRPFGYLTNQTSISSPASATQLK----KYNDILNAHSSLCGTTVFGIVSNQRFNYLKS 298

Query: 282 IFKQQNICLKSFVCGITMLCLKPIVKNYTGSITFCVPVDLRSSLEASSEFGMFYKDIRVE 341
           I  Q++ICL+SF+CGI M+CLKP+VK+++G+I F +P+DLR  L      G+F+K++R+ 
Sbjct: 299 IVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGESLGLFFKELRIA 358

Query: 342 CPLSLIDDKNFNSLTVYNGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALRQRMKA 401
           CPLSLIDD+    L+V     +S     +++   K  L+EYQF  VT HV + +  ++K+
Sbjct: 359 CPLSLIDDE----LSVNEFLANSNDNEEDEEFDEK--LMEYQFNNVTKHVSSFIMAKLKS 412

Query: 402 WEKFGFNDDDIKRMKFGSDD----TATNTKLIQINDVSDIPVDAHEDISGKFHMRELNMT 457
           WEK GFNDDDI+RMK+ +DD      + TKL+QINDVSDI +  + D    F +     T
Sbjct: 413 WEKNGFNDDDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMNND-DKSFKIVSSGFT 471

Query: 458 QSLKPGQLMSLSYTH-SEKGLDICIHYPDGYNMESFVECFQSFIE 501
            S+    L+SLSYT+  E GL+ICIHYPD YN+ESFVECF+SFIE
Sbjct: 472 SSINRPTLLSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516

>KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa]
           {ON} Anc_6.8 YPL272C
          Length = 508

 Score =  443 bits (1140), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 230/519 (44%), Positives = 329/519 (63%), Gaps = 29/519 (5%)

Query: 1   MSFRSLGGFEKKILSQSLEGHRNGVVFGAMYSTTPEEWSDDATLLTYKDXXXXXXXXXXX 60
           M+ R+L  +E+KIL +++   RNGV+F A YS + EEW DD TLLT KD           
Sbjct: 1   MTLRTLSSYERKILDETIRRERNGVIFTASYSASSEEWGDDTTLLTLKDSRPTIAILTKA 60

Query: 61  XAKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGAPPYLLRHI 120
             ++IS HVELFTTINE  EF  +K IK ++++N + F SYKDE +NC  G PPYLLRHI
Sbjct: 61  IQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGCPPYLLRHI 120

Query: 121 FNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLNSISKS---G 177
           F+   F PGS   LW ++++DE+LV+FHG D+LFDIFSAANFHK+ L+  N ++      
Sbjct: 121 FDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLKETNIVANEPLDS 180

Query: 178 SKLSTIFKLEKAVLP----PFPKSIYDNAKLRLPAKAADLFNLQTQSFFKSLYFNAVKKP 233
           S+   IF LE ++         KSIYDN ++ LPA + DLFNLQTQSFFKS++ + VKKP
Sbjct: 181 SESDIIFSLENSIKKINNLKLSKSIYDNPRIHLPATSPDLFNLQTQSFFKSVFHSTVKKP 240

Query: 234 LDYINSN-------PPQQLKEYRT--RYADILRTDNNLCGTTIFGRILPKRLESLDCIFK 284
           + Y+ +N           L    T  +Y DI   +  L  TT+FG+I  +R E L+ +  
Sbjct: 241 IHYLVANVRTKEVTSDNTLSRVTTVQKYTDIFDYNTTLNNTTVFGKITRQRYEYLNSLIT 300

Query: 285 QQNICLKSFVCGITMLCLKPIVKNYTGSITFCVPVDLRSSL-EASSEFGMFYKDIRVECP 343
            Q IC KSF+ GI MLCLKP ++N+ GS+ F + ++LR  L E++ EFG+FYKD+ ++ P
Sbjct: 301 NQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFLKESNIEFGLFYKDVLIDVP 360

Query: 344 LSLIDDKNFNSLTVYNGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALRQRMKAWE 403
           LSLIDD    +  + +GY        + DP   E++LE+QFK+VT  V   + +R+  + 
Sbjct: 361 LSLIDD----NAVMLSGYRD----FSDNDPDLTEKILEFQFKRVTSLVKDLIERRISKFS 412

Query: 404 KFGFNDDDIKRMKFGSDDTATNTKLIQINDVSDIPVDAHEDISGKFHMRELNMTQSLKPG 463
             GFNDDDI++MK+G    A +TK+I++ D S++ + + +   GK+ +   N T+SL+  
Sbjct: 413 TMGFNDDDIRQMKYGK--PAEDTKIIRLFDTSEVSLGSGKR-DGKYILHNTNFTKSLRKN 469

Query: 464 QLMSLSYTHSEK-GLDICIHYPDGYNMESFVECFQSFIE 501
              S+SYT  +  GL++C+ +PD  +ME+FVECFQSFIE
Sbjct: 470 DFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFIE 508

>NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8
          Length = 515

 Score =  345 bits (886), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 202/524 (38%), Positives = 305/524 (58%), Gaps = 31/524 (5%)

Query: 1   MSFRSLGGFEKKILSQSLEGHRNGVVFGAMYS----TTPEEWSDDATLLTYKDXXXXXXX 56
           M  R L  +E K+L Q+L+G RNGV F A Y      +    SD++TL++ KD       
Sbjct: 1   MCSRQLSEYEVKLLEQTLQGKRNGVAFAAKYGRNYDDSSLSSSDESTLVSLKDRRLTLSV 60

Query: 57  XXXXXAKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGAPPYL 116
                  +I  H+EL+T I+E   ++ V EI+A++VI+ +TF S KDE +NC  G PPYL
Sbjct: 61  ITRVLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLGPPPYL 120

Query: 117 LRHIFNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLNSI--- 173
           LRHIFN++ F+ G    LW++Y++DET ++FHG D+LFD FSAA FHK FL  +NS    
Sbjct: 121 LRHIFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSYMSS 180

Query: 174 ---SKSGSKLSTIFKLEKA-----VLPPFPKSIYDNAKLRLPAKAADLFNLQTQSFFKSL 225
              SK    L  +F+L  +     +    P+SIYD          A +FN QT+SFFKSL
Sbjct: 181 IVSSKQKKPLDYLFQLSSSADLIKIYDEIPRSIYDYDSSPFAPLTAVMFNDQTKSFFKSL 240

Query: 226 YFNAVKKPLDYINSNPP-----QQLKEYRTR-YADILRTDNNLCGTTIFGRILPKRLESL 279
           Y NAVKKP+++I +        QQ+KE  T  Y + +    +LCG TIFG I   R   L
Sbjct: 241 YLNAVKKPIEFITNTSSQVKTYQQIKEAETEGYLNPMGIHRSLCGNTIFGTISSCRFNEL 300

Query: 280 DCIFKQQNICLKSFVCGITMLCLKPIVKNYTGSITFCVPVDLRSSLEASSEFGMFYKDIR 339
                ++ I LKS +CG+ M+ LKP + +++ ++ F + V+LR  +  S  FG++Y+DI 
Sbjct: 301 TEKATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSKSKTFGLYYRDII 360

Query: 340 VECPLSLIDDKNFNSLTVYNGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALRQRM 399
           +ECPLSLIDD+       ++GY    V +  ++    E++ E QFK VT ++   + +++
Sbjct: 361 IECPLSLIDDRAIQ----FSGY-RDHVGITAQELETYEKVYEQQFKDVTTYIQNVMNEKI 415

Query: 400 KAWEKFGFNDDDIKRMKFGSDDTATNTKLIQINDVSDIPVDAHEDISGKFHMRELNMTQS 459
             W+     D+DIK MK   D   +  ++IQIND+++I ++ +   +  + ++  +M  S
Sbjct: 416 GYWK----TDNDIKMMKMMDDMHQSKDEIIQINDLTEIDINENLSQNDPYCVKSSSMVTS 471

Query: 460 LKPGQLMSLSYTHSE-KGLDICIHYPDGYNMESFVECFQSFIED 502
           L   ++ S+SYTH E  GL I IH P   +MESFVE FQ+F+++
Sbjct: 472 LSKKEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFLDE 515

>TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6.8
           YPL272C
          Length = 509

 Score =  343 bits (881), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 198/527 (37%), Positives = 298/527 (56%), Gaps = 56/527 (10%)

Query: 3   FRSLGGFEKKILSQSLEGH-RNGVVFGAMYSTTPEEWSDDATLLTYKDXXXXXXXXXXXX 61
            R L   EK+ L  SLE   R+G V    + +   + SDDATLL+ KD            
Sbjct: 12  LRPLSSVEKRFLGNSLESETRHGSVCSGKWVSNSLDISDDATLLSSKDKPLTISLVSRAL 71

Query: 62  AKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGAPPYLLRHIF 121
             +IS+H+E+FTTIN+  EF  + +I   +V++++ F + KDE VNC  GAPPYL+ +IF
Sbjct: 72  KILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHSGAPPYLINYIF 131

Query: 122 NQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLNSISKSGSKLS 181
           +   FQP S   LWQ+++V+ +LVVF+G D LFDIF+ ANF K+  + +NS+     ++ 
Sbjct: 132 SLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLFEIINSLPYENKEIQ 191

Query: 182 --TIFKL---EKAVLPPFPKSIYDNAKLRLPAKAADLFNLQTQSFFKSLYFNAVKKPLDY 236
              IFKL          FPKSIYDN  L LPA   +LFNLQTQSFFKS+Y N  KK  DY
Sbjct: 192 DDIIFKLPNIRNISKINFPKSIYDNPMLHLPATKPELFNLQTQSFFKSIYLNTFKKSFDY 251

Query: 237 INSNPPQQLKEYRTR-----YADILRTDNNLCGTTIFGRILPKRLESLDCIFKQQNICLK 291
           +N      +   R       Y +IL  ++ +    + G +  +R   L  +   + I LK
Sbjct: 252 LNFTQQTPIILARNHNISKNYNEILHLNSIVKSELVTGNVSMERYLQLLKLIDAEKIDLK 311

Query: 292 SFVCGITMLCLKPIVKNYTGSITFCVPVDLRSSL---------------EASSEFGMFYK 336
           SF C I ++CLK ++  + GSI F +P +LRS                 ++++E G+ YK
Sbjct: 312 SFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSSGPEDSANELGIIYK 371

Query: 337 DIRVECPLSLIDDKNFNSLTVYNGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALR 396
           DI VE PL LI+                            E ++E QFK V +++  +++
Sbjct: 372 DIYVEVPLKLIEKIG------------------------NEDVVEEQFKIVCNYINESIQ 407

Query: 397 QRMKAWEKFGFNDDDIKRMKFGSDDTATNTKLIQINDVSDIPVDAHEDISGKFHMRELNM 456
           +R+KAWEK GFNDDDIKRMKFG +       +I++ND++ + +   +D    FH+ +L++
Sbjct: 408 KRIKAWEKNGFNDDDIKRMKFGYEQVGN---IIEVNDLTSLDLSCSKD--SLFHIEDLSL 462

Query: 457 TQSLKPGQLMSLSY-THSEKGLDICIHYPDGYNMESFVECFQSFIED 502
           T++LK  Q++SLS+ +++  GL++CI+Y   Y M+ F++CFQSF+E+
Sbjct: 463 TRNLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDFIDCFQSFMEN 509

>Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to
           Ashbya gossypii ACR018C
          Length = 509

 Score =  325 bits (833), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 188/510 (36%), Positives = 279/510 (54%), Gaps = 20/510 (3%)

Query: 2   SFRSLGGFEKKILSQSLEGHRNGVVFGAMYSTT---PEEWSDDATLLTYKDXXXXXXXXX 58
           S R L   EK    +     RNG+VF   YS+     E WSDD TL   +D         
Sbjct: 7   SIRDLSSVEKIFHKEVYTSRRNGIVFAVNYSSNKCESERWSDDITLSNLRDSRLFDGQIS 66

Query: 59  XXXAKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGAPPYLLR 118
                MI ++VEL  TI +  +FAP + I+ ++V+  + F +YKDE + C+ G PPY+LR
Sbjct: 67  NALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNGIPPYILR 126

Query: 119 HIFNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLNSISKSGS 178
           +I     F+ G    LW++ +VD T+V+ H H+V+FD+F+AANFH  F + L+   K   
Sbjct: 127 NILENNKFEFGRP--LWELIIVDYTMVILHCHEVMFDLFAAANFHLKFQKALSQFPKDTH 184

Query: 179 KLSTIFKLEKAVLPPFPKSIYDNAKLRLPAKAADLFNLQTQSFFKSLYFNAVKKPLDYIN 238
            L  +F  E   L    K+ +D    ++         LQ  S  K  Y   VKK L+ I 
Sbjct: 185 ALDILFVYEGNELQ-LSKTNFDGMS-QISVSPVQSLPLQCISVLKGAYRTTVKKSLNVIR 242

Query: 239 SN--PPQQLKEYRTRYADILRT---DNNLCGTTIFGRILPKRLESLDCIFKQQNICLKSF 293
            N     Q+  Y +  +D+ ++    N LCGTT+ G +  +RL SL  +   +N+C+ S 
Sbjct: 243 RNFVANNQITTYESSKSDVFKSMFNPNTLCGTTVSGSLNAERLASLLELTSSENVCMTSV 302

Query: 294 VCGITMLCLKPIVKNYTGSITFCVPVDLRSSLEASSEFGMFYKDIRVECPLSLIDDKNFN 353
           +C IT+L LKP+++ + GSITF VP+D+R  LE   + G+ Y ++ VECPLS I+DK+F 
Sbjct: 303 LCAITLLSLKPLIRKFNGSITFVVPIDIREKLEI-FDLGVSYTNLMVECPLSFINDKDFQ 361

Query: 354 SLTVYNGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALRQRMKAWEKFGFNDDDIK 413
             TV +G   S  K+    P Y E LLEYQFKQ+T HV+ +L+++ +AW+K  F+   +K
Sbjct: 362 H-TVSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTSHVMNSLKEKKQAWQKRRFDMSSLK 420

Query: 414 RMKFGSDDTATNTKLIQINDVSDIPVDAHEDISGKFHMRELNMTQSLKPGQLMSLSYTHS 473
             K    +     K I+IN      VD  E   G+FH + +N T SL    L+S+S    
Sbjct: 421 GKKLRRSNKIIRGKFIEIN-----LVDMGEAQDGQFHTKNVNFTSSLGSKCLISVSCAIL 475

Query: 474 EK-GLDICIHYPDGYNMESFVECFQSFIED 502
              G++I +HYP+  +M++FVECFQ  +ED
Sbjct: 476 RGVGMNIFMHYPESNDMDAFVECFQILLED 505

>KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272C Hypothetical ORF
          Length = 518

 Score =  305 bits (780), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 178/512 (34%), Positives = 279/512 (54%), Gaps = 19/512 (3%)

Query: 3   FRSLGGFEKKILSQSLEGHRNGVVFGAMYSTT--PEEWSDDATLLTYKDXXXXXXXXXXX 60
           +R+L   EK IL ++  G +NGV+F A Y      ++ SD+ TL +  +           
Sbjct: 8   YRNLTPTEKTILCETATGVKNGVLFSATYYKNFPNKDLSDNETLRSDMNQRLSDSMIWKA 67

Query: 61  XAKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGAPPYLLRHI 120
             K+I +H EL   ++  LEF PV +I  E+V+  + F  Y DE VNC  G PPYLLRHI
Sbjct: 68  LLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYNGVPPYLLRHI 127

Query: 121 FNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLNSISKSGSKL 180
           F++  F  G    LWQ++V+D T+VVFHGHDVLFD F+AANFHK+FLQ LNS+S+S +  
Sbjct: 128 FDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQALNSLSESCTSP 187

Query: 181 STIFKLEKAVLPPFPKSIYDNAKLRLPAKAADLFNLQTQSFFKSLYFNAVKKPLDYINSN 240
             +FK  K +LP  P++++   + +  +   D F  Q+Q+  +SLY  A+KKPL +I S 
Sbjct: 188 RPVFKGGK-ILPTLPRALFQKQEPQAASSITDAFYSQSQAILRSLYNLAIKKPLRFIESG 246

Query: 241 PPQQLKEYRTRYADILRTDNNLCGTTIFGRILPKRLESLDCIFKQQNICLKSFVCGITML 300
             +   E  +   + L   N+LCGT +FG I   R + L  I     I +K+F+   T+ 
Sbjct: 247 RIEHSTEQHSGTPEPLNYPNHLCGTVVFGTISTPRFKILKGILNDHKISMKTFIISATLF 306

Query: 301 CLKPIVKNYTGSITFCVPVDLRSSLEASSEFGMFYKDIRVECPLSLIDDKNFNSLTVY-- 358
           CL+P++ +    ITF +P++LR  +  SS  G++++++ +ECPL      +  S   Y  
Sbjct: 307 CLQPVLDSSEDKITFSLPINLRDLIPWSSPLGIYHRNVLIECPLGTAGRNSNCSAGSYVS 366

Query: 359 -----NGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALRQRMKAWEKFGFNDDDIK 413
                 G   S       D    E L    F++   HV   L++ ++  E   F D D+ 
Sbjct: 367 NPELLEGMTLSDANQTNADQADPESL----FERTVTHVSNELKKALQDLETGKFKDMDMM 422

Query: 414 RMKFGSD--DTATNTKLIQINDVSDIPVDAHEDISGKFHMRELNMTQSLKPGQLMSLSYT 471
           +M+  +     A+ +K+I+IND+S+I  D       ++ + ++  T+S      MS+SY+
Sbjct: 423 KMEQEAKFYAAASGSKIIEINDLSEI--DLSNVNPSQYVVEDICATKSRCNNTFMSISYS 480

Query: 472 HSEK-GLDICIHYPDGYNMESFVECFQSFIED 502
            S   GL++ IHY +   M  FVE F++F+E+
Sbjct: 481 FSSTCGLNLGIHYSEDCEMNYFVESFEAFLEN 512

>Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C -
           Hypothetical ORF [contig 186] FULL
          Length = 519

 Score =  273 bits (699), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 162/515 (31%), Positives = 275/515 (53%), Gaps = 26/515 (5%)

Query: 3   FRSLGGFEKKILSQSLEGHRNGVVFGAMYSTTPEEWSDDATLLTYKDXXXXXXXXXXXXA 62
           +R+L   EK I+ ++  G +NGV+F + Y   P+   + +  ++               A
Sbjct: 8   YRNLTATEKTIICETAAGIKNGVLFSSTYFEGPDNVDNTSPSVSCMKMGKGLPDAIMWQA 67

Query: 63  --KMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGAPPYLLRHI 120
             ++I ++ EL ++IN+ ++F  +  I  ++V+  + F +  DE V+C  G PPYLLRHI
Sbjct: 68  LSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGVPPYLLRHI 127

Query: 121 FNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLNSISK-SGSK 179
           F++  F  G    LWQ++V+D+++VVFHGHDVLFD F+AA FHK+FL+ LNS     G K
Sbjct: 128 FDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALNSFRNVKGQK 187

Query: 180 LSTIFKLEKAVLPPFPKSIYDNAKLRLPAKAADLFNLQTQSFFKSLYFNAVKKPLDYINS 239
              IFK  + ++ P  +S+     + L +   D     +Q+  K+LY  A+KKPL +I S
Sbjct: 188 SDLIFKTREDLI-PLCQSLAAEHNVSLISSVKDQVLTYSQTALKNLYSLAIKKPLRFIES 246

Query: 240 NPPQQLKEYRTRYADILRTDNNLCGTTIFGRILPKRLESLDCIFKQQNICLKSFVCGITM 299
              +      +   D+     +LCGT +FG + P+R+  L  +  +  I  +SF+  +TM
Sbjct: 247 GRLEHSGIPASNPYDLASYAGDLCGTVVFGNVNPERVRGLRALMNESKISFRSFIISVTM 306

Query: 300 LCLKPIVKNYTGSITFCVPVDLRSSLEASSEFGMFYKDIRVECPLSLI--DDKNFNSLTV 357
            CL P+++     I F VP++LR S+  +S+ G+F  ++  ECPL LI  D +  + ++ 
Sbjct: 307 FCLLPVLEPSEEKIIFSVPINLRESIPWASDLGVFQNNVLFECPLDLIKHDIEPCSGIST 366

Query: 358 YNG--------YDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALRQRMKAWEKFGFND 409
           +N          D   V   + DP       +  F+++  HV   L       EK   + 
Sbjct: 367 FNQEFLEGSTLTDVGGVNEDQNDP-------QTVFRRILTHVTTELELAAMRLEKSHSSG 419

Query: 410 DDIKRMKFGSD--DTATNTKLIQINDVSDIPVDAHEDISGKFHMRELNMTQSLKPGQLMS 467
           +D+ + +  +     ++ +K+++IND+  + VD    I  ++ + ++  T S K    MS
Sbjct: 420 EDLIKAEREARYFAASSRSKIVEINDL--LEVDLSSKIHSRYKIGDVCSTSSRKSDTFMS 477

Query: 468 LSYTHSE-KGLDICIHYPDGYNMESFVECFQSFIE 501
           +SY  SE  GL++ IHY +G+NME FVE F+ F++
Sbjct: 478 ISYCSSEISGLNLGIHYSEGFNMEYFVESFEGFLD 512

>ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL272C
          Length = 478

 Score =  264 bits (675), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 162/473 (34%), Positives = 257/473 (54%), Gaps = 28/473 (5%)

Query: 36  EEWSDDATLLTYKDXXXXXXXXXXXXAKMISDHVELFTTINEKLEFAPVKEIKAEEVINA 95
           E WSD +TL++ +               MI ++VE+  T+ +  +FAPV  I+ ++V+  
Sbjct: 26  ETWSDSSTLMSSRCGCLREHQISSALRSMIRENVEMCVTVTDGPKFAPVSRIEYDDVVRV 85

Query: 96  VTFGSYKDEFVNCRFGAPPYLLRHIFNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFD 155
           + F +YKDE + C  G PPY+ RHI N++ F+  +G  LW++Y+ D ++V+FH H+VLFD
Sbjct: 86  IEFQTYKDEAIACHDGIPPYVARHILNKSKFE--AGKPLWEVYIADGSMVIFHCHNVLFD 143

Query: 156 IFSAANFHKIFLQTLNSISKSGSKLSTIFKLEKAVLP-PFPKSIYDNAKLRLPAKAADLF 214
           +F+A NFH  F Q L    K+     T+F  E   L  P          + +P  A+  F
Sbjct: 144 LFAAGNFHVRFQQALQRCEKNEPHNETLFVYEGGPLQLPIDPDACSLPGVDVPYPASSPF 203

Query: 215 NLQTQSFFKSLYFNAVKKPLDYINSNPPQQLKEYRT---RYADILRTDN-NLCGTTIFGR 270
                SF K++   A+K P   + S     L+  R+   R   +L  D  +L GTT+ G 
Sbjct: 204 ----VSFVKNVCRYALK-PFGALASAVTPSLRLNRSSLGRKPFLLTLDKESLYGTTVSGY 258

Query: 271 ILPKRLESLDCIFKQQNICLKSFVCGITMLCLKPIVKNYTGSITFCVPVDLRSSLEASSE 330
           +  K+L+SL  +  ++ +C++SF+C IT+L LKP+++N+ GSI F +P+DLR+    ++ 
Sbjct: 259 LNSKKLDSLLKLISKEEVCVRSFLCAITLLSLKPLIRNFDGSIAFSIPLDLRTESHKTTP 318

Query: 331 FGMFYKDIRVECPLSLIDDKNFNSLTVYNGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDH 390
           FG   K I V+CPL+LIDD+ F SL           K+ +  P + E LLEYQFK+VT H
Sbjct: 319 FGFQSKRILVDCPLALIDDRVFESL-FNRPSKQRKTKLDKNSPKFSEGLLEYQFKRVTTH 377

Query: 391 VVAALRQRMKAWEKFGFNDDDIKRMKFGSDDTATNTKLIQINDVSDIPVDAHEDISGKFH 450
           V+ +L  +           D   + K+ S       K+I+IN      VD     S +F 
Sbjct: 378 VMKSLTAQTSG--------DWTGKRKY-SKCQLRKKKIIEIN-----VVDMGTSPSARFQ 423

Query: 451 MRELNMTQSLKPGQLMSLSYTHSEK-GLDICIHYPDGYNMESFVECFQSFIED 502
           ++ +N T SL     MSLS       G+++C+HY +  +M+ FV+CFQ+F+++
Sbjct: 424 IKNMNFTDSLGSETFMSLSCALMRGVGMNMCMHYLERDSMDMFVDCFQTFLDE 476

>Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741
           nt, 247 aa]
          Length = 246

 Score =  165 bits (418), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 93/249 (37%), Positives = 145/249 (58%), Gaps = 18/249 (7%)

Query: 256 LRTDNNLCGTTIFGRILPKRLESLDCIFKQQNICLKSFVCGITMLCLKPIVKNYTGSITF 315
           LR D+ +    +FG I  +R   L  + ++  ICL+S +CGI MLC KP ++N+ G+I F
Sbjct: 14  LRKDSYIYNRVLFGTIAAERFNRLKALIRKGRICLRSVICGIVMLCTKPNIQNFDGNIRF 73

Query: 316 CVPVDLRSSLEASSEFGMFYKDIRVECPLSLIDDKNFNSLTVYNGYDSSAVKMPEKDPGY 375
            + VD++  ++ SS+FG+  K+I V+CPL LIDDK+      Y   DS ++K  +     
Sbjct: 74  SIGVDMKPIVDDSSQFGILKKNIIVDCPLKLIDDKH------YKDTDSESIKNGD----- 122

Query: 376 KEQLLEYQFKQVTDHVVAALRQRMKAWEK-FGFNDDDIKRMKFGSDDTATNTKLIQINDV 434
              +LE QF++VTD V   L  ++++  K F  N+         S    +++K+IQIND+
Sbjct: 123 ---ILEIQFRKVTDFVTEELSNKLQSMAKHFKRNNCPFNFSSINSQ--ISDSKVIQINDL 177

Query: 435 SDIPVDAHEDISGKFHMRELNMTQSLKPGQLMSLSY-THSEKGLDICIHYPDGYNMESFV 493
           +DIP    E     +   +L +T+ L P + MSLSY T+S   + I IHY +   M+SFV
Sbjct: 178 TDIPFTTTEQNPNGYSFHDLKVTEGLSPNESMSLSYITNSNSAMSISIHYTETKYMDSFV 237

Query: 494 ECFQSFIED 502
           ECF++FIE+
Sbjct: 238 ECFRTFIEN 246

>Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON}
           complement(429..848) [420 nt, 140 aa]
          Length = 139

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 60/130 (46%), Gaps = 1/130 (0%)

Query: 3   FRSLGGFEKKILSQSLEGHRNGVVFGAMYSTTPEE-WSDDATLLTYKDXXXXXXXXXXXX 61
            R L   EK  L Q+ EG  NG++F    S   E+  SDDATL T  +            
Sbjct: 2   LRILNESEKSALKQTSEGSMNGIIFSVKISKKCEDNLSDDATLHTTGESGNLQLLLLKSL 61

Query: 62  AKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGAPPYLLRHIF 121
             +I  + EL TT++E L F  + E+K  +V+  + +   K +      G    L+  I+
Sbjct: 62  KLLIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRKFDINEGLSGPSSSLINSIY 121

Query: 122 NQTTFQPGSG 131
             + FQPGSG
Sbjct: 122 YHSNFQPGSG 131

>Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W -
           Hypothetical ORF [contig 43] FULL
          Length = 460

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 82/299 (27%), Positives = 128/299 (42%), Gaps = 53/299 (17%)

Query: 73  TTINEKLEFAPVKE-IKAEEVINAVTFGSYKDEFVNCRFGAPPYLLRHIFNQTTFQPGSG 131
            T  E     P+ E I  E+V+    +G   ++  N            IF +  F  GSG
Sbjct: 57  VTKGELPSLEPINEQILLEQVLEYTDYGLLDEDICN-----------KIFREVEFTYGSG 105

Query: 132 NVLWQIYVVDE--TLVVFHGHDVLFDIFSAANFHKIFLQTLNSISKSGSKLSTIFK--LE 187
             LW++ V+++  TLV+   H V+ D  S   F K FL +LN+ + +      +F+  + 
Sbjct: 106 KPLWKVLVLNDRRTLVLCTDH-VILDGLSTVAFWKKFLGSLNATASTSLVSEVVFEPSVH 164

Query: 188 KAVLPPFPKSIYDNAKLRLPAKAADLFNLQTQSFFKSLYFNAVKKPLDYINS--NPPQQ- 244
            +V+P  P   YD    R+P      F    ++  + L F A  K +D I +   PP Q 
Sbjct: 165 NSVVPQHP---YD----RIPVT---FFETMARALVQVLVFLAFLK-IDLITTLFVPPLQK 213

Query: 245 ----LKEYR-TR---YAD-ILRTDNNLCGTTIFGRILPKRLESLDCIFKQQNICLKSFVC 295
                K Y+ TR    AD  +R DN L        I P++L++L  + K  N+ L S + 
Sbjct: 214 QYLKFKNYQFTRDYLAADGSVRNDNRLLKIV----IPPQKLQNLLALCKGHNVSLSSLIL 269

Query: 296 GITMLCLKPI-VKNYTGS-ITFCVPVDLRSSLE-------ASSEFGMFYKDIRVECPLS 345
            I    LK +    + G+     +P++ R  +E        S EFG F     +E  LS
Sbjct: 270 AIMANSLKHVDSSQFDGTRAKISIPMNTRPFIEKTLLAEPKSIEFGNFIVGGELEYDLS 328

>TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 35/76 (46%), Gaps = 1/76 (1%)

Query: 395 LRQRMKAWEKFGFNDDDIKRMKFG-SDDTATNTKLIQINDVSDIPVDAHEDISGKFHMRE 453
           L++ MK       N           S+ T + T L+Q N VS++P + H + S    +  
Sbjct: 61  LKRHMKVHPASTHNLHSTSTTSLNISNSTMSMTSLLQSNSVSNLPSNIHVNSSSSSSLTN 120

Query: 454 LNMTQSLKPGQLMSLS 469
           L M  SL+  QLM LS
Sbjct: 121 LFMKASLQQPQLMPLS 136

>KAFR0D00230 Chr4 complement(28545..29801) [1257 bp, 418 aa] {ON}
           Anc_1.14 YCL052C
          Length = 418

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 46/106 (43%)

Query: 298 TMLCLKPIVKNYTGSITFCVPVDLRSSLEASSEFGMFYKDIRVECPLSLIDDKNFNSLTV 357
           T L LK   K  T    + +P       ++SS       +   +C  S+I+    + L V
Sbjct: 25  THLLLKGSEKGVTVQERWIIPRTGGHDDQSSSRITWRGNNPLSDCSQSVIEPILNHGLNV 84

Query: 358 YNGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALRQRMKAWE 403
           YN  D+SA  +  K P YK   L+    Q+TD++ + +      W+
Sbjct: 85  YNDVDASAKGIFVKTPVYKVLHLDKMESQITDYLPSDVDLTFMEWK 130

>SAKL0G15004g Chr7 (1288241..1289611) [1371 bp, 456 aa] {ON} similar
           to uniprot|P53304 Saccharomyces cerevisiae YGR212W SLI1
           N-acetyltransferase confers resistance to the
           sphingolipid biosynthesis inhibitor myriocin (ISP-1) by
           inactivating it co-operates with Ypk1p in mediating
           resistance to myriocin converts myriocin into N-acetyl-
           myriocin
          Length = 456

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 96/223 (43%), Gaps = 19/223 (8%)

Query: 116 LLRHIFNQTTFQPGSGNVLWQIYVVD--ETLVVFHGHDVLFDIFSAANFHKIFLQTLNSI 173
           L+  IF    F+      +W+I  ++   +LV+   H + FD  S   F +  ++ LN+I
Sbjct: 90  LINQIFRTVKFKYHDDVPIWKILALNGGRSLVLCLEH-LFFDGLSGVKFLENIMEELNTI 148

Query: 174 SKSGSKLSTIFKLE-KAVLPPFPKSIYD-NAKLRLPAKAADLFNLQTQSFFKSLYFNAVK 231
               +    ++K E K ++P  P S +    K ++    A LF ++  S+      N   
Sbjct: 149 ECFSNYQDIVYKCEGKELVPKHPYSNWPIPWKWKMIRSLAPLF-VKLDSYIGPWVANFTH 207

Query: 232 KPLDYINSN----PPQQLKEYRTRYADILRTDNNLCGTTIFGRILPKRLESLDCIFKQQN 287
                +N N    P    ++   R  D +R DN      +   I  + LE L    K+ N
Sbjct: 208 GS-SMLNFNRYEFPKGIFRDVVKR--DEIRNDN----CQLIFSIPAENLEQLVVKCKKHN 260

Query: 288 ICLKSFVCGITMLCLKPIVKN--YTGSITFCVPVDLRSSLEAS 328
           + L S +  + +  LK +  +  +   +T  VPV+ R+ ++++
Sbjct: 261 VSLTSILISVFIASLKEVDPSMIHGSQVTVDVPVNTRNLIKST 303

>KAFR0E02280 Chr5 (458594..460489) [1896 bp, 631 aa] {ON} Anc_5.66
           YHR171W
          Length = 631

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 50/110 (45%), Gaps = 6/110 (5%)

Query: 376 KEQLLEYQFKQVTDHVVAALRQRMKAWEKFGFNDDDIKRMKFGSDDTATN--TKLIQIND 433
           K++ LE +FK V +     + Q + +++   F D  +KR KF      T    +L+ +N 
Sbjct: 98  KQKFLEDRFKDVWERSKHDINQAV-SFDMISFAD--LKRYKFYYWLCVTCFIPQLLSVNI 154

Query: 434 VSDIPVDAHEDISGKFHMRELNMTQSL-KPGQLMSLSYTHSEKGLDICIH 482
           +  +P+D  E+I   F+M        L K G ++  S    E    +CI 
Sbjct: 155 IKKVPIDGVEEIQKWFNMHSKEWVCLLDKKGHILKYSVDAVENSRALCIR 204

>Kpol_1010.49 s1010 (113037..114482) [1446 bp, 481 aa] {ON}
           (113037..114482) [1446 nt, 482 aa]
          Length = 481

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 52/118 (44%), Gaps = 25/118 (21%)

Query: 76  NEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGAPPYLLRHIFNQTTFQPGSGNVLW 135
           NEK+ FA + E K  + ++     S                   IF + +F+  +   +W
Sbjct: 75  NEKIYFADIVEYKNWDSVSESNINS-------------------IFQEYSFEYFTDKPVW 115

Query: 136 QIYVVDET--LVVFHGHDVLFDIFSAANFHKIFLQTL---NSISKSGSKLSTIFKLEK 188
           +I V++    L++   H VLFD  S  NF   F+ +L   +SIS+  +    IF  E+
Sbjct: 116 KILVLENQNQLLMLLDH-VLFDGMSGINFWNSFISSLPSIDSISEDANANELIFPFEE 172

>ZYRO0C11484g Chr3 (890770..891540) [771 bp, 256 aa] {ON} similar to
           uniprot|P53315 Saccharomyces cerevisiae YGR248W
          Length = 256

 Score = 30.4 bits (67), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 56/141 (39%), Gaps = 23/141 (16%)

Query: 116 LLRHIFNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLNSISK 175
           L   +     F P      WQ+Y VDE +V     D  +  F            LN ++ 
Sbjct: 49  LYEALIQDQEFAPKVRWSQWQLYFVDERIVPLDDPDSNYGAFKNG--------VLNPLAH 100

Query: 176 SGSKLS---TIFKLEKAVLPPFPKSIYDNAKL---RLPAKAADLFNL------QTQSFF- 222
           SG  L+   T+F + ++++   P      AK     LP+   DL  L       T S F 
Sbjct: 101 SGGHLNLGPTVFAINESLVNGGPAEKDQLAKEYADELPSSPFDLLLLGCGPDGHTCSLFP 160

Query: 223 --KSLYFNAVKKPLDYINSNP 241
             K  Y   +K+P+ +++ +P
Sbjct: 161 GEKHRYLLDLKEPVAHVSESP 181

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,948,663
Number of extensions: 2437709
Number of successful extensions: 6610
Number of sequences better than 10.0: 40
Number of HSP's gapped: 6690
Number of HSP's successfully gapped: 40
Length of query: 503
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 389
Effective length of database: 40,409,475
Effective search space: 15719285775
Effective search space used: 15719285775
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)