Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G046206.9ON39239219990.0
ZYRO0F00462g6.9ON39338614140.0
NCAS0F001906.9ON41139713480.0
NDAI0K029006.9ON43840613410.0
Kpol_1045.786.9ON39239112561e-172
TPHA0M001906.9ON39139012101e-165
SAKL0E00814g6.9ON39840211841e-161
YEL056W (HAT2)6.9ON40140311591e-157
Skud_5.336.9ON40140311521e-156
Suva_5.126.9ON40139811521e-156
KNAG0E009806.9ON41438911411e-154
Smik_5.316.9ON42740511381e-154
CAGL0B03575g6.9ON41939611351e-153
KAFR0L003206.9ON39138511001e-149
KLTH0C11550g6.9ON39837610991e-148
Ecym_30126.9ON39737810941e-148
KLLA0D00814g6.9ON40839610891e-147
ACR017W6.9ON42336910581e-142
Kwal_56.223456.9ON39638310501e-141
TBLA0A071206.9ON40738310101e-135
TPHA0L017208.548ON4194102753e-26
Kpol_1024.398.548ON4174172721e-25
TBLA0H036508.548ON4194172641e-24
NDAI0C055108.548ON4194222641e-24
YBR195C (MSI1)8.548ON4224282622e-24
Smik_2.3358.548ON4224312579e-24
KAFR0I008408.548ON4134122561e-23
Suva_4.4498.548ON4244212542e-23
ZYRO0A13068g8.548ON3974022515e-23
Skud_2.3218.548ON4224132517e-23
NCAS0B021708.548ON4144232402e-21
AEL250C8.548ON4174192357e-21
CAGL0M05291g8.548ON4194122331e-20
Ecym_70428.548ON4144052322e-20
KNAG0A036708.548ON4264212233e-19
TDEL0B029808.548ON4122922233e-19
KLLA0E23541g8.548ON4174012216e-19
KLTH0E12694g8.548ON4182952162e-18
SAKL0H09900g8.548ON4254072137e-18
Kwal_27.120708.548ON4182952127e-18
Kpol_1060.246.276ON4861941596e-11
KAFR0H024508.672ON4171961542e-10
NCAS0G011206.276ON4941761507e-10
Suva_16.1598.672ON4512091444e-09
AEL269C7.534ON4551711444e-09
KLLA0F15598g5.201ON4782081444e-09
ZYRO0E08184g6.276ON5062731392e-08
KNAG0J016808.672ON3981961372e-08
Kpol_1036.658.316ON3712961363e-08
TDEL0A075506.340ON5151861364e-08
YPL151C (PRP46)8.672ON4511601354e-08
ZYRO0F07282g8.672ON4272151354e-08
TDEL0A068906.276ON4472211354e-08
KLLA0C08976g6.325ON9112121365e-08
Skud_16.1318.672ON4511661338e-08
Kwal_26.87768.672ON4331641329e-08
ACR137W8.672ON4252141321e-07
TDEL0A061808.672ON4342121311e-07
SAKL0H15708g8.316ON3682981311e-07
Suva_13.3112.401ON5102951321e-07
SAKL0A01738g6.325ON9092231321e-07
NCAS0D046106.340ON5151821302e-07
NDAI0E024008.672ON4342101292e-07
TPHA0C008608.316ON3783071283e-07
SAKL0H06666g8.672ON4412021283e-07
Smik_6.3488.672ON4511661283e-07
Ecym_55285.429ON4711941274e-07
Suva_4.537.310ON12712121285e-07
NCAS0E037507.310ON12762171285e-07
Skud_4.637.310ON12732111276e-07
SAKL0H16390g8.288ON11401441276e-07
NDAI0I004606.325ON9172381277e-07
TDEL0C023607.310ON12642151268e-07
Ecym_24986.340ON5421781258e-07
YPL247C6.276ON5231851259e-07
NDAI0I003506.340ON5151781259e-07
Suva_3.936.325ON9202381251e-06
KAFR0B057008.316ON3722761231e-06
TDEL0F044308.316ON3673001231e-06
TPHA0E030805.201ON4881321241e-06
CAGL0K09284g6.325ON9112161241e-06
NDAI0H027502.401ON5122451232e-06
AAR057W6.325ON9221821232e-06
NDAI0F012406.276ON5241691222e-06
TPHA0D035906.276ON5981841222e-06
NCAS0B036908.288ON11452051232e-06
AER263C6.340ON5131821212e-06
Kwal_56.236858.288ON11021441213e-06
KAFR0J009805.201ON4801661203e-06
TBLA0C018408.672ON4232211203e-06
ZYRO0A08690g2.401ON5161611204e-06
ABL044C2.469ON5182161204e-06
Skud_3.1336.325ON9162381204e-06
KNAG0G001301.534ON7281531204e-06
TBLA0I022806.325ON9271781204e-06
Smik_6.4516.276ON5231831195e-06
Smik_3.1576.325ON9242381195e-06
Suva_16.606.276ON5261991185e-06
Kpol_1019.307.310ON12522071195e-06
KAFR0J025506.325ON9062381195e-06
TDEL0G033402.401ON5142921186e-06
NCAS0F033405.429ON4481881186e-06
TPHA0G026502.401ON5163051186e-06
KLTH0A07282g6.363ON7252281187e-06
Ecym_21396.276ON4352651177e-06
Ecym_20936.325ON9232121178e-06
Smik_4.457.310ON12702141188e-06
Skud_13.2912.401ON5092931179e-06
TPHA0D038306.325ON9121791171e-05
AGL190W8.316ON3702491151e-05
ADR242C2.401ON5212441161e-05
NCAS0D044806.325ON9152491171e-05
KLTH0D11132g8.672ON4371651151e-05
KLLA0F17237g2.401ON5232451161e-05
ZYRO0D05852g8.316ON3712991151e-05
Smik_15.163.22ON13261101161e-05
TPHA0G016108.672ON4142051151e-05
TPHA0B005904.309ON5881781151e-05
Kwal_23.63246.340ON5141811151e-05
KLLA0F11231g8.672ON4341661151e-05
YCR057C (PWP2)6.325ON9232381161e-05
TBLA0C050107.356ON5721671152e-05
ZYRO0F09922g5.429ON4552061142e-05
KNAG0I025406.325ON9182351152e-05
NDAI0B056305.429ON4351941142e-05
TDEL0A057708.631ON433831142e-05
Kpol_1072.178.672ON4332061142e-05
Kwal_33.151365.201ON4731741142e-05
CAGL0K03861g2.401ON5132951142e-05
Suva_4.4528.544ON8002251142e-05
Ecym_74032.469ON5172391132e-05
Ecym_42808.288ON11321601142e-05
YMR131C (RRB1)2.401ON5112951132e-05
TBLA0A023106.276ON5311921132e-05
KAFR0A003802.401ON5162951132e-05
NDAI0G001501.534ON7222451133e-05
KLLA0E21187g5.429ON4291881123e-05
CAGL0C03608g6.363ON6432351123e-05
CAGL0M02277g8.672ON4271961123e-05
Skud_12.5214.309ON6451781123e-05
KNAG0D007406.276ON5041701123e-05
KAFR0E012303.259ON3692191113e-05
KLTH0B03410g5.201ON4771711123e-05
KLLA0F19734g8.288ON11331511133e-05
Kwal_23.62406.325ON9132121123e-05
Kpol_1028.546.325ON9051751123e-05
KLTH0A06380g6.325ON9152121123e-05
KLTH0F16192g5.429ON4622211113e-05
KLTH0G13068g8.288ON11011511124e-05
Sklu_YGOB_Anc_2.4012.401ON5202931114e-05
KNAG0A012303.22ON13212161124e-05
TDEL0H003707.534ON4652151114e-05
NCAS0F019702.401ON5112451114e-05
AFL157C6.276ON4382131114e-05
AAL157C5.201ON4791491114e-05
SAKL0A02970g6.276ON4152461104e-05
YKL213C (DOA1)1.534ON7151771114e-05
Ecym_42498.316ON3743021105e-05
SAKL0A01276g6.340ON5151851105e-05
KNAG0E021802.401ON5172951105e-05
KNAG0C049505.429ON4401961105e-05
Suva_16.5107.534ON4652081105e-05
AER255C5.429ON4671611106e-05
Ecym_25236.363ON6462521106e-05
KNAG0B064504.309ON6341771107e-05
Kpol_1048.598.544ON8501371107e-05
Kwal_47.178272.401ON5232391098e-05
ZYRO0D08206g6.340ON5151701098e-05
AGL234W6.363ON6292521098e-05
TPHA0E017905.429ON4411941089e-05
CAGL0H00781g6.276ON5131771089e-05
Kwal_56.244787.310ON12961841099e-05
CAGL0A02772g5.429ON4412641089e-05
Smik_12.2567.356ON5761701089e-05
Smik_11.101.534ON7171771081e-04
Skud_15.163.22ON13321051091e-04
KAFR0E039005.429ON4391961081e-04
Ecym_24018.672ON4262101071e-04
TBLA0A037505.429ON4471911081e-04
ADL184W3.25ON4491531081e-04
KLTH0E09394g2.401ON5222391081e-04
Smik_13.3292.401ON5092931081e-04
NCAS0G043001.534ON7251761081e-04
AFR199C2.431ON3342441061e-04
NDAI0C054908.544ON8592121081e-04
Kpol_1062.325.429ON4661951071e-04
Smik_3.1726.340ON5151811071e-04
ZYRO0G20152g2.431ON3192181061e-04
Skud_11.71.534ON7171291071e-04
KLTH0D05346g2.469ON507921071e-04
KNAG0I010508.288ON11591561072e-04
Skud_16.326.276ON5221831062e-04
Kpol_1054.601.534ON7191891072e-04
Kpol_1041.202.401ON5152441062e-04
Suva_3.1096.340ON5151811062e-04
Kwal_26.77362.469ON507921062e-04
KNAG0A012503.25ON4521371052e-04
NCAS0D047806.363ON6212381062e-04
YLR429W (CRN1)4.309ON6511781062e-04
ZYRO0F05808g7.310ON12822181062e-04
TBLA0H002303.22ON13332011062e-04
TDEL0A074006.325ON9012231062e-04
Ecym_60982.431ON3182331042e-04
TBLA0B092502.401ON5262921053e-04
TPHA0I018808.544ON10342311053e-04
KLLA0E23453g8.544ON8262421053e-04
YCR072C (RSA4)6.340ON5151811043e-04
NDAI0J010408.316ON3982861043e-04
YDL195W (SEC31)7.310ON12731721053e-04
AAR078W7.356ON5621761043e-04
KAFR0L013207.310ON12402131043e-04
Suva_11.2681.247ON6452181043e-04
KAFR0F043506.340ON5151851034e-04
NDAI0H022502.470ON6121431034e-04
ZYRO0G10472g4.122ON5601451034e-04
Ecym_60672.401ON5222921034e-04
Kpol_1024.428.544ON8432241034e-04
Ecym_47177.356ON6031711034e-04
YLR196W (PWP1)7.356ON5761461034e-04
KLLA0E07965g2.663ON3901271024e-04
NCAS0C016808.672ON4312261024e-04
CAGL0M05335g8.544ON8062211034e-04
Skud_2.3248.544ON8022221035e-04
Smik_11.2981.247ON6622131035e-04
Kwal_23.64296.363ON7502411035e-04
TDEL0F022304.122ON5561231025e-04
Ecym_71055.201ON4841301025e-04
KAFR0A056104.309ON6201771025e-04
KLTH0H02772g6.276ON4202151025e-04
TPHA0O007101.399ON3041271015e-04
Skud_3.1456.340ON5151811025e-04
TPHA0F036501.534ON740671025e-04
CAGL0J03476g6.340ON5171681026e-04
NDAI0G038303.25ON5101291026e-04
NDAI0J024904.309ON6291791026e-04
KLTH0G12430g8.316ON3671681016e-04
Kpol_1038.203.22ON13132381026e-04
KLLA0F05159g7.310ON12312181026e-04
KLTH0A06754g6.340ON5141771016e-04
Kpol_1001.234.309ON6101781016e-04
Suva_15.223.22ON13361051027e-04
KAFR0E031808.544ON8142231027e-04
NCAS0A042702.431ON3182151007e-04
Skud_12.2617.356ON5801461017e-04
KAFR0F010606.276ON5531701017e-04
Kwal_23.53517.534ON4742181017e-04
NCAS0F018502.431ON318215998e-04
TDEL0C019207.356ON5631731018e-04
KLLA0F10263g6.363ON6822411018e-04
Smik_2.3388.544ON8002401018e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G04620
         (392 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...   774   0.0  
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...   549   0.0  
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...   523   0.0  
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9     521   0.0  
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...   488   e-172
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...   470   e-165
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...   460   e-161
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...   451   e-157
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)   448   e-156
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)   448   e-156
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...   444   e-154
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)   442   e-154
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...   441   e-153
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...   428   e-149
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...   427   e-148
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...   426   e-148
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...   424   e-147
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...   412   e-142
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...   409   e-141
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...   393   e-135
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....   110   3e-26
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...   109   1e-25
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...   106   1e-24
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...   106   1e-24
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...   105   2e-24
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...   103   9e-24
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...   103   1e-23
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...   102   2e-23
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...   101   5e-23
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...   101   7e-23
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...    97   2e-21
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...    95   7e-21
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...    94   1e-20
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...    94   2e-20
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...    91   3e-19
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...    91   3e-19
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...    90   6e-19
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...    88   2e-18
SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {...    87   7e-18
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...    86   7e-18
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    66   6e-11
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    64   2e-10
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    62   7e-10
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    60   4e-09
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    60   4e-09
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    60   4e-09
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    58   2e-08
KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8....    57   2e-08
Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa] ...    57   3e-08
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    57   4e-08
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    57   4e-08
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    57   4e-08
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    57   4e-08
KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly...    57   5e-08
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    56   8e-08
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    55   9e-08
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    55   1e-07
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    55   1e-07
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    55   1e-07
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    55   1e-07
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    55   1e-07
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     55   2e-07
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     54   2e-07
TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.3...    54   3e-07
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    54   3e-07
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    54   3e-07
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    54   4e-07
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    54   5e-07
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    54   5e-07
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    54   6e-07
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    54   6e-07
NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325       54   7e-07
TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7....    53   8e-07
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    53   8e-07
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    53   9e-07
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       53   9e-07
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    53   1e-06
KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa] ...    52   1e-06
TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {O...    52   1e-06
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    52   1e-06
CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highl...    52   1e-06
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    52   2e-06
AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic ho...    52   2e-06
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    52   2e-06
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    52   2e-06
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    52   2e-06
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    51   2e-06
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    51   3e-06
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    51   3e-06
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    51   3e-06
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    51   4e-06
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    51   4e-06
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    51   4e-06
KNAG0G00130 Chr7 complement(8702..10888) [2187 bp, 728 aa] {ON} ...    51   4e-06
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    51   4e-06
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    50   5e-06
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    50   5e-06
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    50   5e-06
Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON} (56367...    50   5e-06
KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {...    50   5e-06
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    50   6e-06
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    50   6e-06
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    50   6e-06
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    50   7e-06
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    50   7e-06
Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar t...    50   8e-06
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    50   8e-06
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    50   9e-06
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    50   1e-05
AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic ho...    49   1e-05
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    49   1e-05
NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {O...    50   1e-05
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    49   1e-05
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    49   1e-05
ZYRO0D05852g Chr4 (498219..499334) [1116 bp, 371 aa] {ON} simila...    49   1e-05
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    49   1e-05
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    49   1e-05
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    49   1e-05
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    49   1e-05
KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]...    49   1e-05
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    49   1e-05
TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa] ...    49   2e-05
ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {...    49   2e-05
KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.3...    49   2e-05
NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa] ...    49   2e-05
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    49   2e-05
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    49   2e-05
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    49   2e-05
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    49   2e-05
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    49   2e-05
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    48   2e-05
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    49   2e-05
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    48   2e-05
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    48   2e-05
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    48   2e-05
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    48   3e-05
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    48   3e-05
CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} simila...    48   3e-05
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    48   3e-05
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    48   3e-05
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    48   3e-05
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    47   3e-05
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    48   3e-05
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    48   3e-05
Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa] ...    48   3e-05
Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON} (1259...    48   3e-05
KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {...    48   3e-05
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    47   3e-05
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    48   4e-05
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    47   4e-05
KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON...    48   4e-05
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    47   4e-05
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    47   4e-05
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    47   4e-05
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    47   4e-05
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    47   4e-05
YKL213C Chr11 complement(31960..34107) [2148 bp, 715 aa] {ON}  D...    47   4e-05
Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}...    47   5e-05
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    47   5e-05
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    47   5e-05
KNAG0C04950 Chr3 (955701..957023) [1323 bp, 440 aa] {ON} Anc_5.4...    47   5e-05
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    47   5e-05
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    47   6e-05
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    47   6e-05
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    47   7e-05
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    47   7e-05
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    47   8e-05
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    47   8e-05
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    47   8e-05
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    46   9e-05
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    46   9e-05
Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa...    47   9e-05
CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {...    46   9e-05
Smik_12.256 Chr12 (490929..492659) [1731 bp, 576 aa] {ON} YLR196...    46   9e-05
Smik_11.10 Chr11 complement(16139..18292) [2154 bp, 717 aa] {ON}...    46   1e-04
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    47   1e-04
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    46   1e-04
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    46   1e-04
TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {O...    46   1e-04
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    46   1e-04
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    46   1e-04
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    46   1e-04
NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.5...    46   1e-04
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    45   1e-04
NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON}             46   1e-04
Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON} (69674....    46   1e-04
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    46   1e-04
ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408) ...    45   1e-04
Skud_11.7 Chr11 complement(15413..17566) [2154 bp, 717 aa] {ON} ...    46   1e-04
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    46   1e-04
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    46   2e-04
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    45   2e-04
Kpol_1054.60 s1054 (148854..151013) [2160 bp, 719 aa] {ON} (1488...    46   2e-04
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    45   2e-04
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    45   2e-04
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    45   2e-04
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    45   2e-04
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     45   2e-04
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    45   2e-04
ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa] ...    45   2e-04
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    45   2e-04
TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa] ...    45   2e-04
Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa] ...    45   2e-04
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    45   3e-04
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    45   3e-04
KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} simi...    45   3e-04
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    45   3e-04
NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8....    45   3e-04
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    45   3e-04
AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic ho...    45   3e-04
KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa] ...    45   3e-04
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    45   3e-04
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    44   4e-04
NDAI0H02250 Chr8 (546983..548821) [1839 bp, 612 aa] {ON} Anc_2.4...    44   4e-04
ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {...    44   4e-04
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    44   4e-04
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    44   4e-04
Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar...    44   4e-04
YLR196W Chr12 (543968..545698) [1731 bp, 576 aa] {ON}  PWP1Prote...    44   4e-04
KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} simila...    44   4e-04
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     44   4e-04
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    44   4e-04
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    44   5e-04
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    44   5e-04
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    44   5e-04
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    44   5e-04
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    44   5e-04
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    44   5e-04
KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {...    44   5e-04
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    44   5e-04
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    44   5e-04
TPHA0F03650 Chr6 (793481..795703) [2223 bp, 740 aa] {ON} Anc_1.5...    44   5e-04
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    44   6e-04
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      44   6e-04
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    44   6e-04
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    44   6e-04
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    44   6e-04
KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} simil...    44   6e-04
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    44   6e-04
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    44   6e-04
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    44   7e-04
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    44   7e-04
NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa...    43   7e-04
Skud_12.261 Chr12 (490588..492330) [1743 bp, 580 aa] {ON} YLR196...    44   7e-04
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    44   7e-04
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    44   7e-04
NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 ...    43   8e-04
TDEL0C01920 Chr3 (337685..339376) [1692 bp, 563 aa] {ON} Anc_7.3...    44   8e-04
KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON} unipro...    44   8e-04
Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON...    44   8e-04
SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {...    43   9e-04
KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa] ...    44   0.001
Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON} YDL...    43   0.001
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    43   0.001
TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {O...    43   0.001
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    43   0.001
TPHA0E03760 Chr5 complement(791726..794116) [2391 bp, 796 aa] {O...    43   0.001
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    43   0.001
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    43   0.001
SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963...    42   0.001
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    43   0.001
ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {...    43   0.001
NCAS0E02840 Chr5 (558336..560159) [1824 bp, 607 aa] {ON} Anc_7.3...    43   0.001
Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON...    43   0.001
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    43   0.001
YDR142C Chr4 complement(740473..741600) [1128 bp, 375 aa] {ON}  ...    42   0.001
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    42   0.001
KNAG0B02580 Chr2 (501215..502957) [1743 bp, 580 aa] {ON} Anc_7.3...    42   0.001
NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON} Anc_7...    42   0.001
SAKL0A10406g Chr1 (910452..912587) [2136 bp, 711 aa] {ON} simila...    43   0.001
CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa] ...    43   0.002
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...    42   0.002
KLLA0B14410g Chr2 (1264616..1266736) [2121 bp, 706 aa] {ON} simi...    42   0.002
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    42   0.002
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    42   0.002
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    42   0.002
SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa] ...    42   0.002
TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON...    42   0.002
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    42   0.002
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    42   0.002
TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.5...    42   0.002
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...    42   0.002
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    42   0.002
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    42   0.002
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    42   0.002
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    42   0.002
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    42   0.002
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               42   0.002
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    42   0.002
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...    42   0.002
KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {...    42   0.002
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    42   0.002
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    42   0.002
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    42   0.002
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    42   0.002
Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {...    42   0.002
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    42   0.002
Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247...    42   0.002
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    42   0.002
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    42   0.002
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    42   0.003
Kwal_56.24661 s56 complement(1093040..1094725) [1686 bp, 561 aa]...    42   0.003
KLTH0E08096g Chr5 complement(743809..745041) [1233 bp, 410 aa] {...    42   0.003
NCAS0B01910 Chr2 (312479..313456) [978 bp, 325 aa] {ON} Anc_8.585      41   0.003
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    42   0.003
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    42   0.003
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    42   0.003
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    42   0.003
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    42   0.003
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    42   0.003
TDEL0F00270 Chr6 complement(40832..42949) [2118 bp, 705 aa] {ON}...    42   0.003
CAGL0M02563g Chr13 complement(295156..296529) [1374 bp, 457 aa] ...    41   0.003
KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7....    42   0.003
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    42   0.003
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    41   0.003
Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...    41   0.003
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    42   0.003
Suva_8.265 Chr8 (481783..483054) [1272 bp, 423 aa] {ON} YOR212W ...    41   0.003
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    42   0.003
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    42   0.003
ZYRO0F06314g Chr6 (526555..527850) [1296 bp, 431 aa] {ON} simila...    41   0.003
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    41   0.004
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    42   0.004
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    41   0.004
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    41   0.004
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    41   0.004
YOR212W Chr15 (742910..744181) [1272 bp, 423 aa] {ON}  STE4G pro...    41   0.004
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    41   0.005
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    41   0.005
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    41   0.005
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    41   0.005
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    41   0.005
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    41   0.005
Suva_10.292 Chr10 (516694..518436) [1743 bp, 580 aa] {ON} YLR196...    41   0.005
TBLA0A01870 Chr1 (455007..458021) [3015 bp, 1004 aa] {ON} Anc_6....    41   0.005
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    41   0.005
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    41   0.005
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    41   0.005
KAFR0C03190 Chr3 complement(639680..641698) [2019 bp, 672 aa] {O...    41   0.005
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    41   0.006
TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.3...    41   0.006
KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]...    41   0.006
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    41   0.006
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    40   0.006
TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.3...    41   0.006
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    41   0.006
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    41   0.006
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    40   0.006
CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa] ...    40   0.006
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    41   0.006
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    40   0.006
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    41   0.007
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    41   0.007
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    41   0.007
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...    40   0.007
CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly...    40   0.007
Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON} (67445..6...    40   0.007
Ecym_8044 Chr8 (97649..98584) [936 bp, 311 aa] {ON} similar to A...    40   0.007
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    40   0.007
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    40   0.007
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    40   0.007
KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {O...    40   0.008
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...    40   0.008
SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {...    40   0.008
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    40   0.008
Suva_3.173 Chr3 (262525..262587,262614..264791) [2241 bp, 746 aa...    40   0.009
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    40   0.009
TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67...    40   0.009
Skud_4.634 Chr4 complement(1131614..1132978) [1365 bp, 454 aa] {...    40   0.009
Smik_3.37 Chr3 (53956..56256) [2301 bp, 766 aa] {ON} YCL039W (REAL)    40   0.009
ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} simila...    40   0.009
ADR090W Chr4 (868742..872443) [3702 bp, 1233 aa] {ON} Syntenic h...    40   0.010
TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.6...    40   0.010
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    40   0.011
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    40   0.011
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    40   0.011
AAL009C Chr1 complement(325785..326696) [912 bp, 303 aa] {ON} Sy...    39   0.011
Smik_15.398 Chr15 (692606..693883) [1278 bp, 425 aa] {ON} YOR212...    40   0.011
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       40   0.011
ZYRO0C03190g Chr3 (245542..249363) [3822 bp, 1273 aa] {ON} simil...    40   0.012
TPHA0F03030 Chr6 complement(661801..663549) [1749 bp, 582 aa] {O...    40   0.012
KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3....    40   0.012
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    40   0.013
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    40   0.013
KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {O...    39   0.013
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    40   0.013
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    40   0.014
Skud_15.379 Chr15 (681934..683211) [1278 bp, 425 aa] {ON} YOR212...    39   0.014
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    39   0.014
Kwal_33.15591 s33 (1174119..1176263) [2145 bp, 714 aa] {ON} YKL2...    40   0.014
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    40   0.014
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    40   0.014
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    39   0.015
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    39   0.015
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...    39   0.015
YFL009W Chr6 (116145..118484) [2340 bp, 779 aa] {ON}  CDC4F-box ...    39   0.016
KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363...    39   0.017
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    39   0.017
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    39   0.017
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    39   0.017
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    39   0.018
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    39   0.019
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    39   0.019
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...    39   0.019
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    39   0.019
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    39   0.020
ZYRO0F06776g Chr6 (555965..557263) [1299 bp, 432 aa] {ON} simila...    39   0.020
Skud_3.23 Chr3 (40457..42805) [2349 bp, 782 aa] {ON} YCL039W (REAL)    39   0.020
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    39   0.021
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    39   0.021
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    39   0.021
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    39   0.021
YDR364C Chr4 complement(1202843..1204210) [1368 bp, 455 aa] {ON}...    39   0.022
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    39   0.023
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    39   0.024
Suva_11.7 Chr11 complement(15456..17615) [2160 bp, 719 aa] {ON} ...    39   0.024
KNAG0A03080 Chr1 complement(380346..381686) [1341 bp, 446 aa] {O...    39   0.026
Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON} (1894...    39   0.027
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    39   0.027
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    39   0.027
ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]...    39   0.028
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    39   0.028
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...    39   0.028
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    39   0.029
AER448W Chr5 (1497416..1499560) [2145 bp, 714 aa] {ON} Syntenic ...    39   0.030
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    39   0.032
ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} simi...    38   0.034
CAGL0A04037g Chr1 complement(404063..405814) [1752 bp, 583 aa] {...    38   0.035
NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4....    38   0.036
KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} simil...    38   0.036
NCAS0J01860 Chr10 (350125..352011) [1887 bp, 628 aa] {ON} Anc_4....    38   0.036
KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {O...    38   0.037
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    38   0.037
KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} simi...    38   0.038
ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]...    38   0.038
KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} simi...    38   0.038
KLLA0F13772g Chr6 (1276532..1278094) [1563 bp, 520 aa] {ON} high...    38   0.039
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    38   0.041
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    38   0.042
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    38   0.042
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    38   0.043
TBLA0I01220 Chr9 (261925..263460) [1536 bp, 511 aa] {ON} Anc_2.4...    38   0.044
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    38   0.044
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    38   0.045
NDAI0A02880 Chr1 (644069..647938) [3870 bp, 1289 aa] {ON} Anc_7....    38   0.045
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    38   0.046
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...    38   0.046
NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {O...    37   0.047
Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON} (85899....    38   0.047
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    38   0.047
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...    38   0.047
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    38   0.049
KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.7...    38   0.049
NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa] ...    38   0.049
TDEL0F02260 Chr6 (414020..415309) [1290 bp, 429 aa] {ON} Anc_4.1...    37   0.050
Skud_4.401 Chr4 complement(712131..713261) [1131 bp, 376 aa] {ON...    37   0.051
CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} simil...    37   0.052
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    37   0.052
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    38   0.053
NDAI0C00170 Chr3 complement(24683..25888) [1206 bp, 401 aa] {ON}...    37   0.054
Kpol_2002.33 s2002 (67641..69998) [2358 bp, 785 aa] {ON} (67641....    38   0.056
NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {O...    38   0.057
NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {O...    37   0.057
KLLA0E18877g Chr5 complement(1676876..1680310) [3435 bp, 1144 aa...    38   0.058
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    37   0.059
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    37   0.059
Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...    37   0.062
TPHA0D04480 Chr4 complement(970967..974989) [4023 bp, 1340 aa] {...    38   0.062
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    37   0.063
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...    37   0.064
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    37   0.065
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    37   0.065
KLLA0E12277g Chr5 (1086778..1087329,1087730..1088158) [981 bp, 3...    37   0.066
TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {...    37   0.066
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...    37   0.067
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    37   0.069
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     37   0.070
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    37   0.072
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    37   0.073
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...    37   0.073
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    37   0.074
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    37   0.081
CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly...    37   0.084
KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} simila...    37   0.084
NCAS0H03530 Chr8 (671246..672400) [1155 bp, 384 aa] {ON} Anc_2.663     37   0.085
CAGL0J08998g Chr10 (884779..888624) [3846 bp, 1281 aa] {ON} high...    37   0.086
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...    37   0.086
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    37   0.088
Kpol_2001.63 s2001 complement(171777..175607) [3831 bp, 1276 aa]...    37   0.092
YCL039W Chr3 (52645..54882) [2238 bp, 745 aa] {ON}  GID7Protein ...    37   0.092
KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.2...    37   0.093
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    37   0.095
KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.7...    37   0.097
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    37   0.10 
Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar...    36   0.11 
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    37   0.11 
Smik_9.144 Chr9 (242718..244610) [1893 bp, 630 aa] {ON} YIL046W ...    37   0.11 
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...    37   0.11 
SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 ...    37   0.12 
KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {O...    36   0.12 
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    37   0.12 
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    36   0.12 
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    36   0.12 
ZYRO0F11484g Chr6 complement(943018..943902) [885 bp, 294 aa] {O...    36   0.12 
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    36   0.12 
KLTH0H01122g Chr8 (113798..115537) [1740 bp, 579 aa] {ON} simila...    36   0.13 
KLLA0F10791g Chr6 complement(991642..993279) [1638 bp, 545 aa] {...    36   0.13 
KLTH0B00924g Chr2 complement(79302..81446) [2145 bp, 714 aa] {ON...    37   0.13 
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    36   0.13 
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    36   0.13 
NCAS0B01660 Chr2 complement(270046..271320) [1275 bp, 424 aa] {O...    36   0.13 
KLLA0D07282g Chr4 (621115..622467) [1353 bp, 450 aa] {ON} simila...    36   0.14 
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    35   0.14 
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    36   0.14 
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    36   0.14 
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    36   0.15 
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    36   0.15 
TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 8...    36   0.16 
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    36   0.16 
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...    36   0.16 
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    36   0.16 
SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {...    36   0.17 
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    36   0.17 
KNAG0H01290 Chr8 (227947..229341) [1395 bp, 464 aa] {ON} Anc_3.2...    36   0.17 
Suva_2.537 Chr2 complement(959258..960625) [1368 bp, 455 aa] {ON...    36   0.17 
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    36   0.18 
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    36   0.18 
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    36   0.18 
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    36   0.19 
Ecym_3619 Chr3 (1183531..1185666) [2136 bp, 711 aa] {ON} similar...    36   0.19 
CAGL0I03454g Chr9 (292823..293734) [912 bp, 303 aa] {ON} similar...    35   0.19 
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    36   0.20 
KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa...    35   0.20 
KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly...    35   0.21 
TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8....    36   0.22 
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...    36   0.22 
Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129...    36   0.22 
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    35   0.22 
Ecym_7078 Chr7 complement(156495..157436) [942 bp, 313 aa] {ON} ...    35   0.23 
TPHA0G00680 Chr7 complement(127929..129302) [1374 bp, 457 aa] {O...    35   0.23 
KLLA0B01958g Chr2 (170646..170663,170896..173550) [2673 bp, 890 ...    36   0.23 
CAGL0J04818g Chr10 (458449..460413) [1965 bp, 654 aa] {ON} highl...    35   0.24 
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    35   0.25 
TPHA0A03100 Chr1 (679875..683672) [3798 bp, 1265 aa] {ON} Anc_7....    35   0.25 
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    35   0.25 
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    35   0.26 
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    35   0.27 
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    35   0.27 
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...    35   0.27 
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...    35   0.28 
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    35   0.28 
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    35   0.28 
CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa] ...    35   0.29 
KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {O...    35   0.29 
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    35   0.30 
NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {O...    35   0.30 
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    35   0.31 
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    35   0.32 
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...    35   0.35 
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    35   0.35 
Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {O...    35   0.35 
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    35   0.37 
Kwal_56.24596 s56 complement(1068314..1069198) [885 bp, 294 aa] ...    35   0.37 
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    35   0.39 
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    35   0.39 
KNAG0G01080 Chr7 (235280..237520) [2241 bp, 746 aa] {ON}  YER066W      35   0.41 
Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129...    35   0.42 
YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}  DIP2Nucle...    35   0.42 
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    35   0.43 
ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [269...    35   0.44 
NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231     35   0.44 
TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.6...    35   0.44 
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    35   0.44 
KNAG0C06240 Chr3 complement(1212466..1213533) [1068 bp, 355 aa] ...    34   0.44 
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    35   0.45 
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...    35   0.46 
Smik_4.386 Chr4 complement(701174..702304) [1131 bp, 376 aa] {ON...    34   0.46 
Kpol_1002.36 s1002 (110010..112229) [2220 bp, 739 aa] {ON} (1100...    35   0.46 
Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...    35   0.48 
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    34   0.49 
KLTH0H01518g Chr8 (138469..139353) [885 bp, 294 aa] {ON} highly ...    34   0.50 
Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,...    34   0.51 
TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [...    34   0.52 
TPHA0J02160 Chr10 (484299..487313) [3015 bp, 1004 aa] {ON} Anc_6...    35   0.53 
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    34   0.54 
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    34   0.54 
Kwal_33.13148 s33 (94593..96614) [2022 bp, 673 aa] {ON} YCL039W ...    34   0.55 
TDEL0F01740 Chr6 complement(322088..325102) [3015 bp, 1004 aa] {...    34   0.56 
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    34   0.58 
Kwal_23.5769 s23 complement(1311598..1313481) [1884 bp, 627 aa] ...    34   0.60 
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    34   0.62 
SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {...    34   0.62 
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    34   0.66 
ADL082C Chr4 complement(538945..540654) [1710 bp, 569 aa] {ON} S...    34   0.67 
TPHA0G02840 Chr7 (604491..605033) [543 bp, 180 aa] {ON} Anc_2.43...    33   0.67 
Kpol_526.37 s526 complement(88726..89769) [1044 bp, 347 aa] {ON}...    34   0.67 
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    34   0.71 
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    34   0.75 
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    34   0.77 
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    34   0.77 
TBLA0D03580 Chr4 complement(885182..887353) [2172 bp, 723 aa] {O...    34   0.78 
Ecym_8317 Chr8 (648256..649527) [1272 bp, 423 aa] {ON} similar t...    33   0.81 
Smik_4.631 Chr4 complement(1128746..1130113) [1368 bp, 455 aa] {...    33   0.88 
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    34   0.90 
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    33   0.92 
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    33   0.93 
SAKL0G14432g Chr7 complement(1245508..1247877) [2370 bp, 789 aa]...    33   0.95 
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    33   1.0  
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    33   1.1  
YIL046W Chr9 (268651..270573) [1923 bp, 640 aa] {ON}  MET30F-box...    33   1.1  
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    33   1.1  
TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa...    33   1.1  
KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 ...    33   1.1  
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    33   1.1  
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    33   1.1  
KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa] ...    33   1.2  
CAGL0L10890g Chr12 (1165380..1166753) [1374 bp, 457 aa] {ON} hig...    33   1.2  
TDEL0A06650 Chr1 (1160677..1162032) [1356 bp, 451 aa] {ON} Anc_8...    33   1.2  
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    33   1.2  
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...    33   1.2  
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    33   1.3  
NCAS0B08910 Chr2 complement(1709752..1712469) [2718 bp, 905 aa] ...    33   1.3  
KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.3...    33   1.3  
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...    33   1.3  
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    33   1.3  
Kwal_14.1710 s14 (433526..435250) [1725 bp, 574 aa] {ON} YGL116W...    33   1.3  
Skud_7.561 Chr7 (920014..921196,921300..921898) [1782 bp, 593 aa...    33   1.3  
NCAS0A02800 Chr1 (533712..535517) [1806 bp, 601 aa] {ON} Anc_4.3...    33   1.3  
KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {...    33   1.3  
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      33   1.3  
ACR091W Chr3 (520609..521595) [987 bp, 328 aa] {ON} Syntenic hom...    33   1.4  
SAKL0F11022g Chr6 (863614..864504) [891 bp, 296 aa] {ON} highly ...    33   1.4  
Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960...    33   1.4  
Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960...    33   1.4  
Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960...    33   1.4  
YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,...    33   1.4  
KLLA0A04928g Chr1 (439349..441934) [2586 bp, 861 aa] {ON} simila...    33   1.4  
KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.2...    33   1.5  
NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 ...    33   1.5  
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    33   1.5  
CAGL0D02090g Chr4 (214357..214893,215564..215860) [834 bp, 277 a...    33   1.5  
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    33   1.5  
NCAS0A09610 Chr1 complement(1920171..1922258) [2088 bp, 695 aa] ...    33   1.5  
TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa...    33   1.5  
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    33   1.5  
NDAI0F03380 Chr6 (813767..815455) [1689 bp, 562 aa] {ON} Anc_2.7...    33   1.5  
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    33   1.6  
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    33   1.6  
Kpol_1070.11 s1070 (30012..32012) [2001 bp, 666 aa] {ON} (30012....    33   1.6  
KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly...    33   1.7  
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    33   1.7  
CAGL0J01287g Chr10 (120215..122047) [1833 bp, 610 aa] {ON} simil...    33   1.7  
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    33   1.7  
NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {O...    33   1.7  
NCAS0D04050 Chr4 (760598..762865) [2268 bp, 755 aa] {ON}               33   1.8  
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    33   1.9  
Suva_14.159 Chr14 complement(292113..293789) [1677 bp, 558 aa] {...    33   1.9  
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...    32   1.9  
NDAI0A00340 Chr1 (50320..53166) [2847 bp, 948 aa] {ON} Anc_1.34 ...    33   2.0  
KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} high...    33   2.1  
Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129...    33   2.1  
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....    32   2.1  
KNAG0G00800 Chr7 (147792..150164) [2373 bp, 790 aa] {ON} Anc_5.1...    32   2.1  
Kwal_56.23035 s56 complement(373146..374420) [1275 bp, 424 aa] {...    32   2.1  
KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {O...    32   2.3  
Kpol_1031.49 s1031 (132811..133005,133055..133063,133288..133320...    32   2.3  
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...    32   2.3  
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    32   2.3  
KAFR0E00180 Chr5 complement(35535..37721) [2187 bp, 728 aa] {ON}...    32   2.4  
TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON} Anc_2...    32   2.4  
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    32   2.5  
KLTH0B01628g Chr2 (129632..132004) [2373 bp, 790 aa] {ON} simila...    32   2.5  
Kwal_27.11126 s27 (651113..654103) [2991 bp, 996 aa] {ON} YPL183...    32   2.6  
NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283     32   2.7  
Smik_14.148 Chr14 complement(275170..276837) [1668 bp, 555 aa] {...    32   2.7  
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    32   2.7  
Kwal_26.8628 s26 (871377..872645) [1269 bp, 422 aa] {ON} YOR212W...    32   2.7  
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...    32   2.7  
NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON}      32   2.8  
Kwal_14.884 s14 complement(95068..96255) [1188 bp, 395 aa] {ON} ...    32   2.8  
Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON...    32   2.9  
NDAI0F02100 Chr6 (513187..514338) [1152 bp, 383 aa] {ON} Anc_6.1...    32   2.9  
Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...    32   2.9  
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    32   3.0  
NCAS0G01830 Chr7 complement(326874..328520) [1647 bp, 548 aa] {O...    32   3.0  
Ecym_2239 Chr2 complement(467139..470081) [2943 bp, 980 aa] {ON}...    32   3.0  
Skud_14.152 Chr14 complement(286929..288704) [1776 bp, 591 aa] {...    32   3.1  
TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657) [...    32   3.1  
TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON} Anc_8...    32   3.1  
KAFR0A07550 Chr1 (1523221..1524804) [1584 bp, 527 aa] {ON} Anc_2...    32   3.2  
ZYRO0G02420g Chr7 (184509..186686) [2178 bp, 725 aa] {ON} simila...    32   3.2  
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...    32   3.3  
KNAG0E02020 Chr5 (416909..417949) [1041 bp, 346 aa] {ON} Anc_2.3...    32   3.3  
KNAG0D02720 Chr4 complement(489642..494267) [4626 bp, 1541 aa] {...    32   3.3  
Suva_2.303 Chr2 complement(535706..536839) [1134 bp, 377 aa] {ON...    32   3.3  
KAFR0I01880 Chr9 (386694..388469) [1776 bp, 591 aa] {ON} Anc_7.2...    32   3.4  
Kpol_361.3 s361 complement(3792..5675) [1884 bp, 627 aa] {ON} co...    32   3.5  
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...    32   3.6  
ZYRO0F17842g Chr6 complement(1477727..1480000) [2274 bp, 757 aa]...    32   3.6  
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...    32   3.7  
Kpol_1057.12 s1057 (22322..23515) [1194 bp, 397 aa] {ON} (22322....    32   3.7  
KLLA0F27511g Chr6 (2546533..2548404) [1872 bp, 623 aa] {ON} simi...    32   3.8  
TDEL0H00630 Chr8 complement(109274..110623) [1350 bp, 449 aa] {O...    32   3.8  
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    32   3.9  
KLLA0C07425g Chr3 complement(647673..649007) [1335 bp, 444 aa] {...    32   3.9  
CAGL0J03806g Chr10 (363777..365039) [1263 bp, 420 aa] {ON} simil...    32   3.9  
NDAI0F02240 Chr6 (542551..545610) [3060 bp, 1019 aa] {ON} Anc_6....    32   4.0  
Kpol_1044.27 s1044 complement(63632..65197) [1566 bp, 521 aa] {O...    32   4.0  
Skud_7.135 Chr7 (254246..254263,254479..257154) [2694 bp, 897 aa...    32   4.1  
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    32   4.1  
YGL137W Chr7 (249869..249886,250087..252738) [2670 bp, 889 aa] {...    32   4.2  
Skud_13.307 Chr13 complement(530776..531819) [1044 bp, 347 aa] {...    31   4.2  
SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]...    32   4.3  
Suva_7.127 Chr7 (246249..246659,246660..248924) [2676 bp, 891 aa...    32   4.3  
TDEL0E04900 Chr5 complement(913381..915738) [2358 bp, 785 aa] {O...    32   4.3  
KNAG0C00410 Chr3 (69301..71367) [2067 bp, 688 aa] {ON} Anc_1.34 ...    32   4.4  
KLLA0C01177g Chr3 (89978..92131) [2154 bp, 717 aa] {ON} similar ...    32   4.5  
NCAS0I02490 Chr9 complement(465916..467796) [1881 bp, 626 aa] {O...    32   4.6  
ZYRO0C09724g Chr3 (738113..739588) [1476 bp, 491 aa] {ON} simila...    31   4.6  
KLTH0D12276g Chr4 (998921..1000258) [1338 bp, 445 aa] {ON} highl...    31   4.6  
Smik_7.135 Chr7 (244035..244445,244446..246698) [2664 bp, 887 aa...    32   4.6  
KNAG0F01250 Chr6 complement(226031..227653) [1623 bp, 540 aa] {O...    31   4.8  
CAGL0M06193g Chr13 (643917..644867) [951 bp, 316 aa] {ON} simila...    31   4.9  
CAGL0C01441g Chr3 complement(156930..159947) [3018 bp, 1005 aa] ...    31   5.0  
KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.1...    31   5.1  
TPHA0N01850 Chr14 (393690..394910) [1221 bp, 406 aa] {ON} Anc_2....    31   5.2  
ADL192W Chr4 (359741..360967) [1227 bp, 408 aa] {ON} Syntenic ho...    31   5.3  
CAGL0D04884g Chr4 (475678..477369) [1692 bp, 563 aa] {ON} highly...    31   5.4  
Kpol_1050.114 s1050 complement(253970..255886) [1917 bp, 638 aa]...    31   5.5  
Smik_4.518 Chr4 complement(935380..936372) [993 bp, 330 aa] {ON}...    31   5.5  
Kpol_1002.74 s1002 complement(195739..198756) [3018 bp, 1005 aa]...    31   5.6  
YNL182C Chr14 complement(295960..297627) [1668 bp, 555 aa] {ON} ...    31   5.7  
Suva_9.154 Chr9 (257284..259200) [1917 bp, 638 aa] {ON} YIL046W ...    31   5.9  
Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W ...    31   5.9  
Ecym_6169 Chr6 complement(314473..316128) [1656 bp, 551 aa] {ON}...    31   6.2  
SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {...    31   6.3  
Skud_4.530 Chr4 complement(945231..946247) [1017 bp, 338 aa] {ON...    31   6.4  
CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar...    31   6.7  
ACR166W Chr3 (647933..649102) [1170 bp, 389 aa] {ON} Syntenic ho...    31   6.9  
Kpol_2000.39 s2000 complement(76168..77499) [1332 bp, 443 aa] {O...    31   6.9  
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    31   6.9  
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    31   7.0  
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    31   7.1  
YDR267C Chr4 complement(1002510..1003502) [993 bp, 330 aa] {ON} ...    30   7.1  
YMR146C Chr13 complement(557481..558524) [1044 bp, 347 aa] {ON} ...    30   7.2  
KLTH0C00616g Chr3 complement(62501..63724) [1224 bp, 407 aa] {ON...    31   7.3  
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    31   7.4  
TBLA0G03080 Chr7 complement(817595..818923) [1329 bp, 442 aa] {O...    31   7.4  
ZYRO0G03586g Chr7 (285054..287969) [2916 bp, 971 aa] {ON} simila...    31   7.6  
KLLA0E18899g Chr5 (1680775..1683747) [2973 bp, 990 aa] {ON} simi...    31   7.7  
KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {O...    31   7.8  
KNAG0C02890 Chr3 (571926..574418) [2493 bp, 830 aa] {ON} Anc_4.1...    31   8.0  
TPHA0F00760 Chr6 (173015..174415) [1401 bp, 466 aa] {ON} Anc_4.1...    30   8.2  
ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {...    30   8.3  
ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON} S...    30   8.5  
TPHA0G03110 Chr7 (661602..663428) [1827 bp, 608 aa] {ON} Anc_2.4...    30   8.7  
NCAS0C05310 Chr3 complement(1079501..1080550) [1050 bp, 349 aa] ...    30   8.8  
KLLA0C16643g Chr3 complement(1457590..1458498) [909 bp, 302 aa] ...    30   8.9  
Suva_7.278 Chr7 complement(482297..483559) [1263 bp, 420 aa] {ON...    30   9.1  
Skud_13.39 Chr13 (67722..69146) [1425 bp, 474 aa] {ON} YML102W (...    30   9.6  
NDAI0J02410 Chr10 complement(586395..589244) [2850 bp, 949 aa] {...    30   9.6  
Suva_16.126 Chr16 complement(209255..212296) [3042 bp, 1013 aa] ...    30   9.7  
NCAS0A00740 Chr1 (143564..144946) [1383 bp, 460 aa] {ON} Anc_1.1...    30   9.9  

>TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9
           YEL056W
          Length = 392

 Score =  774 bits (1999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/392 (96%), Positives = 377/392 (96%)

Query: 1   MAEEQVDKPLSIDEEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXGNSHSNRQELILGT 60
           MAEEQVDKPLSIDEEYELWRSNVPLMYDFVS               GNSHSNRQELILGT
Sbjct: 1   MAEEQVDKPLSIDEEYELWRSNVPLMYDFVSETNLTWPTLTLEWLPGNSHSNRQELILGT 60

Query: 61  HTSEEEPNYLKIAAIDLPDEIVPGKEDRERDGFTKSNIKIIKKFKHEQEVTRARYMPQDS 120
           HTSEEEPNYLKIAAIDLPDEIVPGKEDRERDGFTKSNIKIIKKFKHEQEVTRARYMPQDS
Sbjct: 61  HTSEEEPNYLKIAAIDLPDEIVPGKEDRERDGFTKSNIKIIKKFKHEQEVTRARYMPQDS 120

Query: 121 NLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIAL 180
           NLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIAL
Sbjct: 121 NLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIAL 180

Query: 181 WDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIK 240
           WDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIK
Sbjct: 181 WDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIK 240

Query: 241 TVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDG 300
           TVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDG
Sbjct: 241 TVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDG 300

Query: 301 IVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMA 360
           IVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMA
Sbjct: 301 IVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMA 360

Query: 361 SAEEENIVQVWKCSSKLPRVGGLPKVDDSVLE 392
           SAEEENIVQVWKCSSKLPRVGGLPKVDDSVLE
Sbjct: 361 SAEEENIVQVWKCSSKLPRVGGLPKVDDSVLE 392

>ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 393

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/386 (66%), Positives = 306/386 (79%)

Query: 7   DKPLSIDEEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXGNSHSNRQELILGTHTSEEE 66
           +KPLSIDEEY+LW+SNVPLMYDFVS               G+  SNRQE+ILGTHTS+EE
Sbjct: 8   EKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSSNRQEMILGTHTSDEE 67

Query: 67  PNYLKIAAIDLPDEIVPGKEDRERDGFTKSNIKIIKKFKHEQEVTRARYMPQDSNLIATI 126
            NYLKIAAI LPDE+VP  E +E +   KSN+KIIKKF+HE EVTRARYMPQD NLIATI
Sbjct: 68  QNYLKIAAIYLPDEVVPDAEPKEEEEVLKSNVKIIKKFEHENEVTRARYMPQDDNLIATI 127

Query: 127 NGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTN 186
           +G GT++LY+R+ + + GLLS+  FH +NGYGLSFNP +KGKLLSGSDDS I LWD+T  
Sbjct: 128 SGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGK 187

Query: 187 STKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFN 246
           S +P+ T+   H D VNDCKWH  + N FGSVSED TLQLHDQR++D+  +K++    +N
Sbjct: 188 SQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYN 247

Query: 247 TIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSG 306
           T+AFS HSTNLFAAAGTDS++YLYD RR    LH M GHE  VT+LEF+  +DG+++S+G
Sbjct: 248 TLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAG 307

Query: 307 EDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEEN 366
            DRR I+WDL EIGAEQVPDDADDGSPEV+MIHAGHRS +NDFSMNPNIPWL A+AEEEN
Sbjct: 308 SDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEEN 367

Query: 367 IVQVWKCSSKLPRVGGLPKVDDSVLE 392
           IVQVWK SSKLPR+GG P VD  +LE
Sbjct: 368 IVQVWKPSSKLPRIGGTPSVDTQLLE 393

>NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}
           Anc_6.9 YEL056W
          Length = 411

 Score =  523 bits (1348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/397 (64%), Positives = 303/397 (76%), Gaps = 7/397 (1%)

Query: 3   EEQVDKPLSIDEEYELWRSNVPLMYDFVSXXXXXXXXXXXX---XXXGNSHSNRQELILG 59
           EE  +K LSIDEEYELWRSNVPLMYDFVS                       NRQELI+G
Sbjct: 15  EEDPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELIIG 74

Query: 60  THTSEEEPNYLKIAAIDLPDEIVPGKE---DRER-DGFTKSNIKIIKKFKHEQEVTRARY 115
           THTS EE NYLKIAAIDLP++I+P  E   D+++ +  TKSNIKIIKKFKHE+E+TRARY
Sbjct: 75  THTSGEEDNYLKIAAIDLPNDIIPSTEKLEDQQKGETTTKSNIKIIKKFKHEEEITRARY 134

Query: 116 MPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDD 175
           MPQ+SNL+ATINGSG VFLYDRSKD   GL+S+  +H++NGYGLSFN  D GKLLSGSDD
Sbjct: 135 MPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDD 194

Query: 176 SKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSV 235
             IALW++  +++ P+  W S H D VNDCKW   + N FGSVSED TLQLHDQR KD+ 
Sbjct: 195 GTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTF 254

Query: 236 TDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFY 295
           T + K    FNT+AFSKHS  LFAAAGTDS +YL+D R     LH+M+GH+  VTN+EF 
Sbjct: 255 TSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFS 314

Query: 296 AAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNI 355
             +DGI+M+SGEDRR I+WD+ +IG EQ+PDDA+DG+PEV+MIHAGHRS +NDFSMNPNI
Sbjct: 315 PDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNI 374

Query: 356 PWLMASAEEENIVQVWKCSSKLPRVGGLPKVDDSVLE 392
           PWLMAS+EEENI+QVWKCS KLPRVGG P V  S LE
Sbjct: 375 PWLMASSEEENIIQVWKCSHKLPRVGGTPTVSVSQLE 411

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score =  521 bits (1341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/406 (64%), Positives = 310/406 (76%), Gaps = 21/406 (5%)

Query: 7   DKPLSIDEEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXGNSHS-----NRQELILGTH 61
           +K L+IDEEY+LW+SNVPLMYDFVS                 SHS     NRQELILGTH
Sbjct: 34  NKELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPS-SHSSTPVSNRQELILGTH 92

Query: 62  TSEEEPNYLKIAAIDLPDEIVPG-----KEDRE-------RDGFTKSNIKIIKKFKHEQE 109
           TS EE NYLKIAAIDLPDE+V       K  RE       +    +SNIKI+KKFKHE+E
Sbjct: 93  TSGEEDNYLKIAAIDLPDEVVQPSTNSLKAQREDDEDEDDQKQKPRSNIKIVKKFKHEEE 152

Query: 110 VTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKL 169
           +TRAR+MPQ++++IATINGSGTVF+Y++S D    L+S+L FH++NGYGLSFNP DKGKL
Sbjct: 153 ITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKL 212

Query: 170 LSGSDDSKIALWDITTNST---KPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQL 226
           LSGSDD  IALWDI  NST   KP+  W+S H D VNDCKW+E N N F SVSED TLQL
Sbjct: 213 LSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQL 272

Query: 227 HDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHE 286
           HDQR ++++ + IKT   FNT+AFSKHS  L AAAGTDSL+YLYDSR     L++M+GHE
Sbjct: 273 HDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHE 332

Query: 287 SNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPV 346
            ++TNLEF    DG+++SSG DRRVIMWD+ +IGAEQ+PDDA+DG+PEV+MIHAGHRS V
Sbjct: 333 DSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAV 392

Query: 347 NDFSMNPNIPWLMASAEEENIVQVWKCSSKLPRVGGLPKVDDSVLE 392
           NDFS+NPNIPWLMASAEEENI+QVWKCS KLP VGG P+V  S+LE
Sbjct: 393 NDFSINPNIPWLMASAEEENIIQVWKCSHKLPIVGGTPEVSVSILE 438

>Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON}
           (183046..184224) [1179 nt, 393 aa]
          Length = 392

 Score =  488 bits (1256), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 229/391 (58%), Positives = 293/391 (74%), Gaps = 1/391 (0%)

Query: 2   AEEQVDKPLSIDEEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXGNSHSNRQELILGTH 61
           A+ + ++PL++D+EYELW++NVPLMYDFVS               G+    RQ +ILGTH
Sbjct: 3   AQREQEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDTRQYMILGTH 62

Query: 62  TSEEEPNYLKIAAIDLPDEIVPGKEDRERDGFTKSNIKIIKKFKHEQEVTRARYMPQDSN 121
           TS EE +YLK+AA+DLPDE+V G E  + +  TKSNIKI+KKF+H+ E+ RARYMP+DSN
Sbjct: 63  TSGEEVDYLKVAALDLPDEVVTG-EANDDNRRTKSNIKIVKKFEHDGEINRARYMPKDSN 121

Query: 122 LIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALW 181
           +IATING G V +YDRSK   +GL ++L +H++NGYGLSFNP    +L+SGSDD  IALW
Sbjct: 122 IIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALW 181

Query: 182 DITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKT 241
           DI + S  P S W++ H D VNDC WH  + N FGSVSED TL+LHD+R    V + I+ 
Sbjct: 182 DIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQA 241

Query: 242 VTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGI 301
             AFNT+AFSKHS NLFAAAG D+ IYLYD R+T   LH M+GHE  +T L+F+  +DGI
Sbjct: 242 KAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGI 301

Query: 302 VMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMAS 361
           ++S G DRRVI+WDL EIGAEQ PD+ADDGSPE++MIHAGHRS +NDF+++P IPWL AS
Sbjct: 302 LVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSAS 361

Query: 362 AEEENIVQVWKCSSKLPRVGGLPKVDDSVLE 392
            EE+N+VQVWKCS  L RVGG P++D  +L+
Sbjct: 362 VEEDNVVQVWKCSKNLSRVGGTPEIDTKMLQ 392

>TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON}
           Anc_6.9 YEL056W
          Length = 391

 Score =  470 bits (1210), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 231/390 (59%), Positives = 285/390 (73%), Gaps = 4/390 (1%)

Query: 4   EQVDKPLSIDEEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXGNSHSNRQELILGTHTS 63
           EQ ++PL++D+EY+LW+SNVPL+YDFVS               G+  S RQ LILGT TS
Sbjct: 5   EQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTSTRQHLILGTLTS 64

Query: 64  EEEPNYLKIAAIDLPDEIVPGKEDRERDGFTKSNIKIIKKFKHEQEVTRARYMPQDSNLI 123
             E +YLKIAA+DLPDEI+ GK+    D   KSN+K++KKF H+ E+ RARYMPQ++N+I
Sbjct: 65  GAETDYLKIAALDLPDEIIIGKK---SDKVVKSNLKVVKKFAHDGEINRARYMPQNTNII 121

Query: 124 ATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDI 183
           AT+NG GT+F+YD S+D    LLS+L +H+DN YGL+FNP  +G+L+SGSDDS IALWD 
Sbjct: 122 ATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDA 181

Query: 184 TTNSTK-PVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTV 242
           T +  K P+  W + H D VNDC+WH  N N FGSVSED TLQL D+R       KI + 
Sbjct: 182 TNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSK 241

Query: 243 TAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIV 302
             +N+IAFS  S NLFAAAGT + IYLYD R TG +LH+M+GHE  VT+LEF   KDGI+
Sbjct: 242 GQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGIL 301

Query: 303 MSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASA 362
           +S   DRRVIMWDL EIGAEQ PD+ADDG PEV+MIHAG RS +ND S +P+IPWL AS 
Sbjct: 302 ISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASV 361

Query: 363 EEENIVQVWKCSSKLPRVGGLPKVDDSVLE 392
           EE NIVQVWKCSSKLPR+ G P+V  S LE
Sbjct: 362 EENNIVQVWKCSSKLPRISGTPEVSISDLE 391

>SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 398

 Score =  460 bits (1184), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 234/402 (58%), Positives = 290/402 (72%), Gaps = 14/402 (3%)

Query: 1   MAEEQVDKPLSIDEEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXGNSHSNRQELILGT 60
           M+ E+ +K LSI+EEYELW++NVPLMYDFVS               GNS S +QE+ILGT
Sbjct: 1   MSIEEENKLLSIEEEYELWKTNVPLMYDFVSETKLTWPSLTIQWLPGNSSSTKQEMILGT 60

Query: 61  HTSEEEPNYLKIAAIDLPDEIVPGK----------EDRERDGFTKSNIKIIKKFKHEQEV 110
           HTS E+ NYLKIA+I+LP++I+  +           +++R+   +S IKI KK KHE+E+
Sbjct: 61  HTSGEDDNYLKIASIELPEDILGAEFSETPESTEETEQQRN--VQSRIKITKKIKHEEEI 118

Query: 111 TRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLL 170
           TRAR+MPQD N IATING G VFL+DRSKD +E L+S   FH+DNGYGLSFNP  KG+LL
Sbjct: 119 TRARFMPQDPNFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELL 178

Query: 171 SGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQR 230
           S SDD  IALW++   +T P S   + H+D VNDC WHE N N FGSVSED TLQ+HD+R
Sbjct: 179 SCSDDGTIALWNVMGTNTSP-SKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKR 237

Query: 231 VKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVT 290
             +S   ++   + FNT+ FSKHS NLFAAAGTDSL+YLYD R T + LHTMSGHE +VT
Sbjct: 238 T-NSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVT 296

Query: 291 NLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFS 350
           +LEF   KDGI+ SSG DRRV++WDLM+IG+EQ  +DA DG PE++M+HAGH+S VNDFS
Sbjct: 297 SLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFS 356

Query: 351 MNPNIPWLMASAEEENIVQVWKCSSKLPRVGGLPKVDDSVLE 392
            N NIPWLMAS EE+NIV VWK S KL   G +   D   LE
Sbjct: 357 FNWNIPWLMASVEEDNIVHVWKVSKKLTSPGLIQDYDIRSLE 398

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score =  451 bits (1159), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 224/403 (55%), Positives = 281/403 (69%), Gaps = 19/403 (4%)

Query: 4   EQVDKPLSIDEEYELWRSNVPLMYDFVSXXXXXXXXXXXX-----XXXGNSHSNRQELIL 58
           E  +KPLS+DEEY+LW+SNVPLMYDFVS                     +    +QELI+
Sbjct: 2   ENQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELII 61

Query: 59  GTHTSEEEPNYLKIAAIDLPDEIVPGKEDRERDG--------FTKSNIKIIKKFKHEQEV 110
           GTHTS EE NYLK A I+LP EI+  ++ +E  G          +SNI+I  K++HE+E+
Sbjct: 62  GTHTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEEI 121

Query: 111 TRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLL 170
           TRARYMPQD N++ATING GTVFLY RS    EGL S+L FH+DNGY LSF+ + KG+LL
Sbjct: 122 TRARYMPQDPNIVATINGQGTVFLYSRS----EGLQSTLKFHKDNGYALSFSTLVKGRLL 177

Query: 171 SGSDDSKIALWDITT--NSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHD 228
           SGSDD  +ALW++ +  + TKPV TW   H D +ND KWH  N + FG+VSED  L+++D
Sbjct: 178 SGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKIND 237

Query: 229 QRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESN 288
            R  ++  D +K    FNT+AFS HS+NL AAAG DS +YLYD R     LH MSGHE  
Sbjct: 238 VRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDA 297

Query: 289 VTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVND 348
           V NLEF    DG+V+SSG D R++MWDL +IGAEQ PDDA+DG PE++M+HAGHRS VND
Sbjct: 298 VNNLEFSTHVDGVVVSSGSDNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVND 357

Query: 349 FSMNPNIPWLMASAEEENIVQVWKCSSKLPRVGGLPKVDDSVL 391
           F +NP IPWL+ASAEEENI+QVWKCS  LP VGG PKV+  ++
Sbjct: 358 FDLNPQIPWLVASAEEENILQVWKCSHSLPIVGGPPKVNKDII 400

>Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  448 bits (1152), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 221/403 (54%), Positives = 281/403 (69%), Gaps = 19/403 (4%)

Query: 4   EQVDKPLSIDEEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXGNSHSNR-----QELIL 58
           E  +KPLS+DEEY+LW+SNVPLMYDFVS                     +     QELI+
Sbjct: 2   EGQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELII 61

Query: 59  GTHTSEEEPNYLKIAAIDLPDEIVPGKEDRERDGF--------TKSNIKIIKKFKHEQEV 110
           GTHTS EE NYLK A I+LP E++  +  +E+            +SNI+I  K++HE+E+
Sbjct: 62  GTHTSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEI 121

Query: 111 TRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLL 170
           TRARYMPQD N++ATING GTVFLY RS    +GL S+L FH+DNGY LSF+P+ KG LL
Sbjct: 122 TRARYMPQDPNMVATINGQGTVFLYSRS----DGLQSTLKFHKDNGYALSFSPLIKGHLL 177

Query: 171 SGSDDSKIALWDIT--TNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHD 228
           SGSDD  +ALWD++  ++ST P+ TW+  H D VND KWH  N + FG+VSED  L+++D
Sbjct: 178 SGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKIND 237

Query: 229 QRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESN 288
            R +++  D  K    FNT+AFS HS+N+ AAAG DS +YLYD R     LH MSGHE  
Sbjct: 238 IRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDA 297

Query: 289 VTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVND 348
           VTNLEF    DG+V+SSG D R+IMWDL +IGAEQ PDDA+DG PE++M+HAGHRS VND
Sbjct: 298 VTNLEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVND 357

Query: 349 FSMNPNIPWLMASAEEENIVQVWKCSSKLPRVGGLPKVDDSVL 391
           F +N  +PWL+AS EEENI+QVWKCS  LP VGGLPK++  ++
Sbjct: 358 FDLNAQVPWLIASTEEENILQVWKCSHSLPIVGGLPKINKDIV 400

>Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  448 bits (1152), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 226/398 (56%), Positives = 276/398 (69%), Gaps = 19/398 (4%)

Query: 4   EQVDKPLSIDEEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXGNSHSN-----RQELIL 58
           E  +KPLS+DEEY+LW+SNVPLMYDFVS                          +QELI+
Sbjct: 2   ETQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELII 61

Query: 59  GTHTSEEEPNYLKIAAIDLPDEIVPGKEDRERDG--------FTKSNIKIIKKFKHEQEV 110
           GTHTS EE NYLK A I+LP EI+  ++ +E  G          +SNIKI  K+KHE+E+
Sbjct: 62  GTHTSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEEI 121

Query: 111 TRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLL 170
           TRARYMPQ+   +ATING GTVF+Y RS    EGL S+L FHE+NGY LSF+P+ +G LL
Sbjct: 122 TRARYMPQNPGTVATINGQGTVFIYSRS----EGLQSTLKFHEENGYALSFSPLVEGLLL 177

Query: 171 SGSDDSKIALWDITTNS--TKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHD 228
           SGSDD  +ALWD+  NS  T+P+ TW   H D VND KWH  N + FG+VSED  L+++D
Sbjct: 178 SGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKIND 237

Query: 229 QRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESN 288
            RV+++ T   K    FNT+AFS HS+NL AAAGTDS +YLYD R     LH MSGHE  
Sbjct: 238 LRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDA 297

Query: 289 VTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVND 348
           VTNLEF    DG+V+SSG D R+IMWDL +IGAEQ PDDA+DG PE++M+HAGH+S VND
Sbjct: 298 VTNLEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVND 357

Query: 349 FSMNPNIPWLMASAEEENIVQVWKCSSKLPRVGGLPKV 386
           F +N  IPWL+AS EEENI+QVWKCS  LP VGG PKV
Sbjct: 358 FDLNAQIPWLVASTEEENILQVWKCSHSLPVVGGPPKV 395

>KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {ON}
           Anc_6.9 YEL056W
          Length = 414

 Score =  444 bits (1141), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 213/389 (54%), Positives = 279/389 (71%), Gaps = 5/389 (1%)

Query: 7   DKPLSIDEEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXGNSHS--NRQELILGTHTSE 64
           ++PL   EEY+LW+SNVP+MYDFVS                ++ +   RQELILGTHTS+
Sbjct: 28  NRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTSD 87

Query: 65  EEPNYLKIAAIDLPDEIVPGKEDRERDG-FTKSNIKIIKKFKHEQEVTRARYMPQDSNLI 123
           EE NYLKIA +DLP E+       E D    +SNI++ +KFKH+ EVTRARYMPQD N++
Sbjct: 88  EEQNYLKIAVVDLPTEVTDTSNLTESDEEQVRSNIRVTRKFKHDSEVTRARYMPQDPNIL 147

Query: 124 ATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDI 183
           ATI+G+GTV++YDRS + D   ++ L +H DNGYGL+FNP+ KG LLSGSDDS +ALWD+
Sbjct: 148 ATISGTGTVYIYDRSNERDTASIT-LQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDV 206

Query: 184 TTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVT 243
           T++  +PV  WE+ H D VNDC+WH    + FG+VSED +LQ+HD R    V   I    
Sbjct: 207 TSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVA-TINGTK 265

Query: 244 AFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVM 303
            FNT++FS HS NL A  G +S +YLYD R     LH MSGH   VT+L+F +  DGI++
Sbjct: 266 PFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIIL 325

Query: 304 SSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAE 363
           S+G D+RVI+WD+ +IGAEQV +DA+D + EV+MIHAGHRSP+NDF++NP+IPWL+ASAE
Sbjct: 326 SAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAE 385

Query: 364 EENIVQVWKCSSKLPRVGGLPKVDDSVLE 392
           EENIVQ+WKCS KLPR+ G P V   +L+
Sbjct: 386 EENIVQLWKCSHKLPRISGTPPVRVDMLQ 414

>Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)
          Length = 427

 Score =  442 bits (1138), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 225/405 (55%), Positives = 276/405 (68%), Gaps = 19/405 (4%)

Query: 2   AEEQVDKPLSIDEEYELWRSNVPLMYDFVSXXXXXXXXXXXX-----XXXGNSHSNRQEL 56
           A E  +K LS+DEEY+LW+SNVPLMYDFVS                          RQEL
Sbjct: 26  AMETQEKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQEL 85

Query: 57  ILGTHTSEEEPNYLKIAAIDLPDEIV----PGKEDRERDGFT----KSNIKIIKKFKHEQ 108
           I+GTHTS EE NYLK A I++P EI+    P +E  E D  T    KSNI+I  K+ HE+
Sbjct: 86  IIGTHTSGEEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEE 145

Query: 109 EVTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGK 168
           E+TRARYMPQ+ + +AT+NG GTVFLY RS     GL S+L FH+DNGY LSFN + +G+
Sbjct: 146 EITRARYMPQNPDFVATLNGQGTVFLYSRSG----GLQSTLKFHKDNGYALSFNALVEGQ 201

Query: 169 LLSGSDDSKIALWDITTNSTK--PVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQL 226
           LLSGSDD  +ALW++ +NST   PV TW   H D VND KWH  N   FG+VSED  L++
Sbjct: 202 LLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKI 261

Query: 227 HDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHE 286
           +D R  +   D +K    FNT+AFS HS+NL AAAG DS +YLYD R     LH MSGHE
Sbjct: 262 NDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHE 321

Query: 287 SNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPV 346
             VTN+EF    DG+V+SSG D R+IMWDL +IGAEQ PDDA+DG PE++M+HAGHRS V
Sbjct: 322 DAVTNIEFSTHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSV 381

Query: 347 NDFSMNPNIPWLMASAEEENIVQVWKCSSKLPRVGGLPKVDDSVL 391
           NDF +N  IPWL+AS+EEENI+QVWKCS  LP VGG PKV+  ++
Sbjct: 382 NDFDLNAQIPWLVASSEEENILQVWKCSHNLPIVGGPPKVNKDII 426

>CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056w HAT2
          Length = 419

 Score =  441 bits (1135), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 217/396 (54%), Positives = 278/396 (70%), Gaps = 11/396 (2%)

Query: 7   DKPLSIDEEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXGN---SHSNRQELILGTHTS 63
           ++P+++DEEYELW+SNVP++YDFVS                    +   RQ+LILGTHTS
Sbjct: 25  NEPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLILGTHTS 84

Query: 64  EEEPNYLKIAAIDLPDEIVPGKEDRERDG-----FTKSNIKIIKKFKHEQEVTRARYMPQ 118
            EE NYLKI A+DLP E+    +              SN+KI+KKF H+ E+TRARYMPQ
Sbjct: 85  GEEQNYLKIGAVDLPVEVTENSKKDREIDEEDEDMVLSNVKIVKKFPHDGEITRARYMPQ 144

Query: 119 DSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKI 178
           D N+IATING G +F+YDRSK+G E LLS+L +H +NGYGL+FN  +K  LLSGSDDS I
Sbjct: 145 DDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNI 204

Query: 179 ALWDITT--NSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVT 236
           ALWDI+    + KP  T+E  H D +ND KWH    + FGSVSED T++L D+R    + 
Sbjct: 205 ALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKR-SSQII 263

Query: 237 DKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYA 296
             I T   +NT+AFS  S+NLFAAAGTD+L+YLYD R   N L+ M+GHE  VT +EF  
Sbjct: 264 HNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDP 323

Query: 297 AKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIP 356
             DGI+ SSG DRR I+WDL EIGAEQ  D+ +DG PEV+MIHAGH++ +ND ++NPNI 
Sbjct: 324 NNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNIN 383

Query: 357 WLMASAEEENIVQVWKCSSKLPRVGGLPKVDDSVLE 392
           WL+ASAEE+NIVQ+WKCSS +PR+GG P+VD S+L+
Sbjct: 384 WLVASAEEDNIVQIWKCSSNIPRIGGEPEVDLSILD 419

>KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9
           YEL056W
          Length = 391

 Score =  428 bits (1100), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 209/385 (54%), Positives = 280/385 (72%), Gaps = 8/385 (2%)

Query: 1   MAEEQVDKPLSIDEEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXGNSHS--NRQELIL 58
           M  ++ ++ LSIDEEY+LW+SNVPLMYDFVS                +  +   +QE+I+
Sbjct: 1   MGPQEEERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMII 60

Query: 59  GTHTSEEEPNYLKIAAIDLPDEIVPGKEDRERDGFTKSNIKIIKKFKHEQEVTRARYMPQ 118
           GTHTS++EPNY+KIA+I+LP+E++        D   KSN++I KKFK E+E+TR+RYM Q
Sbjct: 61  GTHTSDQEPNYVKIASIELPNEVI--DPHNVSDAPVKSNVRITKKFKLEKEITRSRYMVQ 118

Query: 119 DSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKI 178
           D N+I+TI+G+GTV ++DR  +  +  + +  +H+DNGYGLSFNP+ KG+LLS +DD  I
Sbjct: 119 DPNIISTIDGNGTVSIFDR--NSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYI 176

Query: 179 ALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSED-CTLQLHDQRVKDSVTD 237
           A++DI   S  PV TW+S     +ND KWH  +   FG+VSE+  TL ++D R KD VT 
Sbjct: 177 AMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVT- 235

Query: 238 KIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAA 297
            I+    FN++AFSKHS NLF+AAGTD  +YLYD R T   LH+MSGHE  VTNLEF+ +
Sbjct: 236 SIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDS 295

Query: 298 KDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPW 357
            DGI++SS EDRR+I+WDLMEIG+EQV +DA D +PE++MIHAGHRS VNDFS+N +IPW
Sbjct: 296 VDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPW 355

Query: 358 LMASAEEENIVQVWKCSSKLPRVGG 382
           L+AS EEENI+QVWK SS+LPR+  
Sbjct: 356 LIASTEEENIIQVWKSSSRLPRISN 380

>KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} similar
           to uniprot|P39984 Saccharomyces cerevisiae YEL056W
          Length = 398

 Score =  427 bits (1099), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 212/376 (56%), Positives = 267/376 (71%), Gaps = 10/376 (2%)

Query: 10  LSIDEEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXGNSHSNRQELILGTHTSEEEPNY 69
           +S+DEEY+LW+SNVPLMYDFVS                N  SN QELILGTHTS  E NY
Sbjct: 10  VSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNEQELILGTHTSGTEQNY 69

Query: 70  LKIAAIDLPDEIV-------PGKEDRERDGFT-KSNIKIIKKFKHEQEVTRARYMPQDSN 121
           LKIA++ LPDE+V       P  +D +  G   +S IKI++KF+H  EVTRARY P + N
Sbjct: 70  LKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFNPN 129

Query: 122 LIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALW 181
           LIATI+GSG VFLYDRSKD D  L +   FH++NGYGL+F+ +  G+LLS SDD  IA+W
Sbjct: 130 LIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIW 189

Query: 182 DITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKT 241
           D+ +    PV   ++ H + VN+CKWHE +   FGSVS+D TL +HD+R+   V  KI  
Sbjct: 190 DVCSGKNTPVKV-DTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVV-KILQ 247

Query: 242 VTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGI 301
              +NT+AFSKHS+NLFAAAGTDS + LYD R+    +H+MSGH  +VT+LEF   KDGI
Sbjct: 248 SEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGI 307

Query: 302 VMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMAS 361
           + S   DRRV++WDL +IGAEQ  +DADDG PE++M+HAGH+SPVNDFS +PNIPWLMAS
Sbjct: 308 LCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMAS 367

Query: 362 AEEENIVQVWKCSSKL 377
            EEEN+VQ+WK S KL
Sbjct: 368 VEEENVVQIWKASKKL 383

>Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON}
           similar to Ashbya gossypii ACR017W
          Length = 397

 Score =  426 bits (1094), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 213/378 (56%), Positives = 268/378 (70%), Gaps = 7/378 (1%)

Query: 4   EQVDKPLSIDEEYELWRSNVPLMYDFVSXXXXXXXXXXXX---XXXGNSHSNRQELILGT 60
           E  + PL++D+EYELW+SNV LMYDFVS                   N    +QE+ILGT
Sbjct: 8   EHDESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGT 67

Query: 61  HTSEEEPNYLKIAAIDLPDEIVPGKEDRERDGFTKSNIKIIKKFKHEQEVTRARYMPQDS 120
           HTS +E NYLKIAAIDLP E+V   ++       KS IK+ KKF+HE EV RARYMP++ 
Sbjct: 68  HTSGDENNYLKIAAIDLPYEVVGLPDEDNSSEPVKSMIKVTKKFEHEDEVIRARYMPKND 127

Query: 121 NLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIAL 180
            +IATING G +F+YDRSK   EGL  +L +H+DNGYGL+FNP  +G+LLS SDD+ +AL
Sbjct: 128 KIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVAL 187

Query: 181 WDITTNST-KPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKI 239
           WDI  NST +PVS   + H D VND KWHE + N FG+VSED TLQ+HD+R   +    +
Sbjct: 188 WDI--NSTDRPVSIVMN-HTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVL 244

Query: 240 KTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKD 299
                 N +AFSKHS NL AAAGTD+ +YLYD RR    LHTM+GH+  VT++EF + KD
Sbjct: 245 PVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKD 304

Query: 300 GIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLM 359
           GI+ SSG DRR+ +WDL +IGAEQ  +DADDG PE++M+HAGHRS +NDFS NP +PWL+
Sbjct: 305 GILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLI 364

Query: 360 ASAEEENIVQVWKCSSKL 377
           ASAEE+N+VQVWK S KL
Sbjct: 365 ASAEEDNVVQVWKISKKL 382

>KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 408

 Score =  424 bits (1089), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 208/396 (52%), Positives = 268/396 (67%), Gaps = 16/396 (4%)

Query: 4   EQVDKPLSIDEEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXGNSHSN--------RQE 55
           E+ ++P +I+EEY+LW SNVP+MYDFVS                             RQE
Sbjct: 5   EEPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQE 64

Query: 56  LILGTHTSEEEPNYLKIAAIDLPDEIVPGKEDRERDG------FTKSNIKIIKKFKHEQE 109
           L++GT T++ EPNYLKIAAIDLP+ +   K     D         +S IKI++KFKHEQE
Sbjct: 65  LLIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKHEQE 124

Query: 110 VTRARYMPQDSNLIATINGSGTVFLYDRS-KDGDEGLLSSLGFHEDNGYGLSFNPVDKGK 168
           VTRARYMPQ  N+IAT+NG+G V+++DR+ K+ D G ++S  +H++NGYGL+FNP   G+
Sbjct: 125 VTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQ 184

Query: 169 LLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHD 228
           LLS SDD  +ALWD+T+ + K  S     H D VNDCKWHE   + FG+VSED TL +HD
Sbjct: 185 LLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHD 244

Query: 229 QRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESN 288
               D    K+   +AFNT+AFSK S NL AAAGTDS +YLYD RR    LH+M+GHE +
Sbjct: 245 TN-SDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDS 303

Query: 289 VTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVND 348
           VT+LEF   +DG++ SSG DRR+IMWDL  IGAEQ PDDA DG PE+ M+H GHRSPVN+
Sbjct: 304 VTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNE 363

Query: 349 FSMNPNIPWLMASAEEENIVQVWKCSSKLPRVGGLP 384
           FS N N+PWLM S EEEN++Q+WK ++K+ R    P
Sbjct: 364 FSHNSNVPWLMCSVEEENVLQIWKPANKIVRPPQPP 399

>ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL056W (HAT2)
          Length = 423

 Score =  412 bits (1058), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 203/369 (55%), Positives = 257/369 (69%), Gaps = 3/369 (0%)

Query: 10  LSIDEEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXGNSHSNRQELILGTHTSEEEPNY 69
           L+++EEYELW SNVP+MY+FVS                +  S  Q LI GTHT+ EE NY
Sbjct: 42  LTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQSPEQSLIFGTHTAGEEVNY 101

Query: 70  LKIAAIDLPDEIVPGKE-DRERDGFTKSNIKIIKKFKHEQEVTRARYMPQDSNLIATING 128
           LK+A I+LP  I    + D E +    S+  I  KF H +EV RARYMP +SN+IATING
Sbjct: 102 LKVATINLPAGIAGLDQGDEEDEANDHSSFAIANKFPHIEEVIRARYMPANSNIIATING 161

Query: 129 SGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNST 188
            GT+ ++DR+ +  +  +S+L FH++NGYGL+FNP   G+LLSGSDD+ +ALWDI   + 
Sbjct: 162 KGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEA-AK 220

Query: 189 KPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTI 248
           KP S   S H D VND KWHE   N FG+VSED TLQ+HD+RV+     K+ T + FNT+
Sbjct: 221 KPKSILTS-HDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTL 279

Query: 249 AFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGED 308
           +FSKHS NL AAAG DS IYLYD R   + LH MSGH+ +VT +EF    DGI+ SSG D
Sbjct: 280 SFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSD 339

Query: 309 RRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIV 368
           RR I+WDL +IGAEQ  DDADDG+PE++M+HAGHRSPVN+FS NP IPWL+AS EE+N++
Sbjct: 340 RRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVI 399

Query: 369 QVWKCSSKL 377
           Q WK S KL
Sbjct: 400 QAWKVSMKL 408

>Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON}
           YEL056W (HAT2) - subunit of a cytoplasmic histone
           acetyltransferase [contig 186] FULL
          Length = 396

 Score =  409 bits (1050), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 213/383 (55%), Positives = 270/383 (70%), Gaps = 8/383 (2%)

Query: 1   MAEEQVDKPLSIDEEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXGNSHSNRQELILGT 60
           M   + ++ LSID+EY+LW+SNVPLMYDFVS                   S  QEL++GT
Sbjct: 1   MQSTEPERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTEQELLVGT 60

Query: 61  HTSEEEPNYLKIAAIDLPDEIVPGK------EDRERDGFTKSNIKIIKKFKHEQEVTRAR 114
           HTS+ E NYLKIA I+LP EI+  +      ++   D    S IKIIKKFKHE EVTRAR
Sbjct: 61  HTSDSEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRAR 120

Query: 115 YMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSD 174
           Y P DSNLIATI+G+GTVFLYDR+KD +  L     +H++NGYGL+F+    G+L+S SD
Sbjct: 121 YAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSD 180

Query: 175 DSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDS 234
           D  IA+WDI +  T P S   S H D VN+CKWHE + N +GSVSED  L +HD+R +  
Sbjct: 181 DGSIAIWDIKSGKTVPTSV-NSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKP 239

Query: 235 VTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEF 294
           +  K+     FNTIAFSKHS+NLFAAAGTD+++YL+DSR+    LH+MSGH+  VT+LEF
Sbjct: 240 L-QKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEF 298

Query: 295 YAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPN 354
              KDGI+ S G DRRV++WDL +IG EQ  +DADDG PE++M+HAGH+S +NDFS +PN
Sbjct: 299 AHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPN 358

Query: 355 IPWLMASAEEENIVQVWKCSSKL 377
           +PWLMAS EEENIVQ+WK S KL
Sbjct: 359 VPWLMASVEEENIVQIWKPSRKL 381

>TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa]
           {ON} Anc_6.9 YEL056W
          Length = 407

 Score =  393 bits (1010), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 206/383 (53%), Positives = 260/383 (67%), Gaps = 16/383 (4%)

Query: 7   DKPLSIDEEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXGNSH----SNRQELILGTHT 62
           ++PL+ D+EYELW+SNVPL+YDFVS                N      SN Q L+LGTHT
Sbjct: 17  EEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGTHT 76

Query: 63  SEEEPNYLKIAAIDLPDEIVPGKEDRERDGFTKSNIKIIKKFKHEQEVTRARYMPQDSNL 122
           S EE NYLKIA I LPD+I+  K +   D   KSNI+IIKKFKHE EVTRA YMPQDS +
Sbjct: 77  SGEEQNYLKIAEITLPDQIINEKTEDNSDKHVKSNIRIIKKFKHELEVTRAHYMPQDSTI 136

Query: 123 IATINGSGTVFLYDRSKDGDEG--LLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIAL 180
           IATING GTVF+YD S D ++   ++S L  H++NGYGL+FNP+DKGKLLS SDD  +A 
Sbjct: 137 IATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY 196

Query: 181 WDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQR-----VKDSV 235
           W+I    + P+ T +      +ND +W++ N N FG V+E   L L D R     +K   
Sbjct: 197 WNI--QKSIPLLTLQET--SIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVS 252

Query: 236 TDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFY 295
              IKT +AFN +AFS HS  L AA+G DSLIYLYD+R     LH M GHE +VT+L+F+
Sbjct: 253 NHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFH 312

Query: 296 AAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGS-PEVVMIHAGHRSPVNDFSMNPN 354
           A  DGIV+S G D+RV +WDL +IG EQ  D+ +DG  PE++MIHAGHRSP+NDFSM+ N
Sbjct: 313 ALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNN 372

Query: 355 IPWLMASAEEENIVQVWKCSSKL 377
           + WL AS EE+NIVQVWK ++ L
Sbjct: 373 LNWLCASIEEDNIVQVWKMNNSL 395

>TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  110 bits (275), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 97/410 (23%), Positives = 185/410 (45%), Gaps = 62/410 (15%)

Query: 12  IDEEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXG-NSHSNRQELILGTHTS-----EE 65
           + E Y  W+ N  L+YD+++                 N+ ++   ++L + TS     +E
Sbjct: 23  LQERYTHWKKNTRLLYDYLNTNSTKWPSLSCQFFQDVNTKNDSHRILLSSFTSGLMPEQE 82

Query: 66  EPNYLKIAAID-LPDEIVPGKEDRERDGFTKSNIKIIKKFKH-EQEVT-------RARYM 116
             N + I+ +  +P   +   +  E +    +N+K+  K  H EQ +T       RARY+
Sbjct: 83  SINIMSISTLKHVPWASLNNFDMDEMEFKPDNNLKLPPKNLHTEQTITFPNGDCNRARYL 142

Query: 117 PQDSNLIATINGSGTVFLYDRSKDGD------------------EGLLSSLGFHEDNGYG 158
           PQ+ ++IA  +  GTV++++R+K G                   E  + S+  + +    
Sbjct: 143 PQNQDIIAGASSDGTVYIFNRTKYGSTLRQTSSFQSYQARFAEPENTVQSVDSNPNEALS 202

Query: 159 LSFNPVDKGKLLSGSDDSKIALWDI-------TTNSTKPVSTWESCHQDGVNDCKWHELN 211
           + +N   +G L +   D +I  WD+       TT +T  VS       +G ND  W  L+
Sbjct: 203 IDWNVQREGLLAASYSDGEIKTWDLKKFSNANTTITTPTVSI--MMDTNGANDVTWMPLH 260

Query: 212 GNTFGSVSEDCTLQLHD---QRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIY 268
            +   +  E   L ++D    R   +++  I      N   F+  +  + A+A T   ++
Sbjct: 261 DSLLAACGESNKLIIYDIRGSREHTTISSGIHE-DGINACRFNYANNLIVASADTVGNVH 319

Query: 269 LYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVI-MWDLMEIGAEQVPDD 327
           ++D R++  ++ T+  H S+++ +E+    D I+ ++G+D  ++ +WD+ +         
Sbjct: 320 IWDIRKSNEIVKTIP-HGSSISTIEWNPNMDTILATAGQDDGLVKLWDVTD--------- 369

Query: 328 ADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSKL 377
                 E++  H GH   VND S N + PWLM S   +N VQ+W+ +  L
Sbjct: 370 -----SELIFTHGGHMLGVNDISWNRHDPWLMCSVARDNSVQIWRPAHNL 414

>Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa]
           {ON} complement(104336..105589) [1254 nt, 418 aa]
          Length = 417

 Score =  109 bits (272), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 103/417 (24%), Positives = 179/417 (42%), Gaps = 57/417 (13%)

Query: 3   EEQVDKPLSIDEEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXG-NSHSNRQELILGTH 61
           E+    P    + Y  W+ N  L+Y++++                 N+ ++   ++L + 
Sbjct: 12  EQSSAIPKERQDRYTTWKKNTKLLYEYLNTNSNKWPSLTCQFFPDVNTKNDSHRILLSSF 71

Query: 62  TS----EEEPNYL-KIAAIDLPDEIVPGKEDRERDGFT--KSNIKIIKKFKHEQEV---- 110
           TS    E+E  Y+ +I+ +           D +   F    SNIK+  K    + V    
Sbjct: 72  TSSLVPEDESLYITRISTLKHLSWASLNNFDLDEMEFKPDNSNIKLPPKNLTTELVIRFP 131

Query: 111 ----TRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFH-------------- 152
                RARY+PQ+ +LIA  +  G+V+++DR+K G        GF               
Sbjct: 132 NGDCNRARYLPQNPDLIAAASSDGSVYIFDRTKHGTAMHSRQSGFTQSYQAKLAVNNNSQ 191

Query: 153 ----EDNGYGLSFNPVDKGKLLSGSDDSKIALWDITT-NSTKPVSTWESCH----QDGVN 203
               E+    + +N   +G L+    D  +  WDIT    + PV      +    + G N
Sbjct: 192 SLNGENEALTIDWNHQKEGHLVVAYSDGHVKAWDITKYKRSDPVIKAPEYNYKLDESGCN 251

Query: 204 DCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTV--TAFNTIAFSKHSTNLFAAA 261
           D  W   + + F + SED  L L D R + ++ D   +V     N   F+  ++ L A+ 
Sbjct: 252 DAVWMPEHNSLFAACSEDNRLSLFDTRDESNIIDISTSVHKGGINACRFNPRNSLLLASG 311

Query: 262 GTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVI-MWDLMEIG 320
            +   I L+D R+    ++ +  H S+++ +E+      ++ S+G+D  ++ +WD     
Sbjct: 312 DSIGNICLWDIRKKETPINILD-HGSSISTIEWNPNLSTVLASAGQDDGLVKLWDA---- 366

Query: 321 AEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSKL 377
                     GS + V IH GH   VND S N + PWLM S  ++N +Q+WK +  L
Sbjct: 367 ----------GSDKPVFIHGGHMLGVNDISWNMHDPWLMCSVSKDNSIQIWKPAHNL 413

>TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  106 bits (264), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 97/417 (23%), Positives = 181/417 (43%), Gaps = 66/417 (15%)

Query: 12  IDEEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXGNSHSN-RQELILGTHTSEEEP--- 67
           + + Y  W+ N  L+YD+++                   SN    L+L T TS + P   
Sbjct: 13  LQQRYSHWKKNTKLLYDYLNTNSNKWPSLTCQFFPDIDKSNDTHRLLLSTFTSSQIPDDE 72

Query: 68  ----------NYLKIAAIDLPD-EIVPGKEDRERDGFTKSNIKIIKKFKHEQEVTRARYM 116
                     N+L  ++++  D + +  K D      +K+ I  I     E +  +ARYM
Sbjct: 73  SIYISHISTLNHLDWSSLNNFDMDEMEFKPDNRIKFPSKNLITDISITFPEGDCNKARYM 132

Query: 117 PQDSNLIATINGSGTVFLYDRSKDG------------------DEGLLSSLGFHEDNG-- 156
           PQ+ ++I   + +G ++++DR+K G                  +  L     F  ++G  
Sbjct: 133 PQNPDIIGCASSNGCIYIFDRTKRGSKLSTTTSARFSSGSKAYEAKLAKQRKFVIEDGTK 192

Query: 157 ------YGLSFNPVDKGKLLSGSDDSKIALWDI-----TTNSTKPVSTWESCHQD-GVND 204
                   +++NP  +G+LLS   +  I LWD      + N     + W++   D G N+
Sbjct: 193 NDEFECLSIAWNPQQEGQLLSCESNGNIHLWDFQKEFSSKNREINNTIWDTNFDDLGCNE 252

Query: 205 CKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVT---AFNTIAFSKHSTNLFAAA 261
             W   + + F +  E+  + + D R K+ + + I+        N+  F+  +  L A+ 
Sbjct: 253 VTWMNGHNSIFATCGENNKMAVFDTR-KEGIVNSIEQGNHNGGINSCKFNYENAMLLASG 311

Query: 262 GTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSG-EDRRVIMWDLMEIG 320
            ++ +I L+D R+    +  +  H S+++ +E+    + ++ S G ED  V +WD   I 
Sbjct: 312 DSNGIINLWDIRKLNKPIRNLY-HGSSISTIEWSPLMNEMIASGGQEDGLVKLWD---IS 367

Query: 321 AEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSKL 377
            E+ P          + IH GH   +ND S + + PWL+ S   +N +Q+WK +  L
Sbjct: 368 NEEEP----------IFIHGGHMLGINDLSWDLHDPWLLCSVGSDNSIQIWKPAKHL 414

>NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON}
           Anc_8.548
          Length = 419

 Score =  106 bits (264), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 99/422 (23%), Positives = 183/422 (43%), Gaps = 62/422 (14%)

Query: 2   AEEQVDKPLSIDEEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXG-NSHSNRQELILGT 60
           A+EQ   P  + + Y  W+ N  L+YD+++                 ++ S+   +++ +
Sbjct: 7   AQEQSTIPNDLQQRYSNWKKNTKLLYDYLNTNATKWPSLTCQFFPDLDTTSDTHRILISS 66

Query: 61  HTSEEEP----------------NYLKIAAIDLPD-EIVPGKEDRERDGFTKSNIKIIKK 103
            TS + P                N+  +   D+ + E  P    +       +++ I  K
Sbjct: 67  FTSSQLPEDEAIHISKISTLKHLNWASVNNFDMDEMEFKPDTNLKLPSKHLVNDLTI--K 124

Query: 104 FKHEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGF------------ 151
           F +  +  RARY+PQ+ ++IA  + +G+V+++DR+K G   +  S               
Sbjct: 125 FPN-GDCNRARYLPQNPDVIAAASSNGSVYIFDRTKHGSSRIRQSKNLKPYDAVLFNNSE 183

Query: 152 -----HEDN--GYGLSFNPVDKGKLLSGSDDSKIALWDIT----TNST--KPVSTWESCH 198
                HE+      L++N   +G L S     ++ +WDI     +N    KPV   +   
Sbjct: 184 TVEELHENTNEAISLAWNYQKEGTLASCYLQGQVQIWDIKQYFHSNPVLDKPVLNIQ-FD 242

Query: 199 QDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTD--KIKTVTAFNTIAFSKHSTN 256
             GVND  W   + + F +  E  TL L DQR+   V+   + +     N+  F+  +  
Sbjct: 243 ALGVNDVSWMPSHDSLFVACGESDTLALFDQRIGKEVSRIAQNRHNGGVNSCKFNYQNNM 302

Query: 257 LFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGE-DRRVIMWD 315
           L A+A ++ L+ ++D R           H S+++ +E+    D I+ ++G+ D  V +WD
Sbjct: 303 LLASADSEGLVNMWDIRNLDQYPIKSINHGSSISTIEWNPNLDTIIATAGQNDGLVKLWD 362

Query: 316 LMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSS 375
           +             +   E++ +H GH   VND S + +  WLM S   +N +Q+WK + 
Sbjct: 363 V------------SNTDNELLFVHGGHMLGVNDISWDLHDSWLMCSVSNDNSIQIWKPAH 410

Query: 376 KL 377
            L
Sbjct: 411 NL 412

>YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}
           MSI1Subunit of chromatin assembly factor I (CAF-1);
           chromatin assembly by CAF-1 is important for multiple
           processes including silencing at telomeres, mating type
           loci, and rDNA; maintenance of kinetochore structure;
           deactivation of the DNA damage checkpoint after DNA
           repair; and chromatin dynamics during transcription;
           Msi1p localizes to both nucleus and cytoplasm and has an
           independent role as a negative regulator of the RAS/cAMP
           pathway via sequestration of Npr1p kinase
          Length = 422

 Score =  105 bits (262), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 100/428 (23%), Positives = 179/428 (41%), Gaps = 68/428 (15%)

Query: 1   MAEEQVDKPLSIDEEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXG-NSHSNRQELILG 59
           +  E    P+ + E Y  W+ N  L+YD+++                 ++ S+   ++L 
Sbjct: 8   ITHEASSIPIDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTSDEHRILLS 67

Query: 60  THTSEEEP-------------NYLKIAAIDLPD----EIVPGKEDRERDGFTKSNIKIIK 102
           + TS ++P              ++K ++++  D    E  P    R       ++I I  
Sbjct: 68  SFTSSQKPEDETIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRFPSKHLVNDISI-- 125

Query: 103 KFKHEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDG-------------DEGLLSSL 149
            F    E  RARY+PQ+ ++IA  +  G ++++DR+K G             +  L  S 
Sbjct: 126 -FFPNGECNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFETKLFGSH 184

Query: 150 GFHED------------NGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTK-PVSTWE- 195
           G  +D                L++N   +  LLS   + ++ +WDI   S + P+     
Sbjct: 185 GVIQDVEAMDTSSADINEATSLAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPL 244

Query: 196 -SCHQDG--VNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDS--VTDKIKTVTAFNTIAF 250
            S + DG  VND  W   + + F + +E   + L D R K     +++ K     N+  F
Sbjct: 245 VSINSDGTAVNDVTWMPTHDSLFAACTEGNAVSLLDLRTKKEKLQSNREKHDGGVNSCRF 304

Query: 251 SKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSG-EDR 309
           +  ++ + A+A ++  + L+D R           H ++V+ LE+    D ++ ++G ED 
Sbjct: 305 NYKNSLILASADSNGRLNLWDIRNMNKSPIATMEHGTSVSTLEWSPNFDTVLATAGQEDG 364

Query: 310 RVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQ 369
            V +WD                  E +  H GH   VND S + + PWLM S   +N V 
Sbjct: 365 LVKLWDT--------------SCEETIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVH 410

Query: 370 VWKCSSKL 377
           +WK +  L
Sbjct: 411 IWKPAGNL 418

>Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  103 bits (257), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 100/431 (23%), Positives = 181/431 (41%), Gaps = 76/431 (17%)

Query: 2   AEEQVDKPLSIDEEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXG-NSHSNRQELILGT 60
           A E  + P ++ E Y  W+ N  L+Y++++                 ++  +   ++L +
Sbjct: 9   ANEASNIPPNLQERYSHWKKNTKLLYEYLNTNSTKWPSLTCQFFPDLDTTLDEHRILLSS 68

Query: 61  HTSEEEP-------------NYLKIAAIDLPD----EIVPGKEDRERDGFTKSNIKIIKK 103
            TS ++P              ++K ++++  D    E  P    R       ++I I   
Sbjct: 69  FTSSQKPEDESIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRYPPKHLVNDISI--- 125

Query: 104 FKHEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDG-------------DEGLLSSLG 150
           F    E  RARY+PQ+ ++IA  +  G ++++DR+K G             +  L  S G
Sbjct: 126 FFPNGECNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEAKLFGSHG 185

Query: 151 FHED------------NGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTK------PVS 192
             +D                +++N   +  LLS   + ++ +WDI   S +      P+ 
Sbjct: 186 VIQDVETMDASSADINEATSIAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLV 245

Query: 193 TWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVT-----AFNT 247
           +  S    GVND  W   + + F + +E  T+ L D R K    +K+K+         N+
Sbjct: 246 SINS-DGSGVNDVTWMPTHDSLFAACTEGNTVSLLDLRTKK---EKLKSNCRSHNGGVNS 301

Query: 248 IAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSG- 306
             F+  ++ + A+A ++  + L+D R   +   T   H  +V+ LE+    D ++ ++G 
Sbjct: 302 CKFNYRNSLILASADSNGKLNLWDIRNMNDCPLTTMEHGGSVSTLEWSPNFDTVLATAGQ 361

Query: 307 EDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEEN 366
           ED  V +WD                  E +  H GH   VND S + + PWLM S   +N
Sbjct: 362 EDGLVKLWDT--------------SREENIFTHGGHMLGVNDISWDAHDPWLMCSVANDN 407

Query: 367 IVQVWKCSSKL 377
            V +WK +  L
Sbjct: 408 SVHIWKPAVNL 418

>KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {ON}
           Anc_8.548 YBR195C
          Length = 413

 Score =  103 bits (256), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 93/412 (22%), Positives = 179/412 (43%), Gaps = 59/412 (14%)

Query: 9   PLSIDEEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXG-NSHSNRQELILGTHTSEEEP 67
           P  + E Y  W+ N  L+Y +++                 ++ ++   ++L T TS + P
Sbjct: 13  PDDLQERYSRWKKNTKLLYSYLNTNTSKWPSLTCQFFPDLDTTTDTHRILLSTFTSSQLP 72

Query: 68  ----------------NYLKIAAIDLPDEIVPGKEDRERDGFTKSNIKIIKKFKHEQEVT 111
                           N+  +   D+ DE+    ++  +      N+ I   F +  +  
Sbjct: 73  EDESLYIANLSTSNHLNWSSLNNFDM-DEMEFKPDNSTKFPSKNLNVDISIPFPN-GDCN 130

Query: 112 RARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYG------------- 158
           RARY+PQ+ +L+A  + +G++++++R+K G   L S+    E   Y              
Sbjct: 131 RARYLPQNPDLLAAASSNGSIYIFNRTKHGSRRLNSNQRSFEARLYSTDKMDENFTNSNE 190

Query: 159 ---LSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWES-----CHQDGVNDCKWHEL 210
              +++N    G L S      I +WDIT  S    +  E+        +G N+  W   
Sbjct: 191 AVSIAWNLQKNGTLASSYSQGSIKIWDITKYSCSDPTLRENELTIPFDPEGCNEVTWMVN 250

Query: 211 NGNTFGSVSEDCTLQLHDQRVKD---SVTDKIKTVTA-FNTIAFSKHSTNLFAAAGTDSL 266
           + + F + SE   L L D R K+    +T+ I T +   N+  F+ ++  L A+A +   
Sbjct: 251 HDSIFAACSESNKLSLFDVRTKEEMLKMTENIGTHSGGINSCKFNYYNDMLLASADSTGK 310

Query: 267 IYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVI-MWDLMEIGAEQVP 325
           I ++D R+          H S+++ LE+    + I++++G+D  ++ +WD          
Sbjct: 311 INMWDIRKLDKEPIKSFNHNSSISTLEWNPNLETILVTAGQDDGLVKIWDT--------- 361

Query: 326 DDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSKL 377
                 + + + +H GH   VND S + + PWL++S   +N + VWK ++ L
Sbjct: 362 -----ANGQNIFVHGGHMLGVNDVSWDLHDPWLLSSVSNDNSIHVWKPATNL 408

>Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON}
           YBR195C (REAL)
          Length = 424

 Score =  102 bits (254), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 94/421 (22%), Positives = 176/421 (41%), Gaps = 70/421 (16%)

Query: 9   PLSIDEEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXG-NSHSNRQELILGTHTSEEEP 67
           P+ + E Y  W+ N  L+YD+++                 ++  +   ++L + TS ++P
Sbjct: 16  PIDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTLDEHRILLSSFTSSQKP 75

Query: 68  -------------NYLKIAAIDLPD----EIVPGKEDRERDGFTKSNIKIIKKFKHEQEV 110
                         ++K ++++  D    E  P    R       ++I I   F    + 
Sbjct: 76  EDETIYISKISTLGHIKWSSLNNFDMDEMEFKPENTTRLPPSHLVNDISI---FFPNGDC 132

Query: 111 TRARYMPQDSNLIATINGSGTVFLYDRSKDG-------------DEGLLSSLGFHED--- 154
            RARY+PQ+ ++IA  +  G ++++DR+K G             +  L  S G  +D   
Sbjct: 133 NRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKNSHPFEAKLFGSHGVIQDVEA 192

Query: 155 ---------NGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTK------PVSTWESCHQ 199
                        L++N   +  LLS   + ++ +WDI   S +      P+ + ES   
Sbjct: 193 MDTSSADVNEATSLAWNLQQEALLLSSHSNGQVQIWDIKQYSHENPLIDSPLVSIES-DA 251

Query: 200 DGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSV--TDKIKTVTAFNTIAFSKHSTNL 257
            GVND  W   + + F + +E   + L D R K     +++       N+  F+  ++ +
Sbjct: 252 SGVNDVTWMPTHDSLFAACTEGNVVSLLDLRTKKEKLRSNRQNHTGGVNSCKFNYRNSLV 311

Query: 258 FAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGE-DRRVIMWDL 316
            A+A ++  + L+D R+      T   H ++++ LE+      ++ ++G+ D  V +WD 
Sbjct: 312 LASADSNGRLNLWDIRKMNESPITTMEHGASISTLEWNPNFSTVLATAGQQDGLVKLWDT 371

Query: 317 MEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSK 376
                            E +  H GH   VND S + + PWLM S   +N V +WK +  
Sbjct: 372 --------------AREETIFTHGGHMLGVNDVSWDVHDPWLMCSVANDNSVHIWKPAEN 417

Query: 377 L 377
           L
Sbjct: 418 L 418

>ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 397

 Score =  101 bits (251), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 96/402 (23%), Positives = 170/402 (42%), Gaps = 54/402 (13%)

Query: 14  EEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXG-NSHSNRQELILGTHTSEEEPN--YL 70
           + Y LW+ N  L+YD+++                 ++ S+   L+  + TS + P    +
Sbjct: 10  QRYTLWKKNTKLLYDYLNTNSFKWPSLSCQFFPDLDTSSDTHRLLFTSFTSSQLPQDENV 69

Query: 71  KIAAID----LP---------DEIVPGKEDRERDGFTKSNIKIIKKFKHEQEVTRARYMP 117
            IA+I     +P         DE+    +   +       I++   F H  +  RA Y+P
Sbjct: 70  TIASISTLRHVPWSSLNNFDMDEMEFKPDLSTKLPPKNLQIQLTINFPHG-DCNRATYLP 128

Query: 118 QDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHE------DNG------YGLSFNPVD 165
           Q+ +LI+T +  G+V+++DR+K G   +    G  E      +NG        L +N   
Sbjct: 129 QNPDLISTASSDGSVYIFDRTKRGKSPISHLRGPFEAQLLPNNNGSPIGETVALDWNRQI 188

Query: 166 KGKLLSGSDDSKIALWDITTNS------TKPVSTWESCHQDGVNDCKWHELNGNTFGSVS 219
           +G L S   + ++ +WDI          ++P + +      G ND  W   +        
Sbjct: 189 EGILASTYSNGQLCIWDIKKFEKRNPIMSQPSADFIDTESQGFNDVSWMPSHDCLLSIAR 248

Query: 220 EDCTLQLHDQRVKDSVTD---KIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTG 276
           ED  + L D R   ++          +  N   F+     L A A  D L+ L+D R+  
Sbjct: 249 EDNIMTLFDTRTNGNIAQTGPSTNHASGINCTKFNPSQPLLVATASGDGLVQLWDIRKLH 308

Query: 277 NVLHTMSGHESNVTNLEFYAAKDGIVMSSG-EDRRVIMWDLMEIGAEQVPDDADDGSPEV 335
           N + T++  ES ++ LE+      ++ + G ED  V +W+            A +G  ++
Sbjct: 309 NPIKTINC-ESPLSALEWNPQLPTVLATGGQEDGLVKLWN------------ASNG--QL 353

Query: 336 VMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSKL 377
           +  H GH   VND + +P+  WLM S   +N   +WK +S+L
Sbjct: 354 LFTHGGHMLGVNDIAWSPHDKWLMCSVANDNSTHLWKPASRL 395

>Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  101 bits (251), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 102/413 (24%), Positives = 177/413 (42%), Gaps = 70/413 (16%)

Query: 12  IDEEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXG-NSHSNRQELILGTHTSEEEP--- 67
           + E Y  W+ N  L+YD+++                 ++  N   ++L + TS ++P   
Sbjct: 19  LQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTLNEHRILLSSFTSSQKPEDE 78

Query: 68  ----------NYLKIAAIDLPD-EIVPGKEDRERDGFTKSNIKIIKKFKHEQEVTRARYM 116
                      ++K A+++  D + +  K +      +K  +  I+ F    E  RARY+
Sbjct: 79  TIYISRISTLGHIKWASLNNFDMDEMEFKPENTTTYPSKHLVDDIRIFFPNGECNRARYL 138

Query: 117 PQDSNLIATINGSGTVFLYDRSKDGDE-------------GLLSSLGFHED--------- 154
           PQ+ ++IA  +  G ++++DR+K G                LL S G  +D         
Sbjct: 139 PQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEIKLLGSHGVIQDVETMDTSLV 198

Query: 155 ---NGYGLSFNPVDKGKLLSGSDDSKIALWDITTNS-TKPV--STWESCHQDG--VNDCK 206
                  L++N   +  LLS   + +I +WDI   S   P+      S   DG  VND  
Sbjct: 199 DINEATSLAWNLQQEALLLSSHSNGQIQVWDIKQYSHDNPIIDVPLMSIDSDGSSVNDVT 258

Query: 207 WHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVT-----AFNTIAFSKHSTNLFAAA 261
           W   + + F + +E   + L D R K    +K+K+         N+  F+  ++ + A+A
Sbjct: 259 WMPTHDSLFAACTERNAVSLLDLRTKK---EKLKSNCKIHGGGVNSCKFNYKNSLILASA 315

Query: 262 GTDSLIYLYDSRRTG-NVLHTMSGHESNVTNLEFYAAKDGIVMSSG-EDRRVIMWDLMEI 319
            ++  + L+D R    N + TM  H ++V+ LE+    D ++ ++G ED  V +WD    
Sbjct: 316 DSNGRLNLWDIRNMNENPIATME-HGASVSTLEWSPNFDTVLATAGQEDGLVKLWDTTR- 373

Query: 320 GAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWK 372
                         E +  H GH   VND S + + PWLM S   +N V +WK
Sbjct: 374 -------------EESIFTHGGHMFGVNDISWDVHDPWLMCSVANDNSVHIWK 413

>NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {ON}
           Anc_8.548
          Length = 414

 Score = 97.1 bits (240), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 103/423 (24%), Positives = 183/423 (43%), Gaps = 62/423 (14%)

Query: 1   MAEEQVDK---PLSIDEEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXG-NSHSNRQEL 56
           + EE V +   P  + + Y  W+ N  L+YD+++                 ++ S+   +
Sbjct: 4   IEEEHVPQSSIPEDLQQRYSNWKKNTRLLYDYLNTNSKKWPSLTCQFFHDLDTTSDTHRI 63

Query: 57  ILGTHTS----EEEPNYL-KIAAIDLPDEIVPGKEDRERDGFT-KSNIKIIKKFKHEQEV 110
           +L   TS    E+E  Y+ K++ +   +       D +   F  ++NIK+  K       
Sbjct: 64  LLSAFTSSQLPEDEAIYIAKLSTLKHLEWASINNFDMDEMEFKPENNIKLPSKNLTNDIS 123

Query: 111 TR--------ARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGF----------- 151
            R        ARY+PQ+ ++IA  +  G+++++DR+K G   +  S              
Sbjct: 124 IRFPDGDCNIARYLPQNPDVIAGASSHGSIYIFDRTKHGSLRMRQSKNLKPYEAALYCPP 183

Query: 152 -------HEDNGYGLSFNPVDKGKLLSGSDDSKIALWDIT--TNSTKPVSTWESCHQD-- 200
                  + +    +S+N   +G L S     +I LWD+   +NS   + T    + D  
Sbjct: 184 KGIENVENTNEATSISWNLQREGLLASCYSSGQIQLWDLKKYSNSKLEMDT-PLLNVDFD 242

Query: 201 --GVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTV--TAFNTIAFSKHSTN 256
             GVND  WH  + +   +  E   + L D R+   +    + +     N+  F+ H  +
Sbjct: 243 ALGVNDVNWHPSHDSILAASGESNIIGLFDNRLGTEILRSNEKMHNGGINSCKFNSHCDS 302

Query: 257 LFAAAGTDSLIYLYDSRRT-GNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVI-MW 314
           L  +  ++  I L+D R+  G  + T+  H S+++ LE+    + IV S+G+D  ++ +W
Sbjct: 303 LLISGDSEGRINLWDLRKLDGEPIKTLH-HGSSISTLEWNPNLETIVASAGQDDGLVKLW 361

Query: 315 DLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCS 374
           D+               + E+V  H GH   VND S N +  WLM S   +N VQVWK +
Sbjct: 362 DV--------------STDELVFTHGGHMLGVNDISWNLHDTWLMCSVSNDNSVQVWKPA 407

Query: 375 SKL 377
             L
Sbjct: 408 HNL 410

>AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR195C
           (MSI1)
          Length = 417

 Score = 95.1 bits (235), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 105/419 (25%), Positives = 174/419 (41%), Gaps = 55/419 (13%)

Query: 2   AEE--QVDKPLS--IDEEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXG-NSHSNRQEL 56
           AEE  QV   +S  + + Y  W+ N  L+YD+++                    +++  L
Sbjct: 7   AEEVPQVSSEISDELQQRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFMPDLEVPTDKHRL 66

Query: 57  ILGTHTSEEEPNYLKIAAIDLPD-EIVPG-------------KEDRERDGFTKSNIKIIK 102
           +L + TS + P    +   +L     VP              K D +     K+ ++ ++
Sbjct: 67  LLSSFTSSQLPEDEAVYISELSTMRHVPWSSLNNFDMDEMEFKVDNQAKLPNKNLVETVR 126

Query: 103 KFKHEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDGDE--GLLSSLGFHE------- 153
                 +  RA YMPQ+ ++I  I  +G V ++DR+K G     LL S   +E       
Sbjct: 127 IQFPSGDCNRACYMPQNPDIIGAIASTGAVNIFDRTKHGTNRPKLLGSAASYEIQLNEPE 186

Query: 154 -------DNGYGLSFNPVDKGKLLSGSDDSKIALWDIT--TNSTKPVSTWE-SCHQD--G 201
                       L++N    G + S   +  I +WDIT    S   +S  E    QD  G
Sbjct: 187 SLGDADSAEALSLAWNWQKAGIIASSYSNGLIKVWDITRYQKSQPTISNPELRILQDKAG 246

Query: 202 VNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSV--TDKIKTVTAFNTIAFSKHSTNLFA 259
            ND  W   + +   +  E  T+ L D R  D+   T         N + F+  +  L  
Sbjct: 247 TNDVSWMVHHSSILAACGESNTIGLLDTRAPDAFKPTKASPHTGGINALQFNYANDMLLC 306

Query: 260 AAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGE-DRRVIMWDLME 318
           AA ++  I L+D R     L   + H  +V+ L++      IV ++G+ D  + +WD   
Sbjct: 307 AADSNGGIALWDCRAFSKPLSVFN-HGDSVSALQWNPNLPTIVATAGQGDGLIKIWD--- 362

Query: 319 IGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSKL 377
               + P+D+      ++ +H GH   VND + N + PWLM S   +N V VWK ++ L
Sbjct: 363 --TSREPEDS------LLFVHGGHMLGVNDIAWNYHDPWLMCSVANDNSVHVWKPAANL 413

>CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa]
           {ON} similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195c MSI1
          Length = 419

 Score = 94.4 bits (233), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 97/412 (23%), Positives = 177/412 (42%), Gaps = 68/412 (16%)

Query: 9   PLSIDEEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXG-NSHSNRQELILGTHTSEEEP 67
           P  +   Y  W+ N  L+YD+++                 ++ S++  L+L + TS + P
Sbjct: 18  PEDVQTRYIHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTSSDQHRLLLSSFTSSQLP 77

Query: 68  ----------------NYLKIAAIDLPD-EIVPGKEDRERDGFTKSNIKIIKKFKHEQEV 110
                           N+  +   D+ + E  P    +       + + I  +F +  + 
Sbjct: 78  EDESVYISKISTLKHLNWSSLNNFDMDEMEFKPDPSVKLPPKNLTTEVSI--RFPN-GDC 134

Query: 111 TRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSL----------GFHE------- 153
            R+RY+PQ+ +LIA  +  G+V++++++K G+  L S            G H+       
Sbjct: 135 NRSRYLPQNPDLIAAASSDGSVYIFNKTKHGNSVLRSKSSDDFQARLFSGSHDAQNLDNF 194

Query: 154 DNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNS------TKPVSTWESCHQDGVNDCKW 207
           +    LS+N   +G L       +  +WD+   S      ++P  T  +   +G ND  W
Sbjct: 195 NEAVSLSWNKHKEGILGVSYSQGQCNIWDVKKFSRSNILISQPELT-VTFDSNGCNDLDW 253

Query: 208 HELNGNTFGSVSEDCTLQLHDQRVK-----DSVTDKIKTVTAFNTIAFSKHSTNLFAAAG 262
             ++ + F +  E   L L D R+      +S+++  K     NT  F+  ++ L A+A 
Sbjct: 254 MPMHDSMFIACGESNKLGLFDMRLNGEKEVNSISN-YKHEDGINTCKFNPGNSLLVASAD 312

Query: 263 TDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSG--EDRRVIMWDLMEIG 320
           T   I L+D R+      +   H S+++ +E +    G+V +S   ED  V +WD   +G
Sbjct: 313 TCGRINLWDIRKLDQEPISTMQHGSSISTIE-WNPNIGVVFASAGQEDGLVKLWD-ASVG 370

Query: 321 AEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWK 372
            E             + +H GH   VND S + + PWLMAS   +N +Q+W+
Sbjct: 371 KE-------------IFVHGGHMLGVNDISWDMHDPWLMASVSNDNTIQIWR 409

>Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to
           Ashbya gossypii AEL250C
          Length = 414

 Score = 94.0 bits (232), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 94/405 (23%), Positives = 175/405 (43%), Gaps = 50/405 (12%)

Query: 9   PLSIDEEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXG-NSHSNRQELILGTHTSEEEP 67
           P  + + Y  W+ N  L+Y++++                 +  S++  ++L + TS + P
Sbjct: 18  PEPLQQRYTNWKKNTRLLYEYLNTNSTKWPSLTCQFMPDMDIASDKHRILLSSFTSAQLP 77

Query: 68  N--YLKIAAIDLPDEIVPGK------EDRE-----RDGFTKSNIKIIKKFKHEQEVTRAR 114
               + I+ I     I          E+ E     +   +K+  + IK    E +  RAR
Sbjct: 78  EDEAIYISEISTMKHIAWSSLNNFHMEEMEFKVDNQVKLSKNLTETIKIQFPEGDCNRAR 137

Query: 115 YMPQDSNLIATINGSGTVFLYDRSKDG-DEGLLSSLGFHED------------NGYGLSF 161
           YMPQ+ ++IA+ +  G+V+++DR+K G +   +    F  D                L++
Sbjct: 138 YMPQNPDVIASASSLGSVYIFDRTKHGSNRPKILGNTFKYDMELKEVESGCNYEASSLAW 197

Query: 162 NPVDKGKLLSGSDDSKIALWDITT-NSTKPVST-----WESCHQDGVNDCKWHELNGNTF 215
           N    G L +   D  + +WDIT  N  +P  T     W+   ++G N+  W   + +  
Sbjct: 198 NYQRSGILAASYSDGDVKIWDITKYNKAQPQLTVPDLRWQ-VDKEGANEVSWMVHHSSIL 256

Query: 216 GSVSEDCTLQLHDQRVKDSVTDKIKTV--TAFNTIAFSKHSTNLFAAAGTDSLIYLYDSR 273
               E   L + D R   + + K  +      N + F+  +  L  +A ++  + + D R
Sbjct: 257 AVCGEGNGLTILDTRTPTTFSTKRHSCHTGGINAVQFNYDNDFLLCSADSEGTLNICDIR 316

Query: 274 RTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGE-DRRVIMWDLMEIGAEQVPDDADDGS 332
           +  + + T S H   V+ +++      ++ S+G+ D  V +WDL           A +  
Sbjct: 317 QLEHPVKTWS-HLDAVSTIQWNPKFPTVIASAGQNDGLVKIWDL-----------AQEDD 364

Query: 333 PEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSKL 377
           P +V IH GH   VND + N + PW+M S   +N V +WK ++ +
Sbjct: 365 P-LVFIHGGHMLGVNDIAWNHHDPWVMCSVSNDNSVHIWKPAANI 408

>KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {ON}
           Anc_8.548 YBR195C
          Length = 426

 Score = 90.5 bits (223), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 91/421 (21%), Positives = 172/421 (40%), Gaps = 71/421 (16%)

Query: 12  IDEEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXG-NSHSNRQELILGTHTSEEEPN-- 68
           +   Y  W+ N  L+YD+++                 +++++   ++L ++TS + P   
Sbjct: 15  LQTRYAYWKKNTKLLYDYLNTNTAKWPSLTCQFFPDVDANTDTHRILLSSYTSCQLPEDE 74

Query: 69  -----------YLKIAAIDLPD----EIVPGKEDRERDGFTKSNIKIIKKFKHEQEVTRA 113
                      +L  A+++  D    E  P +  +       +N+ I        +  RA
Sbjct: 75  NVYVASISTLAHLDWASLNNFDMDEMEFKPDRTTKFPPKNLATNVSITFP---RGDCNRA 131

Query: 114 RYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYG--------------- 158
           RYMPQ+ ++IA  + +G V++++R+K G   +        +  YG               
Sbjct: 132 RYMPQNPDVIAAASSNGAVYVFNRTKHGTRRIQKHAASDAEQDYGPYEARFYNEETDEAR 191

Query: 159 ----------LSFNPVDKGKLLSGSDDSKIALWDITT----NSTKPVSTWESCHQD--GV 202
                     L++N   +G L        + +WD+      N+T   + WE  + D  GV
Sbjct: 192 RTPVDNEAVSLAWNHHREGTLAVAYSHGAVKVWDLQRFNVDNTTISETEWECSNFDSRGV 251

Query: 203 NDCKWHELNGNTFGSVSEDC-TLQLHDQRVKDSVTDKIKT---VTAFNTIAFSKHSTNLF 258
           ND  W   + +   +  E   +L L D R +++V  KI+        N   F+  +  L 
Sbjct: 252 NDVSWMSQHDSILAACGERSDSLALFDTRAQNAVA-KIRNQFKSEGINACKFNWENNLLL 310

Query: 259 AAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGE-DRRVIMWDL- 316
           A+  +     L+D R+          H  +V+ LE+      ++ ++G+ D  + +WD  
Sbjct: 311 ASTDSTGRTNLWDVRKLSAEPIVHFDHGGSVSTLEWNPHDHSVLATAGQSDGLIKIWDTS 370

Query: 317 MEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSK 376
           +EI              + + +H+GH   VND + + + PWLM S   +N V VWK ++ 
Sbjct: 371 LEI------------EDKTIFVHSGHMLGVNDIAWDLHDPWLMCSVSNDNSVHVWKPAAN 418

Query: 377 L 377
           L
Sbjct: 419 L 419

>TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {ON}
           Anc_8.548 YBR195C
          Length = 412

 Score = 90.5 bits (223), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 72/292 (24%), Positives = 133/292 (45%), Gaps = 41/292 (14%)

Query: 112 RARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSS----------------LGFHEDN 155
           RARY+PQ+ ++I+  +  G+++++DR+K       S+                L    + 
Sbjct: 130 RARYLPQNPDVISAASSDGSIYIFDRTKHNSTISRSTTSRPYEIKLEVAPQVELMDSPNE 189

Query: 156 GYGLSFNPVDKGKLLSGSDDSKIALWDIT----TNST--KPVSTWESCHQDGVNDCKWHE 209
              L +N   +G L S     ++ +WDI+    +N T   P+ + +     G ND  W  
Sbjct: 190 VVSLDWNKRKEGILASCHSRGQLLVWDISQYLHSNPTIQTPICSIDDFDPQGANDITWMP 249

Query: 210 LNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVT---AFNTIAFSKHSTNLFAAAGTDSL 266
            + +   +  E  T+ ++D R K  V+ KI+        N+  F+ H+  L A+A +   
Sbjct: 250 SHDSLLAACGESNTVAIYDTRSKSQVS-KIQPGLHNGGINSCDFNAHNDYLLASADSIGT 308

Query: 267 IYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSG-EDRRVIMWDLMEIGAEQVP 325
           ++++D R+          H S+++ +++      I+  +G ED  V +WD          
Sbjct: 309 VHMWDIRKLDQDPIQSVSHGSSISTVKWNPNVATIIAVAGQEDGLVKLWD---------- 358

Query: 326 DDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSKL 377
             A +G  +++  H GH   VND + N + PWLM S   +N + +W+ SS L
Sbjct: 359 --ASNG--QLIFTHGGHMLGVNDIAWNAHDPWLMCSVSNDNSIHLWRPSSHL 406

>KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 417

 Score = 89.7 bits (221), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 85/401 (21%), Positives = 179/401 (44%), Gaps = 42/401 (10%)

Query: 12  IDEEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXGNSHSN-RQELILGTHTSEEEP--- 67
           + + Y  W+ N  L+YD+++                 + +N +Q ++L + TS++ P   
Sbjct: 20  VQQRYTNWKKNTKLLYDYLNTNTSKWPSLSCQFFPDRTLTNDKQRILLSSFTSQQLPQDE 79

Query: 68  ----------NYLKIAAIDLPD-EIVPGKEDRERDGFTKSNIKIIKKFKHEQEVTRARYM 116
                     N++K ++I+  D + +  K D       K+  + ++    + +  R RYM
Sbjct: 80  SIYIGSISTMNHMKWSSINNFDMDEMEFKLDNSLKLNDKTLEEEVRITYPDGDCNRCRYM 139

Query: 117 PQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFH----------EDNGYGLSFNPVDK 166
           PQ+ ++I T + +G+V+++DR+K G++ + +   F           +D    L++N   +
Sbjct: 140 PQNPDIIGTASSNGSVYIFDRTKHGNK-ISTGRKFEIECRNNGDDEQDESLSLAWNYQLE 198

Query: 167 GKLLSGSDDSKIALWDIT----TNSTKPVSTWESCH-QDGVNDCKWHELNGNTFGSVSED 221
           G L +   + K+ +WD+T    +     +   ES    +GVND  W   + +   S  E 
Sbjct: 199 GTLATCQSNGKVKVWDLTKFDKSKQRMEIPERESVMDANGVNDVSWMVNHTSILASCGES 258

Query: 222 CTLQLHDQRVKDSVTDKIKTVT---AFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNV 278
             + L D R +D+  D +   T     N I F+  +  +     +   + ++D R     
Sbjct: 259 NVIGLIDIR-QDTKMDTLHRTTHTDGINAIEFNYKNDMILCTGDSQGQLKIWDIRDFKEP 317

Query: 279 LHTMS-GHESNVTNLEFYAAKDGIVMSSGEDRRVI-MWDLMEIGAEQVPDDADDGSPEVV 336
           +     G +  ++ +++      I+ ++ +   ++ +WD      EQ   +A++    ++
Sbjct: 318 IKEWEHGDQDPISAIQWNPQIPQILATADQQSGLVKIWD---ASGEQEDSNAENNM--LL 372

Query: 337 MIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSKL 377
            +H GH   VND S + + PW M S   +N + +WK ++ L
Sbjct: 373 FVHGGHMLGVNDISWSQHDPWTMCSVSNDNSIHIWKPAANL 413

>KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 418

 Score = 87.8 bits (216), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 69/295 (23%), Positives = 133/295 (45%), Gaps = 39/295 (13%)

Query: 109 EVTRARYMPQDSNLIATINGSGTVFLYDRSKDG--DEGLLS--------------SLGFH 152
           +  +ARY P + +LI + + +G+++++DR+K G   + L+S              SL  H
Sbjct: 133 DCNKARYCPSNPDLIGSASSNGSIYVFDRTKHGFARQKLISAGDTDHQIHCQLSTSLEEH 192

Query: 153 EDNGYGLSFNPVDKGKLLSGSDDSKIALWDI------TTNSTKPVSTWESCHQDGVNDCK 206
           ++    L++N   +G L +     ++ +WD+      +     P++   +    G N+  
Sbjct: 193 KNEAVSLAWNWQRQGLLATSYSHGQVCVWDLEKYDKNSPTLINPLAM-STVDPRGSNEVS 251

Query: 207 WHELNGNTFGSVSEDCTLQLHDQRVKD---SVTDKIKTVTAFNTIAFSKHSTNLFAAAGT 263
           W   + +     SED  + + D R  +   S           NT  F+ H   L  +A +
Sbjct: 252 WMVRHDSLLAYCSEDNLVGIMDIRNPEKGQSSGSNPHHSNGINTCQFNYHRDMLLCSADS 311

Query: 264 DSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVI-MWDLMEIGAE 322
              I L+D R     L T+  H  +++ L++   +  ++ + G+D  ++ +WDL +   +
Sbjct: 312 AGRINLWDIRNFTQPLKTLL-HNDSISVLQWNPREPTVLATGGQDGGLVKIWDLSQPEGQ 370

Query: 323 QVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSKL 377
                      E++  H GH   VND S +P+  W+M S   +N +QVW+ S+ L
Sbjct: 371 -----------ELIFTHGGHMLGVNDISWDPHDTWMMCSVANDNSIQVWRPSNSL 414

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/91 (21%), Positives = 46/91 (50%), Gaps = 1/91 (1%)

Query: 101 IKKFKHEQEVTRARYMPQDSNLIATI-NGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGL 159
           +K   H   ++  ++ P++  ++AT     G V ++D S+   + L+ + G H      +
Sbjct: 327 LKTLLHNDSISVLQWNPREPTVLATGGQDGGLVKIWDLSQPEGQELIFTHGGHMLGVNDI 386

Query: 160 SFNPVDKGKLLSGSDDSKIALWDITTNSTKP 190
           S++P D   + S ++D+ I +W  + +  +P
Sbjct: 387 SWDPHDTWMMCSVANDNSIQVWRPSNSLVEP 417

>SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {ON}
           similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195C MSI1 Subunit of chromatin assembly factor I
           (CAF- I) regulates the RAS/cAMP pathway via
           sequestration of Npr1p kinase localizes to the nucleus
           and cytoplasm homologous to human retinoblastoma binding
           proteins RbAp48 and RbAp46
          Length = 425

 Score = 86.7 bits (213), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 90/407 (22%), Positives = 168/407 (41%), Gaps = 50/407 (12%)

Query: 9   PLSIDEEYELWRSNVPLMYDFVSXXXXXXXXXXXXXXXGNSHSNRQ-ELILGTHTSEEEP 67
           P  +   Y  W+ N  L+YD+++                   +N Q  L+L + TS + P
Sbjct: 27  PEEVQTRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTNDQHRLLLSSFTSSQLP 86

Query: 68  -------------NYLKIAAIDLPD-EIVPGKEDRERDGFTKSNIKIIKKFKHEQEVTRA 113
                         +L  ++++  D + +  K D      +K+ IK +       +   A
Sbjct: 87  EDESIYVSRVSTLKHLPWSSLNNFDMDEMEFKLDNSSKLPSKNLIKELNISFPMGDCNGA 146

Query: 114 RYMPQDSNLIATINGSGTVFLYDRSKDG-------DEGLLSSLGFHEDN------GYGLS 160
           RY+PQ+ ++IA  + +G+++++DR+K G       D G +  L F   +         L+
Sbjct: 147 RYLPQNPDVIAAASSNGSIYVFDRTKHGLTRQKLHDGGSMFELEFQSSSLEEHQEVVSLA 206

Query: 161 FNPVDKGKLLSGSDDSKIALWDITTNSTK-PV----STWESCHQDGVNDCKWHELNGNTF 215
           +N   +G L +      + +WD+   S   PV        +    G ND  W   + +  
Sbjct: 207 WNWQREGLLAACYSGGDVKVWDVKKYSRNFPVIDKADYTHNADPRGCNDVSWMVNHASIL 266

Query: 216 GSVSEDCTLQLHDQRVKDSVTDKIKTVT----AFNTIAFSKHSTNLFAAAGTDSLIYLYD 271
               E  ++ + D R +  V    K         N+  F+ H+  L  +  +   + L+D
Sbjct: 267 ACCGESNSINVIDTRAQKGVLSSTKDTKHHSRGINSSQFNYHNDMLLCSGDSTGRVNLWD 326

Query: 272 SRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGE-DRRVIMWDLMEIGAEQVPDDADD 330
            R     L ++  H S+++  ++      I+ ++ + D  V +WD+ +   E        
Sbjct: 327 IRDLETPLKSLD-HGSSISKTQWNPNLSTILATADQSDGLVKLWDIAQEPGE-------- 377

Query: 331 GSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSKL 377
              E++ +H GH   VND S N + PWLM S   +N VQ+W+ +  L
Sbjct: 378 ---ELLFVHGGHMLGVNDISWNYHDPWLMCSVANDNSVQLWRPARNL 421

>Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR195C
           (MSI1) - p50 subunit of the yeast Chromatin Assembly
           Factor-I (CAF-I) negative regulator of ras-mediated cAMP
           induction; homologous to beta subunit of GTP-binding
           proteins [contig 24] FULL
          Length = 418

 Score = 86.3 bits (212), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 72/295 (24%), Positives = 129/295 (43%), Gaps = 39/295 (13%)

Query: 109 EVTRARYMPQDSNLIATINGSGTVFLYDRSKDGDE----------------GLLSSLGFH 152
           +  +ARY P + +LI++ + +G+V+++DR+K G                   L +SL   
Sbjct: 133 DCNKARYCPSNPDLISSASSNGSVYVFDRTKHGSARQKLISGGDPDHQIHCQLSTSLEER 192

Query: 153 EDNGYGLSFNPVDKGKLLSGSDDSKIALWDI------TTNSTKPVSTWESCHQDGVNDCK 206
           ++    L++N   +G L +     ++ +WD+      +     P S+  +  Q G ND  
Sbjct: 193 QNEALNLAWNWQQQGLLATCYSGGEVCVWDLAKYDKASPTLIDPHSSLLADPQ-GSNDIS 251

Query: 207 WHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKT---VTAFNTIAFSKHSTNLFAAAGT 263
           W   + +      E   L + D R+                 N   F+ +   L  +A +
Sbjct: 252 WMVNHDSLLAYCGEGNALGVLDTRITKQPPQSFSNPHHSNGVNACQFNYYKDLLLCSADS 311

Query: 264 DSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVI-MWDLMEIGAE 322
              I L+D R   + + ++  H S V+ L++      I+ ++G+D  ++ +WDL +    
Sbjct: 312 AGRINLWDIRDFSSPIRSLDHHGS-VSALQWNPHHPTILATAGQDDGLVKIWDLSQ---- 366

Query: 323 QVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSKL 377
             P D      E+   H GH   VND S +PN PW+M S   +N +Q+WK S  L
Sbjct: 367 --PVDQ-----ELKFTHGGHMLGVNDISWDPNDPWMMCSVSNDNSIQLWKPSQNL 414

 Score = 38.1 bits (87), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 43/91 (47%), Gaps = 1/91 (1%)

Query: 101 IKKFKHEQEVTRARYMPQDSNLIATI-NGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGL 159
           I+   H   V+  ++ P    ++AT     G V ++D S+  D+ L  + G H      +
Sbjct: 327 IRSLDHHGSVSALQWNPHHPTILATAGQDDGLVKIWDLSQPVDQELKFTHGGHMLGVNDI 386

Query: 160 SFNPVDKGKLLSGSDDSKIALWDITTNSTKP 190
           S++P D   + S S+D+ I LW  + N   P
Sbjct: 387 SWDPNDPWMMCSVSNDNSIQLWKPSQNLMTP 417

>Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {ON}
           complement(61507..62967) [1461 nt, 487 aa]
          Length = 486

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 90/194 (46%), Gaps = 25/194 (12%)

Query: 161 FNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSE 220
           +NP+D   L+S S D+   +WD+   S+  V T    H   V D K+   +   F S   
Sbjct: 230 WNPIDTNLLISSSIDTTCIVWDL--QSSNYVRTQLIAHDSEVFDVKFLAHSTQLFASCGG 287

Query: 221 DCTLQLHDQRV----------------KDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTD 264
           D ++++ D R                  D++TD  K+ +A   +  S    N+ A    D
Sbjct: 288 DGSVRVFDLRSLAHSTIIYESNSDQNGSDTLTDNEKSPSALLRLQPSPSDPNVMATFALD 347

Query: 265 SL-IYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLME----- 318
           S  I + D R  G+ + T+ GH + V  ++++  K  +++S G+D +V+ WDL E     
Sbjct: 348 SKSILILDMRNPGSPVLTLEGHSAAVNQIKWHPKKSNVLLSCGDDCQVLYWDLNEWLSPT 407

Query: 319 -IGAEQVPDDADDG 331
            + A +   +A+DG
Sbjct: 408 SLSANENKVNANDG 421

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 55/155 (35%), Gaps = 42/155 (27%)

Query: 105 KHEQEVTRARYMPQDSNLIATIN-GSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNP 163
           K    + R +  P D N++AT    S ++ + D    G   L  +L  H      + ++P
Sbjct: 323 KSPSALLRLQPSPSDPNVMATFALDSKSILILDMRNPGSPVL--TLEGHSAAVNQIKWHP 380

Query: 164 VDKGKLLSGSDDSKIALWD---------ITTNSTK---------------PVSTWES--- 196
                LLS  DD ++  WD         ++ N  K               PVS W     
Sbjct: 381 KKSNVLLSCGDDCQVLYWDLNEWLSPTSLSANENKVNANDGPISGQQINAPVSQWNQSNV 440

Query: 197 ---------CH---QDGVNDCKWHELNGNTFGSVS 219
                    C+   Q  +N+  W    G+ FG VS
Sbjct: 441 QNVLDVPAMCYSNRQQEINNIAWRPHGGDWFGCVS 475

>KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {ON}
           Anc_8.672 YPL151C
          Length = 417

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 92/196 (46%), Gaps = 23/196 (11%)

Query: 159 LSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSV 218
           ++ +PVD     +GS+DS I +WD  +   K      S H  GV D    + +   F S 
Sbjct: 114 IAMDPVDNEWFATGSNDSTIKVWDFASGKLKLTL---SGHVMGVRDLVVSKRHPYMF-SA 169

Query: 219 SEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHST-NLFAAAGTDSLIYLYDSRRTGN 277
           SED  ++  D      + D    ++  +T+    H T +L A+AG DS++ L+D R    
Sbjct: 170 SEDKLVKCWDLEKNAPIRDYFGHLSGVHTVDI--HPTLSLIASAGRDSVVKLWDIRSKKA 227

Query: 278 VLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVM 337
           V+ T+ GH+S + +++   A D  ++S   D  VI WDL+               P  V+
Sbjct: 228 VI-TLVGHKSPINSVKCTPA-DPQIISCSNDTTVITWDLVA------------AKPMKVI 273

Query: 338 IHAGHRSPVNDFSMNP 353
            H  HR  V D +++P
Sbjct: 274 TH--HRKAVRDIAVHP 287

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 61/129 (47%), Gaps = 17/129 (13%)

Query: 248 IAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGE 307
           IA        FA    DS I ++D   +G +  T+SGH   V +L   + +   + S+ E
Sbjct: 114 IAMDPVDNEWFATGSNDSTIKVWDFA-SGKLKLTLSGHVMGVRDL-VVSKRHPYMFSASE 171

Query: 308 DRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENI 367
           D+ V  WDL            +  +P  +  + GH S V+   ++P +  L+ASA  +++
Sbjct: 172 DKLVKCWDL------------EKNAP--IRDYFGHLSGVHTVDIHPTLS-LIASAGRDSV 216

Query: 368 VQVWKCSSK 376
           V++W   SK
Sbjct: 217 VKLWDIRSK 225

>NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {ON}
           Anc_6.276
          Length = 494

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 81/176 (46%), Gaps = 13/176 (7%)

Query: 161 FNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSE 220
           +NP+D   L+S S D+   +WD+   S+  V T    H   V D ++   +   F S   
Sbjct: 240 WNPIDTNLLISSSIDTTCIVWDL--QSSNYVKTQLIAHDSEVYDVRFLTQSTQLFASCGG 297

Query: 221 DCTLQLHDQR--------VKDSVTDKIKTVTAFNTIAF--SKHSTNLFAAAGTDS-LIYL 269
           D ++++ D R         +  V+D     + F  +    S H  N+ A    DS  I +
Sbjct: 298 DGSVRVFDLRSLAHSTIIYEPPVSDLNPDTSQFALLRLEPSPHDPNVMATFAADSNKILI 357

Query: 270 YDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVP 325
            D R   + L  + GH ++V  ++++  K  +++S G+D +V+ WDL +  A   P
Sbjct: 358 LDMRNPESPLMILEGHSASVNQIKWHPIKRNVLLSGGDDCQVLYWDLNKCTASSDP 413

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 63/155 (40%), Gaps = 10/155 (6%)

Query: 96  SNIKIIKKFKHEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDN 155
           SN    +   H+ EV   R++ Q + L A+  G G+V ++D        ++      + N
Sbjct: 265 SNYVKTQLIAHDSEVYDVRFLTQSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPVSDLN 324

Query: 156 GYGLSF-------NPVDKGKLLS-GSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKW 207
                F       +P D   + +  +D +KI + D+  N   P+   E  H   VN  KW
Sbjct: 325 PDTSQFALLRLEPSPHDPNVMATFAADSNKILILDMR-NPESPLMILEG-HSASVNQIKW 382

Query: 208 HELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTV 242
           H +  N   S  +DC +   D     + +D + T 
Sbjct: 383 HPIKRNVLLSGGDDCQVLYWDLNKCTASSDPVATT 417

>Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {ON}
           YPL151C (REAL)
          Length = 451

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 100/209 (47%), Gaps = 24/209 (11%)

Query: 160 SFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVS 219
           + +PVD    ++GS+D+ + +WD+ +   K   T    H   V D    + +   F SVS
Sbjct: 146 AIDPVDNEWFVTGSNDTTMKVWDLASGKLKVTLT---GHVMTVRDIAVSDRHPYLF-SVS 201

Query: 220 EDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHST-NLFAAAGTDSLIYLYDSRRTGNV 278
           ED T++  D      + D    ++   T++   H T +L A AG DS++ L+D R    V
Sbjct: 202 EDKTVKCWDLEKNQIIRDYHGHLSGVRTVSI--HPTLDLIATAGRDSVVKLWDIRTRVPV 259

Query: 279 LHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMI 338
           + T+ GH+  +  +E  A  D  ++SS  D  V +WD++             G    V+ 
Sbjct: 260 I-TLVGHKGPINQVEC-APVDPQIVSSSTDATVRLWDIVA------------GKAMKVLT 305

Query: 339 HAGHRSPVNDFSMNPNIPWLMASAEEENI 367
           H  H+  V   +++PN  + MASA  ++I
Sbjct: 306 H--HKRSVRAIALHPN-EFSMASACTDDI 331

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 51/171 (29%), Positives = 83/171 (48%), Gaps = 9/171 (5%)

Query: 152 HEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELN 211
           HE    GL ++P D   LLSG  D+ + LWD+T+NS + +      H   V+  K H  +
Sbjct: 214 HEGKIGGLDWHP-DGNHLLSGGGDNLVKLWDMTSNSFEELRG----HAGRVSRVKVHP-S 267

Query: 212 GNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYD 271
           G    S S D T  L D   K  +  +     A  TIAF      L A+AG D++  ++D
Sbjct: 268 GRLAASASFDLTWILWDLERKVELQLQEGHSKAVYTIAFQSDGA-LLASAGLDAVCAIWD 326

Query: 272 SRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAE 322
             R+G  +  + GH   ++ ++ ++     + ++G D  V +WD+  +G E
Sbjct: 327 -LRSGEPIMKLEGHAGAISGVD-WSPNGYQLATAGADGTVRVWDIRNVGTE 375

>KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011W
          Length = 478

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 90/208 (43%), Gaps = 20/208 (9%)

Query: 110 VTRARYMPQDSNLIATINGSGTVFLY------------DRSKDGDEGLLSSLGFHEDNGY 157
           VT +   PQ  N + +     TV L+            D   + DEG++ +  FH ++ +
Sbjct: 118 VTPSYLSPQRENFMLSCGDDKTVKLWSVNSDDFSNVKDDTRLNTDEGIIKT--FHGEHAF 175

Query: 158 GLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGS 217
               +   K   ++G   ++I LWD  TN +KP+S   S   D +N  ++++   +   S
Sbjct: 176 QSLDHHRQKSNFVTGG--AQIELWD--TNRSKPISNL-SWGADNINHVRFNQNEVDILAS 230

Query: 218 VSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGN 277
              D ++ L+D R  +S T KI      N+I ++      F  A  D   Y YD R    
Sbjct: 231 TGSDNSVVLYDLRT-NSPTQKIVQTMRTNSICWNPVEAFNFVIANEDHNAYYYDMRNMSK 289

Query: 278 VLHTMSGHESNVTNLEFYAAKDGIVMSS 305
            LH    H S V +++F    D +V  S
Sbjct: 290 ALHVFKDHVSAVMDVDFSPTGDEVVTGS 317

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 42/196 (21%), Positives = 76/196 (38%), Gaps = 35/196 (17%)

Query: 145 LLSSLGF-HEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTN----------------- 186
            +  LG+ H D  Y ++ N     KL + S D  I  W+++T                  
Sbjct: 58  FVGQLGYGHRDGVYTIAKNYNVLNKLATASGDGVIKYWNMSTREELSSFKAHYGMVTGLC 117

Query: 187 ------STKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIK 240
                 S +  +   SC  D     K   +N + F +V +D  L        + +     
Sbjct: 118 VTPSYLSPQRENFMLSCGDDKT--VKLWSVNSDDFSNVKDDTRLN-----TDEGIIKTFH 170

Query: 241 TVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDG 300
              AF ++   +  +N F   G    I L+D+ R+  +   +S    N+ ++ F   +  
Sbjct: 171 GEHAFQSLDHHRQKSN-FVTGGAQ--IELWDTNRSKPI-SNLSWGADNINHVRFNQNEVD 226

Query: 301 IVMSSGEDRRVIMWDL 316
           I+ S+G D  V+++DL
Sbjct: 227 ILASTGSDNSVVLYDL 242

>ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} similar
           to uniprot|Q12523 Saccharomyces cerevisiae YPL247C
           Hypothetical ORF
          Length = 506

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 63/273 (23%), Positives = 109/273 (39%), Gaps = 48/273 (17%)

Query: 87  DRERDGFTKSNIKIIKKFKHEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLL 146
           + ER+   + N+ + K  K +Q  +R           A   GSG++    + + G  G L
Sbjct: 193 EEERNLQEQINLSLCKYDKQQQGASRVN---------AAAGGSGSIRTNPQQQQGLIGEL 243

Query: 147 SSL-GFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDC 205
             +  FH        +NPVD   L+S S D+   +WD+   S+  V T    H   V D 
Sbjct: 244 PPITSFH--------WNPVDPNLLISSSIDTTCIVWDL--QSSNYVRTQLIAHDSEVYDV 293

Query: 206 KWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAF--------------- 250
           ++       F S   D ++++ D R     T   +  ++  T+                 
Sbjct: 294 RFLTQTTQLFSSCGGDGSVRVFDLRCLAHSTIIYEPPSSPATLQPTTAAGSSSAADSDTG 353

Query: 251 --------SKHSTNLFAAAGTDS-LIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGI 301
                   S    N+ A    DS  + + D R  G+ +  + GH + V  + ++ +K  +
Sbjct: 354 VPLLRLEPSPFDPNVIATFAIDSPRVLILDMRNPGSPVLVLEGHSAAVNQMRWHPSKRNV 413

Query: 302 VMSSGEDRRVIMWDL----MEIGAEQVPDDADD 330
           ++S  +D +V+ WDL    M    +Q PD A D
Sbjct: 414 LLSCADDCQVLYWDLNNYIMGHPTDQDPDHAVD 446

>KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8.672
           YPL151C
          Length = 398

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 91/196 (46%), Gaps = 23/196 (11%)

Query: 159 LSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSV 218
           ++  PVD    ++GS+D+ + +WD+ +   K      S H  GV D    E +   F S 
Sbjct: 92  VAVEPVDNEWFVTGSNDTTLKVWDLASGKLKLTL---SGHTMGVRDVAVSERHPYMF-SA 147

Query: 219 SEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHST-NLFAAAGTDSLIYLYDSRRTGN 277
           SED  ++  D     ++ D    ++  +T+    H T +L A  G D+++ L+D  RT  
Sbjct: 148 SEDKLVKCWDLEKNTAIRDYYGHLSGVHTVDI--HPTLDLIATGGRDAVVKLWDI-RTRK 204

Query: 278 VLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVM 337
            + T+ GH++ +T ++     D  V+SS  D  V +WD++             G    V+
Sbjct: 205 AVKTLVGHKAPITKVKCTPV-DPQVVSSSTDTTVRLWDIVA------------GKSMKVL 251

Query: 338 IHAGHRSPVNDFSMNP 353
            H  H+  V   +++P
Sbjct: 252 TH--HKRAVRSIALHP 265

>Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa]
           {ON} complement(180839..181954) [1116 nt, 372 aa]
          Length = 371

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 68/296 (22%), Positives = 123/296 (41%), Gaps = 39/296 (13%)

Query: 113 ARYMPQDSNLIATINGS-------GTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVD 165
            +Y P   N +A  +GS       G +F+ D    G    ++S    +D  Y +++N + 
Sbjct: 15  VQYSPFFDNRLAVASGSNFGLVGNGNLFILDIDPQGRIHSMNSF-MTQDCLYDVAWNELH 73

Query: 166 KGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQ 225
           + ++L    D  + L+D T+    P++ ++  H   V  C W+ +N  TF S S D T++
Sbjct: 74  ENQVLVAQGDGSLRLFD-TSLQKFPIAIFKE-HSKEVLSCNWNLINKQTFVSSSWDGTVK 131

Query: 226 LHDQRVKDSV-TDKIKTVTAF----NTIA--------------------FSKHSTNLFAA 260
           +     K+S+ T +++ V       NTIA                    FS H  NL   
Sbjct: 132 IWTPNRKESLRTLQVQPVMQSQLVDNTIAKTNGSRGTISANKNCIYQAQFSPHDENLVMC 191

Query: 261 AGTDSLIYLYDSRR--TGNVLHTMSGHE-SNVTNLEFYAAKDGIVMSSGEDRRVIMWDL- 316
              +S + L+D R+  + N       H  S     +F   +  +V +SG D  + +WD+ 
Sbjct: 192 CSGNSYVTLFDLRQPNSNNKQQRFLAHNGSETLTCDFNKYRPTVVATSGVDSSIRIWDIR 251

Query: 317 MEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWK 372
           M +         +  +  +  I   H   V   + +P+ P ++ SA  +    VW+
Sbjct: 252 MLVNLGPQSQHINSSAACINEITRAHELAVRKVAWSPHHPNVLLSASYDMTCSVWQ 307

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 62/168 (36%), Gaps = 17/168 (10%)

Query: 110 VTRARYMPQDSNLIATINGSGTVFLYD-RSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGK 168
           + +A++ P D NL+   +G+  V L+D R  + +      L  +        FN      
Sbjct: 176 IYQAQFSPHDENLVMCCSGNSYVTLFDLRQPNSNNKQQRFLAHNGSETLTCDFNKYRPTV 235

Query: 169 LLSGSDDSKIALWDI------------TTNSTKPVSTWESCHQDGVNDCKWHELNGNTFG 216
           + +   DS I +WDI              +S   ++     H+  V    W   + N   
Sbjct: 236 VATSGVDSSIRIWDIRMLVNLGPQSQHINSSAACINEITRAHELAVRKVAWSPHHPNVLL 295

Query: 217 SVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSK----HSTNLFAA 260
           S S D T  +      D     +KT +  ++  F K    HS  +F A
Sbjct: 296 SASYDMTCSVWQDLSYDGSRFTMKTNSIDSSKGFIKRFTGHSEFVFGA 343

>TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa]
           {ON} Anc_6.340 YCR072C
          Length = 515

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 90/186 (48%), Gaps = 17/186 (9%)

Query: 147 SSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCK 206
           S++  H        F P    ++++G+ D+   +WD  T +  P++T  S HQ+ V    
Sbjct: 137 SAIAGHGATILCSQFAPHTSSRMVTGAGDNTARVWDCDTQT--PMAT-LSGHQNWVLCVA 193

Query: 207 WHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIK------TVTAFNTIAFSKHSTN-LFA 259
           W   +G T  + S DCT++L D +    + D +K      T   +  +   K       A
Sbjct: 194 WSP-DGETIATGSMDCTVRLWDSKAGQPLGDALKGHQKWITSLVWEPLHLVKPGDKPRLA 252

Query: 260 AAGTDSLIYLYD-SRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLME 318
           +A  D  I ++D SRR    ++T+SGH ++V+ +++     G++ S   D+ V +WD M 
Sbjct: 253 SASKDGTIKIWDTSRRV--CIYTLSGHTNSVSCVKW--GGQGLLYSGSHDKTVRVWD-MN 307

Query: 319 IGAEQV 324
           +G + +
Sbjct: 308 VGGKCI 313

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 61/257 (23%), Positives = 102/257 (39%), Gaps = 58/257 (22%)

Query: 106 HEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPV- 164
           H+  V    + P D   IAT +   TV L+D SK G + L  +L  H+     L + P+ 
Sbjct: 185 HQNWVLCVAWSP-DGETIATGSMDCTVRLWD-SKAG-QPLGDALKGHQKWITSLVWEPLH 241

Query: 165 -----DKGKLLSGSDDSKIALWDITTNSTKPVSTWE-SCHQDGVNDCKWHELNGNTFGSV 218
                DK +L S S D  I +WD    +++ V  +  S H + V+  KW         S 
Sbjct: 242 LVKPGDKPRLASASKDGTIKIWD----TSRRVCIYTLSGHTNSVSCVKWG--GQGLLYSG 295

Query: 219 SEDCTLQLHDQRVKDSVTDKIK------------------------TVTAFNTIAFSKHS 254
           S D T+++ D  V     + +K                        T T F +   ++  
Sbjct: 296 SHDKTVRVWDMNVGGKCINILKSHAHWVNHLSLSTEYALRVGPFDHTATKFTSAEEARKK 355

Query: 255 T---------------NLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKD 299
                            L   A  D  ++L+D  ++G  L  ++GH+  V ++ F  + D
Sbjct: 356 ALENYEKIAKRNGKAEELIVTASDDFTMFLWDPTKSGKPLARLTGHQKLVNHVAF--SPD 413

Query: 300 G-IVMSSGEDRRVIMWD 315
           G  ++S+  D  + +WD
Sbjct: 414 GRFIVSASFDNSIKLWD 430

>YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON}
           PRP46Member of the NineTeen Complex (NTC) that contains
           Prp19p and stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs
          Length = 451

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 81/160 (50%), Gaps = 9/160 (5%)

Query: 159 LSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSV 218
           ++ +PVD    ++GS+D+ + +WD+ T   K   T  + H   V D    + +   F SV
Sbjct: 145 VAIDPVDNEWFITGSNDTTMKVWDLATGKLK---TTLAGHVMTVRDVAVSDRHPYLF-SV 200

Query: 219 SEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHST-NLFAAAGTDSLIYLYDSRRTGN 277
           SED T++  D      + D    ++   T++   H T +L A AG DS+I L+D R    
Sbjct: 201 SEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSI--HPTLDLIATAGRDSVIKLWDMRTRIP 258

Query: 278 VLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLM 317
           V+ T+ GH+  +  ++     D  V+SS  D  V +WD++
Sbjct: 259 VI-TLVGHKGPINQVQCTPV-DPQVVSSSTDATVRLWDVV 296

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 27/123 (21%), Positives = 60/123 (48%), Gaps = 17/123 (13%)

Query: 258 FAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLM 317
           F     D+ + ++D   TG +  T++GH   V ++   + +   + S  ED+ V  WDL 
Sbjct: 155 FITGSNDTTMKVWD-LATGKLKTTLAGHVMTVRDVAV-SDRHPYLFSVSEDKTVKCWDLE 212

Query: 318 EIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSKL 377
           +               +++  + GH S V   S++P +  L+A+A  ++++++W   +++
Sbjct: 213 K--------------NQIIRDYYGHLSGVRTVSIHPTLD-LIATAGRDSVIKLWDMRTRI 257

Query: 378 PRV 380
           P +
Sbjct: 258 PVI 260

>ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} similar
           to uniprot|Q12417 Saccharomyces cerevisiae YPL151C PRP46
           Splicing factor that is found in the Cef1p subcomplex of
           the spliceosome
          Length = 427

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 58/215 (26%), Positives = 99/215 (46%), Gaps = 25/215 (11%)

Query: 159 LSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSV 218
           L  +PVD     +GS+D+ + +WD+ +   K      + H   V D    + +   F S 
Sbjct: 121 LKVDPVDNEWFATGSNDTTVKIWDLASGKLKLT---LAGHVMTVRDVAISQRHPYLF-SA 176

Query: 219 SEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHST-NLFAAAGTDSLIYLYDSRRTGN 277
           SED  ++  D      + D    ++  +T+    H T +L A+AG D ++ L+D R    
Sbjct: 177 SEDKMVKCWDLEKNQIIRDYHGHLSGVHTVDI--HPTLDLIASAGRDGVVKLWDIRSRTA 234

Query: 278 VLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVM 337
           V+ T+ GH+S +T +        +V SS  D  V +WD+              G    ++
Sbjct: 235 VM-TLIGHKSPITKVHCLPVNPQVV-SSSTDATVRLWDVTA------------GKSYKIL 280

Query: 338 IHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWK 372
            H  H+  V DFS++P+  + M SA  ++I + WK
Sbjct: 281 TH--HKRSVRDFSLHPS-EFSMVSACTDDI-RSWK 311

>TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON}
           Anc_6.276 YPL247C Two N bases added to fix a frameshift
           that can't be corrected using the reads.
          Length = 447

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 50/221 (22%), Positives = 89/221 (40%), Gaps = 23/221 (10%)

Query: 161 FNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSE 220
           +NP D   L+S S D+   +WD+   S   + T    H   V D ++   +   F S   
Sbjct: 218 WNPTDPNLLISSSIDTTCIVWDL--QSANYIKTQLIAHDSEVFDVRFLTQSTQLFASCGG 275

Query: 221 DCTLQLHDQR------------VKDSVTDKIKTVT--AFNTIAFSKHSTNLFAAAGTD-S 265
           D ++++ D R            + D   D        A   +  S    N+ A    D S
Sbjct: 276 DGSVRVFDLRCLAHSTIIYEPTIPDGAPDLPSPTVPPALLRLEPSPFDPNVIATFAIDSS 335

Query: 266 LIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL-MEIGAEQV 324
            + + D R  G+ L T+  H + +  ++++  +  +++S+ +D +V+ WDL   + +E  
Sbjct: 336 KVLILDMRSPGSPLLTLEAHTAPINQIKWHPTRRNVLLSASDDCQVLYWDLNTHLDSEST 395

Query: 325 PDDADDGSPE-----VVMIHAGHRSPVNDFSMNPNIPWLMA 360
            D   D  P+       M +A     VN+    P   W  A
Sbjct: 396 KDTTPDSQPDSTVQKPAMFYASGGQEVNNIVWRPQGDWFGA 436

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 54/127 (42%), Gaps = 23/127 (18%)

Query: 112 RARYMPQDSNLIATIN-GSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLL 170
           R    P D N+IAT    S  V + D    G    L +L  H      + ++P  +  LL
Sbjct: 316 RLEPSPFDPNVIATFAIDSSKVLILDMRSPGSP--LLTLEAHTAPINQIKWHPTRRNVLL 373

Query: 171 SGSDDSKIALWDITT----------------NST--KPVSTWESCHQDGVNDCKWHELNG 212
           S SDD ++  WD+ T                +ST  KP   + S  Q+ VN+  W    G
Sbjct: 374 SASDDCQVLYWDLNTHLDSESTKDTTPDSQPDSTVQKPAMFYASGGQE-VNNIVWRP-QG 431

Query: 213 NTFGSVS 219
           + FG++S
Sbjct: 432 DWFGAIS 438

>KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly
           similar to uniprot|P25636 Saccharomyces cerevisiae
           YCR057C PWP2 part of small (ribosomal) subunit (SSU)
           processosome (contains U3 snoRNA) Eight WD-repeats with
           homology with G protein beta subunits flanked by
           nonhomologous N-terminal and C-terminal extensions
           regulatory protein
          Length = 911

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 57/212 (26%), Positives = 101/212 (47%), Gaps = 18/212 (8%)

Query: 116 MPQDSNLIATINGSGTVFLYDRSKDG---------DEGLLSSLGFHEDNGYGLSFNPVDK 166
           M Q++     IN SG    +  SK G         +  +L   G H D   GL ++P D 
Sbjct: 296 MGQNAVNTVAINSSGEWLAFGSSKLGQLIVYEWQSESYILKQQG-HFDTLNGLCYSP-DG 353

Query: 167 GKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQL 226
            K+++ S + KI +WD+ +     ++T++  H  GV+  ++ +  G    S S D T++ 
Sbjct: 354 SKIVTASHEGKIKIWDVASGFC--LATFDE-HAGGVSAVEFAK-KGQVLFSASLDGTVKA 409

Query: 227 HDQ-RVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGH 285
            D  R ++  T        FN++A    S  +  A   DS      S +TG ++ T+SGH
Sbjct: 410 WDLIRYRNFRTFTATERIQFNSLAVDP-SGEVVCAGSEDSFDIFVWSVQTGQLVDTLSGH 468

Query: 286 ESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLM 317
           E  ++ L F + ++G++ S+  D+ + +W L 
Sbjct: 469 EGPISCLSF-SNENGVLASASWDKTIRVWSLF 499

>Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {ON}
           YPL151C (REAL)
          Length = 451

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 83/166 (50%), Gaps = 9/166 (5%)

Query: 160 SFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVS 219
           + +PVD    ++GS+D+ + +WD+ T   K   T  + H   V D    + +   F SVS
Sbjct: 146 AIDPVDNEWFVTGSNDTTMKVWDLATGKLK---TTLAGHVMTVRDIAVSDRHPYLF-SVS 201

Query: 220 EDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHST-NLFAAAGTDSLIYLYDSRRTGNV 278
           ED T++  D      + D    ++   T++   H T +L A AG DS++ L+D R    V
Sbjct: 202 EDKTVKCWDLEKNHIIRDYYGHLSGVRTVSI--HPTLDLIATAGRDSVVKLWDIRTRMPV 259

Query: 279 LHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQV 324
           + T+ GH+  +  ++     D  ++SS  D  V +WD++   A +V
Sbjct: 260 I-TLVGHKGPINQVQCTPV-DPQIVSSSTDATVRLWDIVAGKAMKV 303

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 59/123 (47%), Gaps = 17/123 (13%)

Query: 258 FAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLM 317
           F     D+ + ++D   TG +  T++GH   V ++   + +   + S  ED+ V  WDL 
Sbjct: 155 FVTGSNDTTMKVWD-LATGKLKTTLAGHVMTVRDIAV-SDRHPYLFSVSEDKTVKCWDLE 212

Query: 318 EIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSKL 377
           +                ++  + GH S V   S++P +  L+A+A  +++V++W   +++
Sbjct: 213 K--------------NHIIRDYYGHLSGVRTVSIHPTLD-LIATAGRDSVVKLWDIRTRM 257

Query: 378 PRV 380
           P +
Sbjct: 258 PVI 260

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 76/183 (41%), Gaps = 35/183 (19%)

Query: 194 WESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKT-----VTAFNTI 248
           W  C      D +W       F + S D T+     +V D  T K+KT     V     I
Sbjct: 141 WVRCAAIDPVDNEW-------FVTGSNDTTM-----KVWDLATGKLKTTLAGHVMTVRDI 188

Query: 249 AFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGED 308
           A S     LF+ +  D  +  +D  +  +++    GH S V  +  +   D ++ ++G D
Sbjct: 189 AVSDRHPYLFSVS-EDKTVKCWDLEK-NHIIRDYYGHLSGVRTVSIHPTLD-LIATAGRD 245

Query: 309 RRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIV 368
             V +WD+      ++P          V+   GH+ P+N     P  P +++S+ +   V
Sbjct: 246 SVVKLWDIRT----RMP----------VITLVGHKGPINQVQCTPVDPQIVSSSTDAT-V 290

Query: 369 QVW 371
           ++W
Sbjct: 291 RLW 293

>Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C
           (PRP46) - pre-mRNA splicing factor [contig 67] FULL
          Length = 433

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 78/164 (47%), Gaps = 9/164 (5%)

Query: 162 NPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSED 221
           +PVD     +GS+D+ I +WD+ +   K   T        V   + H L      S SED
Sbjct: 130 DPVDNAWFATGSNDTTIKVWDMASGKLKLTLTGHVMTVRSVAVSQRHPL----MFSASED 185

Query: 222 CTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHST-NLFAAAGTDSLIYLYDSRRTGNVLH 280
             ++  D     ++ D     +  NT+    H T +L A+AG D+++ L+D R    V+ 
Sbjct: 186 KMVKCWDLERNAAIRDYHGHFSGVNTVDV--HPTLDLIASAGRDAVVRLWDIRTRLPVM- 242

Query: 281 TMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQV 324
           T++GH+S +  ++ +   D  +MS   D  V +WD+    A ++
Sbjct: 243 TLAGHKSPINQVKCFPV-DPQIMSCSSDATVRLWDIRAGKATKI 285

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 77/160 (48%), Gaps = 24/160 (15%)

Query: 215 FGSVSEDCTLQLHDQ---RVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYD 271
           F + S D T+++ D    ++K ++T  + TV    ++A S+    +F+A+  D ++  +D
Sbjct: 137 FATGSNDTTIKVWDMASGKLKLTLTGHVMTV---RSVAVSQRHPLMFSAS-EDKMVKCWD 192

Query: 272 SRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDG 331
             R    +    GH S V  ++ +   D ++ S+G D  V +WD+      ++P      
Sbjct: 193 LERNA-AIRDYHGHFSGVNTVDVHPTLD-LIASAGRDAVVRLWDIRT----RLP------ 240

Query: 332 SPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVW 371
               VM  AGH+SP+N     P  P +M S   +  V++W
Sbjct: 241 ----VMTLAGHKSPINQVKCFPVDPQIM-SCSSDATVRLW 275

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 59/121 (48%), Gaps = 17/121 (14%)

Query: 258 FAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLM 317
           FA    D+ I ++D   +G +  T++GH   V ++   + +  ++ S+ ED+ V  WDL 
Sbjct: 137 FATGSNDTTIKVWD-MASGKLKLTLTGHVMTVRSVAV-SQRHPLMFSASEDKMVKCWDLE 194

Query: 318 EIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSKL 377
              A              +  + GH S VN   ++P +  L+ASA  + +V++W   ++L
Sbjct: 195 RNAA--------------IRDYHGHFSGVNTVDVHPTLD-LIASAGRDAVVRLWDIRTRL 239

Query: 378 P 378
           P
Sbjct: 240 P 240

>ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL151C (PRP46)
          Length = 425

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/214 (26%), Positives = 93/214 (43%), Gaps = 23/214 (10%)

Query: 159 LSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSV 218
           +  +PVD     +GS+DS I +WD+ T   K        H   V D      +   F S 
Sbjct: 119 VCVDPVDNAWFATGSNDSTIRVWDLATGKLKVTL---QGHIMTVRDICISARHPYMF-SA 174

Query: 219 SEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNV 278
           S+D  ++  D      V D   T++  +++     S +L  +AG DS++ ++D R    V
Sbjct: 175 SQDKLVKCWDLERNTVVRDFHGTLSGVHSVDLHP-SLDLIVSAGRDSVVRVWDIRSRSCV 233

Query: 279 LHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMI 338
           L T++GH   +  +      D  ++S   D  V +WDL+             G P   + 
Sbjct: 234 L-TLAGHRGPINKVRCLPV-DPQIVSCSTDATVKLWDLVA------------GKPMKTLT 279

Query: 339 HAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWK 372
           H  H+  V D + NP   +  ASA  ++I + WK
Sbjct: 280 H--HKRNVRDLAFNPT-EFSFASACTDDI-RSWK 309

>TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON}
           Anc_8.672 YPL151C
          Length = 434

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 56/212 (26%), Positives = 100/212 (47%), Gaps = 25/212 (11%)

Query: 162 NPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSED 221
           +PVD     +GS+D+ I +WD+ +   K      S H   V D    E +   F S SED
Sbjct: 131 DPVDNAWYATGSNDTSIKVWDLASGKLKLTL---SGHIMTVRDLAISERHPYMF-SASED 186

Query: 222 CTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHST-NLFAAAGTDSLIYLYDSRRTGNVLH 280
            T++  D      + +    ++  +T++   H T +L  +AG DS++ L+D R    V++
Sbjct: 187 KTIKCWDLEKNMVIRNYHGHLSGVHTVSL--HPTLDLVVSAGRDSVVKLWDMRTRVPVMN 244

Query: 281 TMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHA 340
            + GH+S +  +      D  ++S   D  + +WD+              G    ++ H 
Sbjct: 245 LI-GHKSPINKVRCLPV-DPQIISCSTDANIRLWDITA------------GKSAKILTH- 289

Query: 341 GHRSPVNDFSMNPNIPWLMASAEEENIVQVWK 372
            H+  V DF+++P+  + MASA  ++I + WK
Sbjct: 290 -HKRSVRDFALHPS-EFSMASACTDDI-RSWK 318

>SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|Q750X9 Ashbya gossypii AGL190W
           AGL190Wp and similar to YDR142C uniprot|P39108
           Saccharomyces cerevisiae YDR142C PEX7 May serve as
           intraperoxisomal receptor for type 2 peroxisomal
           proteins (such as thiolase) Member of
           beta-transducin-related (WD- 40) protein family
          Length = 368

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 67/298 (22%), Positives = 113/298 (37%), Gaps = 47/298 (15%)

Query: 113 ARYMPQDSNLIATINGS-------GTVFLYDRSKDGDEGLLSSLGFHEDNG-YGLSFNPV 164
            +Y P   N +A   GS       G +F+ D    G   ++ S  F   +G + +++N  
Sbjct: 14  VQYSPFYDNKLAVATGSNFGLVGNGKLFILDIDPHGR--MVESNSFLTQDGLFDVAWNEG 71

Query: 165 DKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTL 224
              ++L+   D  + L+DI      P+S ++  HQ  V  C W+ +N  TF S S D T+
Sbjct: 72  HANQVLAAQGDGSLRLFDINL-PQYPISIFQE-HQKEVFSCNWNLVNKQTFVSSSWDGTV 129

Query: 225 QLHDQRVKDSVTDKI-----------------------------KTVTAFNTIAFSKHST 255
           ++     ++S+T  +                             K         FS H  
Sbjct: 130 KIWSPMRQESLTTLVPIPMERSPLVEAKAGGIPLSNQQNHSIISKNKDCIYQAQFSPHDP 189

Query: 256 NLFAAAGTDSLIYLYDSRRTGNV--LHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIM 313
           NL      +S + L+D R+  N    + MS         +F   +  IV + G D+ V +
Sbjct: 190 NLIMCCAGNSYVTLFDLRQPTNTNQQNFMSHGGLETLTCDFNKYRPHIVATGGVDKLVKI 249

Query: 314 WDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVW 371
           WDL  +     P        E+     GH   +   S +P+   L+ S   +   +VW
Sbjct: 250 WDLRMVRKFSNPLQQPMSINEI----PGHELAIRKVSWSPHHSNLVLSTSYDMTCRVW 303

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 28/131 (21%), Positives = 53/131 (40%), Gaps = 7/131 (5%)

Query: 105 KHEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPV 164
           K++  + +A++ P D NLI    G+  V L+D  +  +    + +           FN  
Sbjct: 174 KNKDCIYQAQFSPHDPNLIMCCAGNSYVTLFDLRQPTNTNQQNFMSHGGLETLTCDFNKY 233

Query: 165 DKGKLLSGSDDSKIALWDI------TTNSTKPVSTWE-SCHQDGVNDCKWHELNGNTFGS 217
               + +G  D  + +WD+      +    +P+S  E   H+  +    W   + N   S
Sbjct: 234 RPHIVATGGVDKLVKIWDLRMVRKFSNPLQQPMSINEIPGHELAIRKVSWSPHHSNLVLS 293

Query: 218 VSEDCTLQLHD 228
            S D T ++ D
Sbjct: 294 TSYDMTCRVWD 304

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 35/78 (44%), Gaps = 9/78 (11%)

Query: 247 TIAFSKHSTNLFAAAGTDSLIYLYD---SRRTGNVLHT------MSGHESNVTNLEFYAA 297
           T  F+K+  ++ A  G D L+ ++D    R+  N L        + GHE  +  + +   
Sbjct: 227 TCDFNKYRPHIVATGGVDKLVKIWDLRMVRKFSNPLQQPMSINEIPGHELAIRKVSWSPH 286

Query: 298 KDGIVMSSGEDRRVIMWD 315
              +V+S+  D    +WD
Sbjct: 287 HSNLVLSTSYDMTCRVWD 304

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 68/295 (23%), Positives = 120/295 (40%), Gaps = 53/295 (17%)

Query: 122 LIATINGSGTVFLYDRSKDGDEGLLSSLGFH----------------EDNGYGLSFNPVD 165
           L AT++ +G V++YD +        S+ G+                    GYGL ++P+ 
Sbjct: 227 LTATMSENGDVYIYDLA--AQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLI 284

Query: 166 K-GKLLSGSDDSKIALWDITTNSTKPVSTWESCHQ-------DGVNDCKWHELNGNTFGS 217
           K G LLSG    +I L      + +  S W +  Q       + + D +W       F +
Sbjct: 285 KTGALLSGDCSGQIYL------TQRHTSRWVTDKQSFTVSNNESIEDIQWSRTESTVFAT 338

Query: 218 VSEDCTLQLHDQRVKD---SVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRR 274
            + D  +++ D R K    +++ K    T  N I++S     L A+   +    ++D R+
Sbjct: 339 AACDGYIRIWDTRSKKHKPAISVKASN-TDVNVISWSDKIGYLLASGDDNGTWGVWDLRQ 397

Query: 275 -------TGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL-MEIGAEQVPD 326
                  T   +     H+  +T++ F    + IV    ED  V +WDL +E   E++  
Sbjct: 398 FTPSNADTVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQ 457

Query: 327 DA------DDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSS 375
            A       D  P+++ +H   +  V D   +  IP  + S   + +  VWK  S
Sbjct: 458 QAAETKELQDIPPQLLFVH--WQREVKDVKWHKQIPGCLVSTGTDGL-NVWKTIS 509

>SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly
           similar to uniprot|P25636 Saccharomyces cerevisiae
           YCR057C PWP2 part of small (ribosomal) subunit (SSU)
           processosome (contains U3 snoRNA) Eight WD-repeats with
           homology with G protein beta subunits flanked by
           nonhomologous N-terminal and C-terminal extensions
           regulatory protein
          Length = 909

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 104/223 (46%), Gaps = 18/223 (8%)

Query: 116 MPQDSNLIATINGSGTVFLYDRSKDG---------DEGLLSSLGFHEDNGYGLSFNPVDK 166
           M Q++    +IN SG    +  SK G         +  +L   G H D+   L+++P D 
Sbjct: 297 MGQNAVNTVSINNSGEWLAFGSSKLGQLLVYEWQSESYILKQQG-HFDSMNSLTYSP-DG 354

Query: 167 GKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQL 226
            ++++ SDD KI +WD+ +     ++T++  H   V   ++ +  G    S S D T++ 
Sbjct: 355 SRVVTSSDDGKIKIWDVVSGFC--LATFDD-HTSSVTAVQFAK-KGQVLFSASLDGTVKA 410

Query: 227 HDQ-RVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGH 285
            D  R ++  T        FN +A    S  +  A   DS      S +TGN+L T++GH
Sbjct: 411 WDLIRYRNFRTFTAAERIQFNCLAVDP-SGEVVCAGSVDSFEIHVWSVQTGNLLDTLAGH 469

Query: 286 ESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDA 328
           E  V+ L F + ++ ++ S+  D+ + +W +     +  P D 
Sbjct: 470 EGPVSCLSF-SNENSVLASASWDKTIRIWSIFGRSQQVEPFDV 511

>NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 88/182 (48%), Gaps = 24/182 (13%)

Query: 147 SSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVST----WESCHQDGV 202
           S++  H       +F P    ++++G+ D+   +WD  T + K   T    W  C    V
Sbjct: 137 SAIAGHGSTILCSAFAPNTSSRMVTGAGDNTARIWDCDTQTPKATLTGHFNWVLC----V 192

Query: 203 NDCKWHELNGNTFGSVSEDCTLQLHDQR----VKDSVTDKIKTVT--AFNTIAFSKHS-T 255
           + C     NG    + S D T++L D +    + D++   +K +T  A+  I   K   +
Sbjct: 193 SYCP----NGEVIATGSMDNTIRLWDSKDGKPLGDALRGHLKWITSLAWEPIHLVKPGES 248

Query: 256 NLFAAAGTDSLIYLYD-SRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMW 314
              A+A  D  I ++D +RR    L+TMSGH ++V+ +++  +  GI+ S   D+ V +W
Sbjct: 249 PRLASASKDGTIRIWDITRRV--CLYTMSGHTNSVSCIKW--SGQGIIYSGSHDKTVRVW 304

Query: 315 DL 316
           D+
Sbjct: 305 DM 306

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 53/267 (19%), Positives = 112/267 (41%), Gaps = 42/267 (15%)

Query: 117 PQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDS 176
           P +S  +A+ +  GT+ ++D ++      L ++  H ++   + ++   +G + SGS D 
Sbjct: 245 PGESPRLASASKDGTIRIWDITR---RVCLYTMSGHTNSVSCIKWS--GQGIIYSGSHDK 299

Query: 177 KIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQL----HDQRVK 232
            + +WD+  +  K ++  +S H   VN             S+S D  L++    H     
Sbjct: 300 TVRVWDMNADG-KCINILKS-HAHWVNHL-----------SLSTDYALRVGAFDHTGAQP 346

Query: 233 DSVTDKIKTVTAFNTIAFSKHST--NLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVT 290
            S  D      A       K+     L   A  D  ++L++  ++   +  M+GH+  V 
Sbjct: 347 ASAKDARDKALANYEKVVKKNGKLEELMVTASDDFTMFLWNPLKSNKPIARMTGHQKLVN 406

Query: 291 NLEFYAAKDG-IVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDF 349
           ++ F  + DG  ++S+  D  + +W            D  DG  + +    GH + V   
Sbjct: 407 HVAF--SPDGRYIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASVYQV 450

Query: 350 SMNPNIPWLMASAEEENIVQVWKCSSK 376
           + + +   L+ S  ++  ++VW   ++
Sbjct: 451 AWSADCR-LLVSCSKDTTLKVWDVRTR 476

>NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672
          Length = 434

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 96/210 (45%), Gaps = 24/210 (11%)

Query: 159 LSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSV 218
           ++ +P+D    ++GS+D+ I +WD+     K      + H   V D    E +   F S 
Sbjct: 128 VAVDPIDNEWFVTGSNDATIKIWDLAKGHLKLT---LAGHAMTVRDIAISERHPYMF-SA 183

Query: 219 SEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHST-NLFAAAGTDSLIYLYDSRRTGN 277
           SED  ++  D     ++ D    ++  +++    H T +L A AG DS++ L+D R   +
Sbjct: 184 SEDKLVKCWDLEKNTAIRDYHGHLSGVHSVDI--HPTLDLIATAGRDSVVRLWDIRARVS 241

Query: 278 VLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVM 337
           V+ T+ GH+S +  +      D  ++S   D  + +WD++             G    V+
Sbjct: 242 VM-TLIGHKSPINKVHCLPV-DPQIVSCSTDATIRLWDIIA------------GKSRKVL 287

Query: 338 IHAGHRSPVNDFSMNPNIPWLMASAEEENI 367
            H  H+  V D S +P   + M SA  ++I
Sbjct: 288 TH--HKKSVRDMSFHPR-EFSMVSASTDDI 314

>TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.316
           YDR142C
          Length = 378

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 70/307 (22%), Positives = 119/307 (38%), Gaps = 56/307 (18%)

Query: 114 RYMPQDSNLIATINGS-------GTVFLYD---RSKDGDEGLLSSLGFHEDNGYGLSFNP 163
           +Y P   N +A  +GS       G +F+ D   R K  +  +  +    +D  + LS+N 
Sbjct: 16  QYSPFFDNRLAVASGSNYGLVGNGKLFILDIDERGKIKENNIFIT----QDCLFDLSWNE 71

Query: 164 VDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCT 223
           + + ++L    D  + L+D TT    P+  ++  H+  V  C W+ +   TF S S D  
Sbjct: 72  LHENQVLVAQGDGSLRLFD-TTLQKYPIGIFKE-HKKEVLSCNWNLITKGTFVSSSWDGA 129

Query: 224 LQL------------------------HDQRVK-------DSVTDKIKTVTAFNTIAFSK 252
           +++                        H+Q  K       +  T  ++         FS 
Sbjct: 130 VKMWSPLREQSLLTLLPKSSEQSSKINHNQIAKIPPHVNNNQSTPILQNKDCVYQAQFSP 189

Query: 253 HSTNLFAAAGTDSLIYLYDSRRTGNVLH-----TMSGHESNVTNLEFYAAKDGIVMSSGE 307
           H  NL A    +S I L+D+R   N  +       SG E+    L+F   +  ++ SSG 
Sbjct: 190 HDNNLIACCSGNSYITLFDTREQNNRFNNNSFIAHSGLET--LTLDFNKYRPTVLASSGA 247

Query: 308 DRRVIMWDLMEIGAEQVPDDADDGSPEVVM--IHAGHRSPVNDFSMNPNIPWLMASAEEE 365
           D  + +WD+  I      +     S  + M  I   H   V     +P+   L+ S   +
Sbjct: 248 DNSIKIWDMRMIRNNNSNNTVMPTSNPICMNEIRKAHDLAVRRVVWSPHQSNLLLSTSYD 307

Query: 366 NIVQVWK 372
              +VWK
Sbjct: 308 MTSKVWK 314

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 72/197 (36%), Gaps = 39/197 (19%)

Query: 110 VTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHED-NGYGLSFNPVDKGK 168
           V +A++ P D+NLIA  +G+  + L+D  +  +    +S   H       L FN      
Sbjct: 182 VYQAQFSPHDNNLIACCSGNSYITLFDTREQNNRFNNNSFIAHSGLETLTLDFNKYRPTV 241

Query: 169 LLSGSDDSKIALWDI-------TTNSTKPVST------WESCHQDGVNDCKWHELNGNTF 215
           L S   D+ I +WD+       + N+  P S           H   V    W     N  
Sbjct: 242 LASSGADNSIKIWDMRMIRNNNSNNTVMPTSNPICMNEIRKAHDLAVRRVVWSPHQSNLL 301

Query: 216 GSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTI--------AFSKHSTNLFAA------- 260
            S S D T ++     KD   D  K     N+I         F  H+  +F A       
Sbjct: 302 LSTSYDMTSKVW----KDFSFDGSKITGKTNSIDPGSGLIKTFHHHTEFVFGADWSLWGQ 357

Query: 261 ------AGTDSLIYLYD 271
                  G DS +Y+++
Sbjct: 358 PGFIATTGWDSKVYIWN 374

>SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {ON}
           highly similar to uniprot|Q75BY3 Ashbya gossypii ACR137W
           PRP46 Pre-mRNA-splicing factor PRP46 and similar to
           YPL151C uniprot|Q12417 Saccharomyces cerevisiae YPL151C
           PRP46 Splicing factor that is found in the Cef1p
           subcomplex of the spliceosome
          Length = 441

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 91/202 (45%), Gaps = 25/202 (12%)

Query: 155 NGY--GLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNG 212
           NG+   ++ +P+D     +GS+D+ I +WD+ T   K      S H   V D    + + 
Sbjct: 129 NGWVRTVAVDPIDNEWFATGSNDTTIKIWDLATGKLKLTL---SGHIMTVKDICISKRHP 185

Query: 213 NTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHST-NLFAAAGTDSLIYLYD 271
             F S SED  ++  D      + D    ++  +T+    H T NL A AG DS++ L+D
Sbjct: 186 YMF-SASEDKLVKCWDLEKNRVIRDYHGHLSGVHTVDI--HPTLNLIATAGRDSVVRLWD 242

Query: 272 SRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDG 331
            R    V+ TM+GH+S +  ++     D  V+S   D  V +WD+              G
Sbjct: 243 IRTKLPVM-TMAGHKSPINRVKCLPV-DPQVVSCSADATVRLWDITA------------G 288

Query: 332 SPEVVMIHAGHRSPVNDFSMNP 353
               V+ H  H+  V D  ++P
Sbjct: 289 KTLKVLTH--HKRSVRDIGIHP 308

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 63/132 (47%), Gaps = 17/132 (12%)

Query: 247 TIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSG 306
           T+A        FA    D+ I ++D   TG +  T+SGH   V ++   + +   + S+ 
Sbjct: 134 TVAVDPIDNEWFATGSNDTTIKIWD-LATGKLKLTLSGHIMTVKDI-CISKRHPYMFSAS 191

Query: 307 EDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEEN 366
           ED+ V  WDL +                V+  + GH S V+   ++P +  L+A+A  ++
Sbjct: 192 EDKLVKCWDLEK--------------NRVIRDYHGHLSGVHTVDIHPTLN-LIATAGRDS 236

Query: 367 IVQVWKCSSKLP 378
           +V++W   +KLP
Sbjct: 237 VVRLWDIRTKLP 248

>Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C
           (REAL)
          Length = 451

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 83/166 (50%), Gaps = 9/166 (5%)

Query: 160 SFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVS 219
           + +PV+    ++GS+D+ + +WD+ T   +   T  + H   V D    + +   F SVS
Sbjct: 146 AIDPVNNEWFITGSNDTTMKVWDLATGKLR---TTLAGHVMTVRDIAISDRHPYLF-SVS 201

Query: 220 EDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHST-NLFAAAGTDSLIYLYDSRRTGNV 278
           ED T++  D      + D    ++   T++   H T +L A AG DS+I L+D R    V
Sbjct: 202 EDKTVKCWDLEKNQIIRDYYGHLSGVRTVSI--HPTLDLIATAGRDSVIKLWDIRTRVPV 259

Query: 279 LHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQV 324
           + T+ GH+  +  ++     D  ++SS  D  V +WD++   A +V
Sbjct: 260 I-TLVGHKGPINQVQCTPV-DPQIVSSSTDATVRLWDVVAGKAMKV 303

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 72/167 (43%), Gaps = 28/167 (16%)

Query: 210 LNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKT-----VTAFNTIAFSKHSTNLFAAAGTD 264
           +N   F + S D T+     +V D  T K++T     V     IA S     LF+ +  D
Sbjct: 150 VNNEWFITGSNDTTM-----KVWDLATGKLRTTLAGHVMTVRDIAISDRHPYLFSVS-ED 203

Query: 265 SLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQV 324
             +  +D  +   ++    GH S V  +  +   D ++ ++G D  + +WD+      +V
Sbjct: 204 KTVKCWDLEK-NQIIRDYYGHLSGVRTVSIHPTLD-LIATAGRDSVIKLWDIRT----RV 257

Query: 325 PDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVW 371
           P          V+   GH+ P+N     P  P +++S+ +   V++W
Sbjct: 258 P----------VITLVGHKGPINQVQCTPVDPQIVSSSTDAT-VRLW 293

>Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {ON}
           similar to Ashbya gossypii AER255C
          Length = 471

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 86/194 (44%), Gaps = 9/194 (4%)

Query: 152 HEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELN 211
           HE+    L F P      LSG +D+K+ +WD+  +  + +      HQ  + D  +   +
Sbjct: 177 HENGTTALKFLPKSGHLFLSGGNDNKLKIWDLYHD--RRLLRDFCGHQKPIRDFNF-TTD 233

Query: 212 GNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYD 271
              F SVS D  L++ D   K ++  + K  +  N + F   +         +S I  YD
Sbjct: 234 SKQFTSVSYDKFLKIWDTE-KGAIIHRTKLTSVPNCVTFHPINNYELVVGLLNSEIKHYD 292

Query: 272 SR--RTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWD-LMEIGAEQVPDDA 328
           +R      ++ T   H S++  L+F+      + SS ED+ + +WD  + I  +Q+ D A
Sbjct: 293 TRDNYKNGLIQTYDHHTSSIIALKFFPNGSKFI-SSSEDKTIRIWDNQINIPIKQISDTA 351

Query: 329 DDGSPEVVMIHAGH 342
               P  + IH  H
Sbjct: 352 QHSMP-WIEIHPEH 364

 Score = 37.0 bits (84), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 19/94 (20%), Positives = 39/94 (41%), Gaps = 14/94 (14%)

Query: 278 VLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVM 337
           +++   GHE+  T L+F      + +S G D ++ +WDL                  ++ 
Sbjct: 170 IINVYDGHENGTTALKFLPKSGHLFLSGGNDNKLKIWDLYH-------------DRRLLR 216

Query: 338 IHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVW 371
              GH+ P+ DF+   +      S   +  +++W
Sbjct: 217 DFCGHQKPIRDFNFTTDSK-QFTSVSYDKFLKIW 249

>Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W
           (REAL)
          Length = 1271

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 98/212 (46%), Gaps = 22/212 (10%)

Query: 125 TINGS---GTVFLYDRSKDGDEGLLSSLGF--HEDNGYGLSFNPVDKGKLLSGSDDSKIA 179
           TI G+   GT+ LY    D  + ++S+  F  H  +   + FN      L SG ++ +I 
Sbjct: 76  TIAGALDNGTLELYSIG-DAHDTIVSTAKFSNHSSSVKTVKFNSKQDNVLASGGNNGEIF 134

Query: 180 LWDI-----TTNSTKPVSTWESCHQ-DGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKD 233
           +WD+     + +S  P++  +S    D VN   W++   + F S        + D + K 
Sbjct: 135 IWDMNKCTESPSSYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKAKK 194

Query: 234 SVTDKIKTVT------AFNTIAF-SKHSTNLFAAAGTDS--LIYLYDSRRTGNVLHTMS- 283
            V     T          + + +  K+ST +  A G+D+   I ++D R     L T+S 
Sbjct: 195 EVIHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQTLSQ 254

Query: 284 GHESNVTNLEFYAAKDGIVMSSGEDRRVIMWD 315
           GH+  + +L++    + +++SSG D  V++W+
Sbjct: 255 GHQKGILSLDWCHQDENLLLSSGRDNTVLLWN 286

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 73/172 (42%), Gaps = 11/172 (6%)

Query: 210 LNGNTFGSVSEDCTLQLHDQRVKDS--VTDKIKTVTAFNTIAFSKHSTNLFAAA---GTD 264
           ++G    + S D +L+L      DS      ++  + FN + +S H+    A A   GT 
Sbjct: 28  VSGTVDANFSTDSSLELWSLLTTDSEKPMASLQVDSKFNDLDWS-HNNKTIAGALDNGTL 86

Query: 265 SLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQV 324
            L  + D+  T       S H S+V  ++F + +D ++ S G +  + +WD+ +    + 
Sbjct: 87  ELYSIGDAHDTIVSTAKFSNHSSSVKTVKFNSKQDNVLASGGNNGEIFIWDMNK--CTES 144

Query: 325 PDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSK 376
           P      +P   M        VN  + N ++  + ASA   N   +W   +K
Sbjct: 145 PSSYTPLTPGQSMSSVDE---VNSLAWNQSLAHVFASAGSSNFASIWDLKAK 193

>NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {ON}
           Anc_7.310
          Length = 1276

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 97/217 (44%), Gaps = 20/217 (9%)

Query: 119 DSNLIA-TINGSGTVFLYDRSKDGDEGLLSSLGF---HEDNGYGLSFNPVDKGKLLSGSD 174
           D+  IA  ++ +G + L+ + ++  +  L SLG    H      L FNP  +  L S  +
Sbjct: 75  DNKFIAGALDDNGKIELFSKEENDTKISLKSLGKFKKHTTAVNTLRFNPKQQNVLASAGN 134

Query: 175 DSKIALWDI-----TTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTL-QLHD 228
           + +I +WDI     +T+ +          QD +    W++   + F S  +  T   + D
Sbjct: 135 NGEILIWDINKTLSSTDYSPSAPGIAMSTQDEIKSVSWNKSLAHVFASAGDTTTYASIWD 194

Query: 229 QRVKDSVT----DKIKTVTAFNTIAFSKH---STNLFAAAGTDS--LIYLYDSRRTGNVL 279
            + K  V        KT    N      H   +T +  A+G+DS  +I ++D R +   +
Sbjct: 195 LKAKKEVIHLNYTSPKTGLKPNLAVVEWHPKVTTYVATASGSDSDPVILIWDLRNSNMPM 254

Query: 280 HTMSG-HESNVTNLEFYAAKDGIVMSSGEDRRVIMWD 315
            T+ G H   + +L++    + +++SSG D  V +WD
Sbjct: 255 TTLEGPHTKGIMSLDWCTKDESLLLSSGRDGIVALWD 291

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 67/150 (44%), Gaps = 20/150 (13%)

Query: 173 SDDSKIALWDITTNSTKPVSTWESCHQDG-VNDCKWHELNGNTFGSVSEDCTLQLHDQRV 231
           S+DS + LW + ++  K  +   S   D    D  W   N    G++ ++  ++L  +  
Sbjct: 37  SNDSTLELWSLLSDPKKDPTPVASITTDARFKDLDWSFDNKFIAGALDDNGKIELFSKEE 96

Query: 232 KD------SVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGH 285
            D      S+    K  TA NT+ F+    N+ A+AG +  I ++D  +T          
Sbjct: 97  NDTKISLKSLGKFKKHTTAVNTLRFNPKQQNVLASAGNNGEILIWDINKT---------- 146

Query: 286 ESNVTNLEFYAAKDGIVMSSGEDRRVIMWD 315
              +++ ++  +  GI MS+ ++ + + W+
Sbjct: 147 ---LSSTDYSPSAPGIAMSTQDEIKSVSWN 173

>Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W
           (REAL)
          Length = 1273

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 97/211 (45%), Gaps = 17/211 (8%)

Query: 122 LIATINGSGTVFLYDRSKDGDE-GLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIAL 180
           +IA    +GT+ LY  ++  D     +  G H  +   + FN      L SG ++ +I +
Sbjct: 76  IIAGALDNGTLELYSTNEANDTISSTAKFGSHSSSVKTVKFNARQDNVLASGGNNGEIFI 135

Query: 181 WDI-----TTNSTKPVSTWESCHQ-DGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDS 234
           WD+     + ++  P++  +S    D VN   W++   + F S        + D + K  
Sbjct: 136 WDMNKCTESPSTYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKAKKE 195

Query: 235 VTDKIKTVTA------FNTIAF-SKHSTNLFAAAGTDS--LIYLYDSRRTGNVLHTMS-G 284
           V     T  +       + + +  K+ST +  A G+D+   I ++D R     + T++ G
Sbjct: 196 VIHLSYTSPSSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPMQTLNQG 255

Query: 285 HESNVTNLEFYAAKDGIVMSSGEDRRVIMWD 315
           H+  + +L++    + +++SSG D  V++W+
Sbjct: 256 HQKGILSLDWCDQDENLLLSSGRDNTVLLWN 286

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/172 (21%), Positives = 75/172 (43%), Gaps = 11/172 (6%)

Query: 210 LNGNTFGSVSEDCTLQLHDQRVKDS--VTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLI 267
           ++G    + S D +L+L      DS      ++  + FN + +S H+  + A A  +  +
Sbjct: 28  VSGTVDANFSTDSSLELWSLLATDSEKPLASLQVDSKFNDLDWS-HNNEIIAGALDNGTL 86

Query: 268 YLYDSRRTGNVLHTMS---GHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQV 324
            LY +    + + + +    H S+V  ++F A +D ++ S G +  + +WD+ +    + 
Sbjct: 87  ELYSTNEANDTISSTAKFGSHSSSVKTVKFNARQDNVLASGGNNGEIFIWDMNK--CTES 144

Query: 325 PDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSK 376
           P      +P   M        VN  + N ++  + ASA   N   +W   +K
Sbjct: 145 PSTYTPLTPGQSMSSVDE---VNSLAWNQSLAHVFASAGSSNFASIWDLKAK 193

>SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1140

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 68/144 (47%), Gaps = 2/144 (1%)

Query: 173 SDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVK 232
           + + K  +W+++ NST  +      H   + D  +H  +     + S D  +   D R  
Sbjct: 88  TSNQKAMVWNLSRNSTNAIEHILHGHFRAITDINFHPHHPEILATCSVDTYVLAWDMRSP 147

Query: 233 DSVTDKIKTVTA-FNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTN 291
                      A  + + ++  ++N+ A++ +D +  ++D R+    L+T+ GHE +V N
Sbjct: 148 QRPYYSTSEWRAGASQVKWNFRNSNIMASSHSDHVC-IWDLRKGCTPLYTLQGHEGSVNN 206

Query: 292 LEFYAAKDGIVMSSGEDRRVIMWD 315
           ++F  AK+  +MSS  D  V  WD
Sbjct: 207 IDFNKAKETEIMSSSNDGTVKFWD 230

 Score = 34.3 bits (77), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 45/84 (53%), Gaps = 3/84 (3%)

Query: 110 VTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKL 169
            ++ ++  ++SN++A+ + S  V ++D  K      L +L  HE +   + FN   + ++
Sbjct: 161 ASQVKWNFRNSNIMAS-SHSDHVCIWDLRKGCTP--LYTLQGHEGSVNNIDFNKAKETEI 217

Query: 170 LSGSDDSKIALWDITTNSTKPVST 193
           +S S+D  +  WD + + TKP  T
Sbjct: 218 MSSSNDGTVKFWDYSVSDTKPRHT 241

>NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325
          Length = 917

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 106/238 (44%), Gaps = 24/238 (10%)

Query: 92  GFTKSNIKI--IKKFKHEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDG-------- 141
           GFT    ++  +  F   Q+++    M Q+     T+N +G    +  SK G        
Sbjct: 274 GFTNGEFRLYEMPSFTLLQQLS----MGQNPVNTVTVNSTGEWLAFGSSKLGQLLVYEWQ 329

Query: 142 -DEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQD 200
            +  +L   G H D+   L+++P D  ++++ +DD KI +WD+ +       T    H  
Sbjct: 330 SESYILKQQG-HFDSTNSLTYSP-DGSRVVTAADDGKIKVWDVVSGFCLATFTE---HTS 384

Query: 201 GVNDCKWHELNGNTFGSVSEDCTLQLHDQ-RVKDSVTDKIKTVTAFNTIAFSKHSTNLFA 259
            V   ++ +  G    S S D T++  D  R ++  T        FN +A    S  +  
Sbjct: 385 SVTQVQFAK-KGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCLAVDP-SGEVVC 442

Query: 260 AAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLM 317
           A   DS      S +TG +L T+SGHE  V+ L F + ++ ++ S+  D+ V +W + 
Sbjct: 443 AGSIDSFDIHVWSVQTGQLLDTLSGHEGPVSCLSF-SQENSVLASASWDKTVRIWSIF 499

>TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7.310
           YDL195W
          Length = 1264

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 91/215 (42%), Gaps = 21/215 (9%)

Query: 119 DSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYG--LSFNPVDKGKLLSGSDDS 176
           D  +IA    SG V L+  + D    L S   F +  G    + FN      L SG    
Sbjct: 73  DDKIIAGALDSGVVELFSSTGDS---LKSEARFQQHQGAAKTVKFNSKQNNVLASGGSKG 129

Query: 177 KIALWDITT---NS---TKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQR 230
           +I +WD+ T   NS   T       S   + V    W++   + F S        + D +
Sbjct: 130 EIYIWDLNTCLKNSEGYTPLTPGVASTPIEEVTSLAWNQSLAHVFASAGSTSYASIWDLK 189

Query: 231 VKDSV------TDKIKTVTAFNTIAF-SKHSTNLFAAAGTDS--LIYLYDSRRTGNVLHT 281
            K  V      +      +  + + +  K+ST +  A G+D+  LI ++D R     L  
Sbjct: 190 AKKEVIHLSYASPSTGLKSQLSVVEWHPKNSTRVATATGSDTEPLILVWDLRNANTPLQV 249

Query: 282 MS-GHESNVTNLEFYAAKDGIVMSSGEDRRVIMWD 315
           +S GH   + +L++ +  + +++SSG D  +++W+
Sbjct: 250 LSKGHSKGILSLDWCSQDEELLLSSGRDNTIVLWN 284

>Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AER263C
          Length = 542

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 85/178 (47%), Gaps = 16/178 (8%)

Query: 147 SSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCK 206
           S++  H       +F P    ++++GS D+   +WD  T +  P+ T +  H + V    
Sbjct: 164 SAIAGHSSTILCSTFAPHTSSRMVTGSGDNNARIWDCDTQT--PIYTLKG-HTNWVLCVA 220

Query: 207 WHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNL--------F 258
           W   +G    + S D T++L D +  DS  D ++  + + T + S    +L         
Sbjct: 221 W-SADGEVIATGSMDNTIRLWDAQTGDSKGDALRGHSKWIT-SMSWEPIHLVTPGNKPRI 278

Query: 259 AAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL 316
           A+A  D  I ++D+ R   +L T+SGH S+V+ +++     G++ +   DR +  WD+
Sbjct: 279 ASASKDGTIKVWDTVRRQCIL-TLSGHTSSVSCIKW--GGQGVIYTGSHDRTIRCWDM 333

 Score = 30.4 bits (67), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 59/135 (43%), Gaps = 19/135 (14%)

Query: 257 LFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDG-IVMSSGEDRRVIMWD 315
           L A A  D  +YL++  +    L  M+GH+  V ++ F  + DG  ++S+  D  + +W 
Sbjct: 400 LIATASDDFTMYLWNPLKGTKPLTRMTGHQKLVNHVAF--SPDGRYIVSASFDNSIKLW- 456

Query: 316 LMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSS 375
                        +  S + +    GH + V   + + +   L+ S  ++  ++VW   +
Sbjct: 457 -------------EGSSGKFISTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVWDVRT 502

Query: 376 KLPRVGGLPKVDDSV 390
           +   V  LP  +D V
Sbjct: 503 RKLAV-DLPGHNDEV 516

>YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and nucleus; similar to the petunia WD repeat protein
           an11; overexpression causes a cell cycle delay or arrest
          Length = 523

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 80/185 (43%), Gaps = 26/185 (14%)

Query: 161 FNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSE 220
           +N VD   ++S S D+   +WD+   S+  V T    H   V D ++   +   F S   
Sbjct: 251 WNTVDTNLIISSSIDTTCIVWDL--QSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGG 308

Query: 221 DCTLQLHDQR-------------------VKDSVTDKIKTVTAFNTIAFSKHSTNLFAAA 261
           D ++++ D R                      ++T   K   A   +  S +  N+ A  
Sbjct: 309 DGSVRVFDLRSLAHSTIIYEPPSSSVSGATAGTITPSSKGSDALLRLEPSPYDPNVLATF 368

Query: 262 GTDS-LIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL---- 316
             DS  I + D R   + +  + GH S+V  ++++  K  +++S G+D +V+ WDL    
Sbjct: 369 AADSNKIIILDMRNPESPILNLQGHGSSVNGIKWHPTKRNVLLSCGDDCQVLYWDLNSSF 428

Query: 317 MEIGA 321
           MEI A
Sbjct: 429 MEINA 433

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 38/86 (44%), Gaps = 1/86 (1%)

Query: 100 IIKKFKHEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGL 159
           I    K    + R    P D N++AT        +    ++ +  +L+  G H  +  G+
Sbjct: 342 ITPSSKGSDALLRLEPSPYDPNVLATFAADSNKIIILDMRNPESPILNLQG-HGSSVNGI 400

Query: 160 SFNPVDKGKLLSGSDDSKIALWDITT 185
            ++P  +  LLS  DD ++  WD+ +
Sbjct: 401 KWHPTKRNVLLSCGDDCQVLYWDLNS 426

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 41/94 (43%), Gaps = 3/94 (3%)

Query: 234 SVTDKIKTVTAFNTIA---FSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVT 290
           +  D +K +  F  I    ++   TNL  ++  D+   ++D + +  V   +  H+S V 
Sbjct: 232 AAADDMKVIGTFPPITSFDWNTVDTNLIISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVF 291

Query: 291 NLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQV 324
           ++ F      +  S G D  V ++DL  +    +
Sbjct: 292 DVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTI 325

>NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 81/178 (45%), Gaps = 16/178 (8%)

Query: 147 SSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCK 206
           S++  H       +F P    ++++G+ D+   +WD  T + K   T    H + V    
Sbjct: 137 SAIAGHGSTILCSAFAPNSSSRMVTGAGDNTARIWDCDTQTPKATLT---GHTNWVLCVS 193

Query: 207 WHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIK------TVTAFNTIAFSKHSTN-LFA 259
           W   NG    + S D T++L + +    V D ++      T  A+  I   K       A
Sbjct: 194 WCP-NGEVIATGSMDNTIRLWEGKSGKPVGDALRGHLKWITSLAWEPIHLVKAGEQPRLA 252

Query: 260 AAGTDSLIYLYD-SRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL 316
           +A  D  I ++D SRR    L+T+SGH ++V+ +++     GI+ S   D+ V  WD+
Sbjct: 253 SASKDGTIKIWDTSRRV--CLYTLSGHTNSVSCIKW--GGQGILYSGSHDKTVRAWDM 306

>Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}
           YCR057C (REAL)
          Length = 920

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 114/238 (47%), Gaps = 24/238 (10%)

Query: 92  GFTKSNIKI--IKKFKHEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDG-------- 141
           GFT    ++  + +F   Q+++    M Q+     T+N +G    +  SK G        
Sbjct: 278 GFTSGEFRLYDLPEFTLIQQLS----MGQNPVNTVTVNNTGEWLAFGSSKLGQLLVYEWQ 333

Query: 142 -DEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQD 200
            +  +L   G H D+   L+++P D  ++++ SDD KI +WD+T+     ++T+E  H  
Sbjct: 334 SESYILKQQG-HFDSTNSLAYSP-DGSRVVTASDDGKIKVWDVTSGFC--LATFEE-HTS 388

Query: 201 GVNDCKWHELNGNTFGSVSEDCTLQLHDQ-RVKDSVTDKIKTVTAFNTIAFSKHSTNLFA 259
            V   ++ +  G    S S D T++  D  R ++  T        FN +A       + A
Sbjct: 389 SVTAVQFAK-RGQVMFSSSMDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCA 447

Query: 260 AAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLM 317
            +  +  I+++ S +TG +L  +SGHE  V+ L F + ++ ++ S+  D+ + +W + 
Sbjct: 448 GSLDNFDIHVW-SVQTGQLLDALSGHEGPVSCLSF-SQENSVLASASWDKTIRIWSIF 503

>KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa]
           {ON} Anc_8.316 YDR142C
          Length = 372

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 63/276 (22%), Positives = 106/276 (38%), Gaps = 34/276 (12%)

Query: 128 GSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNS 187
           G+G V+L +    G     +S    +D  + +++N + + ++L    D  + L+D TT  
Sbjct: 36  GNGKVYLLEIDSKGQIHETNSF-LTQDCLFDVAWNELHENQVLVAQGDGSLRLFD-TTLK 93

Query: 188 TKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDS----VTDKIKTVT 243
             P+  +   H+  V  C W+ +  NTF S S D T+++     K S    V   +K + 
Sbjct: 94  DYPIEIFNE-HEREVFSCSWNLITKNTFTSSSWDGTVKIWSPLRKASLLTLVPHPLKVMK 152

Query: 244 AFNTI-----------------------AFSKHSTNLFAAAGTDSLIYLYDSRR--TGNV 278
            F+ +                        FS H  NL      +S   L+D R+  T N 
Sbjct: 153 NFDQVDIPISNQKAHTAISKNKNCIYQAQFSPHDPNLVICCAGNSYTTLFDLRQPSTSNN 212

Query: 279 LHTMSGHES-NVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAE-QVPDDADDGSPEVV 336
                 H        +F   +  IV + G D  + +WDL  +  + Q     D+    V 
Sbjct: 213 QQNFFSHSGLEALTCDFNKYRPNIVATGGVDNTIRIWDLRMLSKQFQAGTQRDNSIMCVN 272

Query: 337 MIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWK 372
            I  GH   V   S +P+    + S   +    VW+
Sbjct: 273 EIKKGHELAVRKVSWSPHSSTTLLSTSYDMTCCVWQ 308

 Score = 30.4 bits (67), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 50/135 (37%), Gaps = 19/135 (14%)

Query: 105 KHEQEVTRARYMPQDSNLIATINGSGTVFLYD----RSKDGDEGLLSSLGFHEDNGYGLS 160
           K++  + +A++ P D NL+    G+    L+D     + +  +   S  G          
Sbjct: 172 KNKNCIYQAQFSPHDPNLVICCAGNSYTTLFDLRQPSTSNNQQNFFSHSGLE---ALTCD 228

Query: 161 FNPVDKGKLLSGSDDSKIALWDITT------------NSTKPVSTWESCHQDGVNDCKWH 208
           FN      + +G  D+ I +WD+              NS   V+  +  H+  V    W 
Sbjct: 229 FNKYRPNIVATGGVDNTIRIWDLRMLSKQFQAGTQRDNSIMCVNEIKKGHELAVRKVSWS 288

Query: 209 ELNGNTFGSVSEDCT 223
             +  T  S S D T
Sbjct: 289 PHSSTTLLSTSYDMT 303

>TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {ON}
           Anc_8.316 YDR142C
          Length = 367

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 67/300 (22%), Positives = 119/300 (39%), Gaps = 50/300 (16%)

Query: 113 ARYMPQDSNLIATINGS-------GTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVD 165
            +Y P   N +A ++GS       G +F+ D    G     +S    +D  + +++N + 
Sbjct: 14  VQYSPFFDNRLAVVSGSNFGLVGNGKLFILDIDPQGKIHESNSF-LTQDCLFDVAWNELH 72

Query: 166 KGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQ 225
           + ++L    D  + L+D T  +  P++ ++  HQ  V  C W+ LN NTF S S D T++
Sbjct: 73  ENQVLVAQGDGSLRLFD-TKLAQYPIAIFKE-HQKEVFSCNWNLLNKNTFVSSSWDGTVK 130

Query: 226 LHDQRVKDSVT----DKIKTVTAF---------------------NTI---AFSKHSTNL 257
           +     KDS+       +KTV                        N I    FS H  NL
Sbjct: 131 IWSPTRKDSLLTLTPQPLKTVNRVDHSMNIPMSNQRNHADITRNKNCIYQAQFSPHDPNL 190

Query: 258 FAAAGTDSLIYLYDSRRTGNVLHTMS--GHES-NVTNLEFYAAKDGIVMSSGEDRRVIMW 314
                 +S I ++D R+  +  +  +  GH        +F   +   + + G D  + +W
Sbjct: 191 VMCCSGNSYITIFDLRQPPSPTNQRNFLGHSGLEALTCDFNKYRPHTIATGGVDNVIRIW 250

Query: 315 DLMEIGAEQVPDDADDGSPEVVM--IHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWK 372
           DL            ++ SP + +  +  GH   V     +P+   +  S   +    VW+
Sbjct: 251 DLRMT-------SKNNSSPSICVNEVVGGHELAVRKVCWSPHHSNIFLSTSYDMTCCVWQ 303

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 54/127 (42%), Gaps = 7/127 (5%)

Query: 105 KHEQEVTRARYMPQDSNLIATINGSGTVFLYD-RSKDGDEGLLSSLGFHEDNGYGLSFNP 163
           +++  + +A++ P D NL+   +G+  + ++D R         + LG          FN 
Sbjct: 173 RNKNCIYQAQFSPHDPNLVMCCSGNSYITIFDLRQPPSPTNQRNFLGHSGLEALTCDFNK 232

Query: 164 VDKGKLLSGSDDSKIALWDI---TTNSTKP---VSTWESCHQDGVNDCKWHELNGNTFGS 217
                + +G  D+ I +WD+   + N++ P   V+     H+  V    W   + N F S
Sbjct: 233 YRPHTIATGGVDNVIRIWDLRMTSKNNSSPSICVNEVVGGHELAVRKVCWSPHHSNIFLS 292

Query: 218 VSEDCTL 224
            S D T 
Sbjct: 293 TSYDMTC 299

>TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {ON}
           Anc_5.201 YLL011W
          Length = 488

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 60/132 (45%), Gaps = 8/132 (6%)

Query: 176 SKIALWDITTNSTKPVS--TWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKD 233
           ++I LWD   N +KP+S  TW +   D V   K+++   +   S   D ++ L+D R  +
Sbjct: 193 AQIQLWD--ANRSKPISNLTWGA---DNVTSVKFNQTETDILASTGSDNSIVLYDLRT-N 246

Query: 234 SVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLE 293
           S T KI+     N I ++      F  A  D   Y YD R     L+    H S V +++
Sbjct: 247 SPTQKIRQSMRTNAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVD 306

Query: 294 FYAAKDGIVMSS 305
           F    D IV  S
Sbjct: 307 FSPTGDEIVTGS 318

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 77/200 (38%), Gaps = 30/200 (15%)

Query: 126 INGSGTVFLYD--RSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDI 183
           + G   + L+D  RSK      +S+L +  DN   + FN  +   L S   D+ I L+D+
Sbjct: 189 VTGGAQIQLWDANRSKP-----ISNLTWGADNVTSVKFNQTETDILASTGSDNSIVLYDL 243

Query: 184 TTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKT-V 242
            TNS  P        +   N   W+ +    F   +ED     +D R      +  K  V
Sbjct: 244 RTNS--PTQKIRQSMR--TNAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALNVFKDHV 299

Query: 243 TAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEF-------- 294
           +A   + FS          G + +   YD  +T  +  T  GH   V + +         
Sbjct: 300 SAVMDVDFS--------PTGDEIVTGSYD--KTIRIYKTNQGHSREVYHTKRMQHVFQVK 349

Query: 295 YAAKDGIVMSSGEDRRVIMW 314
           Y+     ++S  +D  V +W
Sbjct: 350 YSMDSKYIISGSDDGNVRLW 369

 Score = 31.2 bits (69), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 42/196 (21%), Positives = 82/196 (41%), Gaps = 34/196 (17%)

Query: 145 LLSSLGF-HEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTN----------------S 187
            +  +G+ H D  Y ++ N     KL S S D  +  ++++T                  
Sbjct: 58  FIGQMGYGHRDGVYTIAKNYNQLNKLASSSADGVVKYFNMSTREEICSFKAHYGLVTGLC 117

Query: 188 TKPVSTWESCHQDGVNDC------KWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKT 241
            +P ++  + ++  +  C      K   ++ N F +  +D T+   D  +K    D    
Sbjct: 118 VRPETSATNKNEHYMISCGDDKTVKLWSVDSNDFSNNKKDDTIHKGDGLLKTYYGDH--- 174

Query: 242 VTAFNTIAFSKHSTN-LFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDG 300
             AF       H  N  F   G  + I L+D+ R+  + +   G + NVT+++F   +  
Sbjct: 175 --AF--FGLDHHRNNSTFVTGG--AQIQLWDANRSKPISNLTWGAD-NVTSVKFNQTETD 227

Query: 301 IVMSSGEDRRVIMWDL 316
           I+ S+G D  ++++DL
Sbjct: 228 ILASTGSDNSIVLYDL 243

>CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highly
           similar to uniprot|P25635 Saccharomyces cerevisiae
           YCR057c PWP2 periodic tryptophan protein
          Length = 911

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 102/216 (47%), Gaps = 26/216 (12%)

Query: 116 MPQDSNLIATINGSGTVFLYDRSKDG---------DEGLLSSLGFHEDNGYGLSFNPVDK 166
           M Q+     ++N SG    +  SK G         +  +L   G H D    L+++P D 
Sbjct: 296 MGQNPVNTVSVNNSGEWLAFGSSKLGQLLVYEWQSESYILKQQG-HFDATNSLTYSP-DG 353

Query: 167 GKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQL 226
            ++++ ++D KI +WD+ +     ++T+E  H   V   ++ +  G    S S D T++ 
Sbjct: 354 SRVVTAAEDGKIKVWDVASGFC--LATFEE-HTSAVTAVQFAK-KGQVLFSASLDGTVRA 409

Query: 227 HDQ-RVKDSVTDKIKTVTAFNTIAFS----KHSTNLFAAAGTDSLIYLYDSRRTGNVLHT 281
            D  R ++      +  TA   + F+    + S  + +A  TDS      S +TG +L T
Sbjct: 410 WDLIRYRN-----FRVFTATERVQFTCLAVEPSGEVVSAGSTDSFDVFVWSVQTGQLLDT 464

Query: 282 MSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLM 317
           +SGHE  V+ L F + ++ ++ S+  D+ + +W + 
Sbjct: 465 LSGHEGPVSCLAF-SMENAVLASASWDKTIRIWSIF 499

>NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.401
           YMR131C
          Length = 512

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/245 (22%), Positives = 104/245 (42%), Gaps = 35/245 (14%)

Query: 156 GYGLSFNP-VDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQ-------DGVNDCKW 207
           GY L ++P +  G LL+G    +I        + +  S W +  Q         + D +W
Sbjct: 277 GYALDWSPSIQTGALLTGDCSGQIYF------TQRHTSKWVTDKQPFTVSNNKSIEDIQW 330

Query: 208 HELNGNTFGSVSEDCTLQLHDQRVKD---SVTDKIKTVTAFNTIAFSKHSTNLFAAAGTD 264
               G  F S   D  +++ D R K    +++ K    T  N I++S     L A+   +
Sbjct: 331 SRTEGTVFASAGCDGYIRIWDTRSKKHKPAISVKASN-TDVNVISWSDKLGYLLASGDDN 389

Query: 265 SLIYLYDSRR----TGNVLHTMSG---HESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL- 316
            +  ++D R+    T N +  ++    H+  +T++ F    + IV  + ED  V +WDL 
Sbjct: 390 GVWGVWDLRQFSPDTANSVQPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLS 449

Query: 317 MEIGAEQVPDDADDGS------PEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQV 370
           +E   E++   A +        P+++ +H   +  V D   +  IP  + S   + +  +
Sbjct: 450 VEADDEEIKQQAAETKELQQIPPQLLFVH--WQKEVKDVKWHKQIPGALVSTGTDGL-NI 506

Query: 371 WKCSS 375
           WK  S
Sbjct: 507 WKTIS 511

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 23/37 (62%)

Query: 151 FHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNS 187
           FH+     +SFNP+D+  +   S+D+ + LWD++  +
Sbjct: 416 FHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEA 452

>AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR057C (PWP2)
          Length = 922

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 90/182 (49%), Gaps = 16/182 (8%)

Query: 152 HEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELN 211
           H D    L+++P D  ++++ ++D KI +WDI +     ++T+E  H   V   ++ + N
Sbjct: 355 HFDALNALAYSP-DGARIVTAAEDGKIKIWDIVSGFC--LATFEE-HTSSVTSVQFAK-N 409

Query: 212 GNTFGSVSEDCTLQLHD-QRVKDSVTDKIKTVTAFNTIAFSKHSTN----LFAAAGTDSL 266
           G    S S D T++  D  R ++      +T TA   I FS  + +    +  A   D+ 
Sbjct: 410 GQIMFSSSLDGTVKAWDLMRFRN-----FRTFTATERIQFSCLAADPTGEVVCAGSLDNY 464

Query: 267 IYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPD 326
                S +TG +L T+SGHE  V+ L F + ++ I+ S+  D+ + +W +     +  P 
Sbjct: 465 DIQVWSVQTGQLLDTLSGHEGPVSCLSF-SRENSILASASWDKTIRVWSIFGRSQQVEPI 523

Query: 327 DA 328
           +A
Sbjct: 524 EA 525

>NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {ON}
           Anc_6.276 YPL247C
          Length = 524

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 73/169 (43%), Gaps = 15/169 (8%)

Query: 161 FNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSE 220
           +NP+D   L+S S D+   +WD+   S+  V T    H   V D ++   +   F S   
Sbjct: 256 WNPIDTNLLISSSIDTTCIIWDL--ESSNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGG 313

Query: 221 DCTLQLHDQRVKDSVT------------DKIKTVTAFNTIAFSKHSTNLFAAAGTDS-LI 267
           D ++++ D R     T                   A   +  S H  N+ A    DS  I
Sbjct: 314 DGSVRVFDLRSLAHSTIIYEPPAQMDPSSSAAASNALLRLEPSPHDPNIVATFAADSNKI 373

Query: 268 YLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL 316
            + D R     + T+ GH S++  ++++  +  I++S  +D +V+ WDL
Sbjct: 374 IILDMRNPETPVLTLQGHSSSLNQIKWHPTERNILLSCADDCQVLYWDL 422

 Score = 33.5 bits (75), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 17/76 (22%), Positives = 37/76 (48%), Gaps = 1/76 (1%)

Query: 110 VTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKL 169
           + R    P D N++AT        +    ++ +  +L+  G H  +   + ++P ++  L
Sbjct: 350 LLRLEPSPHDPNIVATFAADSNKIIILDMRNPETPVLTLQG-HSSSLNQIKWHPTERNIL 408

Query: 170 LSGSDDSKIALWDITT 185
           LS +DD ++  WD+ +
Sbjct: 409 LSCADDCQVLYWDLNS 424

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/120 (20%), Positives = 53/120 (44%), Gaps = 4/120 (3%)

Query: 205 CKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTD 264
           CK+ + +     +V+ +    L D  V + +  +   +T+F+   ++   TNL  ++  D
Sbjct: 215 CKYKKQHHMNIKAVATNSGNPLSDA-VPNDILGEFPPITSFH---WNPIDTNLLISSSID 270

Query: 265 SLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQV 324
           +   ++D   +  V   +  H+S V ++ F      +  S G D  V ++DL  +    +
Sbjct: 271 TTCIIWDLESSNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRSLAHSTI 330

>TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.276
           YPL247C
          Length = 598

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 81/184 (44%), Gaps = 31/184 (16%)

Query: 161 FNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSE 220
           +N +D   L+S S D+   +WD+   S+  V T    H   V D K+   +   F S   
Sbjct: 308 WNSIDTNLLISSSIDTTCIVWDLQ--SSNYVKTQLIAHDSEVFDVKFLIQSTQLFASCGG 365

Query: 221 DCTLQLHDQRV--------------------KDSVTDKIKTVTAFNTIAF-------SKH 253
           D ++++ D R                      + VT KI   +A N+++        S  
Sbjct: 366 DGSIRVFDLRALQHSTIIYETANDLQGNNTFNNDVTTKIDNSSA-NSLSHALLRLEPSPT 424

Query: 254 STNLFAAAGTDS-LIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVI 312
             NL A  G D   I + D R  G  +  +SGH  +V  ++++ +K  +++S G+D +V+
Sbjct: 425 DPNLIATFGLDKKAILILDMRNPGVPVLVLSGHSPSVNQIKWHPSKPYVLLSCGDDCQVL 484

Query: 313 MWDL 316
            WDL
Sbjct: 485 YWDL 488

>NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {ON}
           Anc_8.288
          Length = 1145

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 89/205 (43%), Gaps = 19/205 (9%)

Query: 173 SDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVK 232
           + + K  +W++   S+  +      H   + D  ++  N +   + S D  +   D R  
Sbjct: 91  TSNQKALIWNLARTSSDAIDHVLHGHSRAITDINFNPENPDILATCSVDTYVHAWDMR-- 148

Query: 233 DSVTDKIKTVTAFNT----IAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESN 288
            S      T +A+ +    + ++   +N+ A+A ++  IY++D R     LH + GH+S+
Sbjct: 149 -SPHRPFYTTSAWRSGASQVKWNYKDSNILASAHSND-IYIWDLRMGSTPLHKLVGHDSS 206

Query: 289 VTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPV-N 347
           V +++F   K   +MSS  D  V  WD+ + G++          P    I  G   P  N
Sbjct: 207 VNSIDFNRFKSSEIMSSSNDGTVKFWDISK-GSDNCTSTVSTDFP----IWRGRYLPFGN 261

Query: 348 DFSMNP-----NIPWLMASAEEENI 367
            F + P     N  +L    E+EN+
Sbjct: 262 GFCIMPQEGGGNAVYLSTLKEQENL 286

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 45/84 (53%), Gaps = 3/84 (3%)

Query: 110 VTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKL 169
            ++ ++  +DSN++A+ + S  ++++D  + G   L   +G H+ +   + FN     ++
Sbjct: 164 ASQVKWNYKDSNILASAH-SNDIYIWDL-RMGSTPLHKLVG-HDSSVNSIDFNRFKSSEI 220

Query: 170 LSGSDDSKIALWDITTNSTKPVST 193
           +S S+D  +  WDI+  S    ST
Sbjct: 221 MSSSNDGTVKFWDISKGSDNCTST 244

>AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR072C
          Length = 513

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 85/182 (46%), Gaps = 16/182 (8%)

Query: 147 SSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCK 206
           S++  H       +F P    ++++G+ D+   +WD  T +  P+ T +  H + V    
Sbjct: 135 SAIAGHGATILCSAFAPHTSSRMVTGAGDNTARIWDCDTQT--PLCTLKG-HSNWVLCVA 191

Query: 207 WHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNL--------F 258
           W   +G    + S D T++L D     S+ D ++  T + T + S    +L         
Sbjct: 192 W-SADGEVIATGSMDATIRLWDSEKGQSLGDALRGHTKWIT-SLSWEPIHLVKPGEKPRL 249

Query: 259 AAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLME 318
           A+A  D  I ++D+ R    ++T+SGH S+V+ +++      ++ S+  DR V  WD+  
Sbjct: 250 ASASKDGTIKIWDTTRR-VCIYTLSGHTSSVSCIKW--GGRNVLYSASHDRTVRCWDMAA 306

Query: 319 IG 320
            G
Sbjct: 307 GG 308

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 61/305 (20%), Positives = 114/305 (37%), Gaps = 72/305 (23%)

Query: 119 DSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPV------DKGKLLSG 172
           D  +IAT +   T+ L+D  K   + L  +L  H      LS+ P+      +K +L S 
Sbjct: 195 DGEVIATGSMDATIRLWDSEKG--QSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASA 252

Query: 173 SDDSKIALWDITTNSTKPVSTWE-SCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRV 231
           S D  I +WD    +T+ V  +  S H   V+  KW     N   S S D T++  D   
Sbjct: 253 SKDGTIKIWD----TTRRVCIYTLSGHTSSVSCIKWG--GRNVLYSASHDRTVRCWDMAA 306

Query: 232 KDSVTDKIKT--------------------------------------VTAFNTIAFSKH 253
                + +K+                                      +  +  +A    
Sbjct: 307 GGKCINILKSHAHWVNHLSLSTDYALRMGPFDHTGTKPASPEDAQARALRNYEKVAKKNG 366

Query: 254 STNLFAAAGTDSL-IYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDG-IVMSSGEDRRV 311
           +       G+D   +YL++  +    +  M+GH+  V ++ F  + DG  ++S+  D  +
Sbjct: 367 TMEELMVTGSDDFTMYLWNPLKGSKPILRMTGHQKLVNHVAF--SPDGRYIVSASFDNSI 424

Query: 312 IMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVW 371
            +W            D  DG  + +    GH + V   + + +   L+ S  ++  ++VW
Sbjct: 425 KLW------------DGRDG--KFIATFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVW 469

Query: 372 KCSSK 376
              ++
Sbjct: 470 DVKTR 474

>Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa]
           {ON} YDR128W - Hypothetical ORF [contig 174] FULL
          Length = 1102

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 67/144 (46%), Gaps = 2/144 (1%)

Query: 173 SDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVK 232
           + + K  LW+++ NS+  +      H   + D  +H  +     + S D  +   D R  
Sbjct: 88  TSNQKALLWNLSRNSSDAIEHVLHGHSRAITDINFHPTHPEILATCSIDAYVHAWDMRSP 147

Query: 233 DSVTDKIKTVTA-FNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTN 291
                     +A  + + ++  ++N+ A+A ++  +Y++D R+    LH + GH ++V +
Sbjct: 148 RRAYYSASVWSAGASQVKWNYKNSNVMASAHSND-VYIWDLRKGCTPLHVLQGHVNSVNS 206

Query: 292 LEFYAAKDGIVMSSGEDRRVIMWD 315
           ++F    +  +MSS  D  V  WD
Sbjct: 207 IDFSKFDETEIMSSSNDGTVKFWD 230

 Score = 30.8 bits (68), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 19/84 (22%), Positives = 45/84 (53%), Gaps = 3/84 (3%)

Query: 110 VTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKL 169
            ++ ++  ++SN++A+ + S  V+++D  K      L  L  H ++   + F+  D+ ++
Sbjct: 161 ASQVKWNYKNSNVMASAH-SNDVYIWDLRKGCTP--LHVLQGHVNSVNSIDFSKFDETEI 217

Query: 170 LSGSDDSKIALWDITTNSTKPVST 193
           +S S+D  +  WD + +  +P  T
Sbjct: 218 MSSSNDGTVKFWDYSLSDKEPQRT 241

>KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5.201
           YLL011W
          Length = 480

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 71/166 (42%), Gaps = 14/166 (8%)

Query: 143 EGLLSSLGFHEDNGYG-LSFNPVDKGKLLSG--SDDSKIALWDITTNSTKPVSTWESCHQ 199
           EGLL +        YG  +F  +D  +  S   +  ++I LWD  +N +KP+S   S   
Sbjct: 163 EGLLKTF-------YGEHAFQGIDHHREASTFVTGGAQIHLWD--SNRSKPISNL-SWGA 212

Query: 200 DGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFA 259
           D +   K+++   +   S   D  + L+D R  +S T KI      N I ++      F 
Sbjct: 213 DNITSVKFNQNEVDILASTGSDNAIVLYDLRT-NSPTQKIIQTMRTNAICWNPMEAFNFV 271

Query: 260 AAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSS 305
            A  D   Y YD R     LH    H S V +++F    D IV  S
Sbjct: 272 IANEDHNAYYYDMRNMSRALHVFKDHVSAVMDVDFSPTGDEIVTGS 317

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 82/195 (42%), Gaps = 33/195 (16%)

Query: 145 LLSSLGF-HEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTN----------------S 187
            +  LG+ H D  Y ++ N  +  KL SGS D  I  W+++T                  
Sbjct: 58  FIGQLGYGHRDGVYTIAKNYNNLNKLASGSADGIIKYWNMSTREEFVSFKAHYGLVTGLC 117

Query: 188 TKPVSTWESCHQDGVNDC------KWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKT 241
             P  T ++ +++ +  C      K   +N + F +V  D  L        + +      
Sbjct: 118 VTPEHTSKNKNENFMLSCGDDKTVKLWSVNNDDFSNVKSDAELNT------EGLLKTFYG 171

Query: 242 VTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGI 301
             AF  I   + ++  F   G    I+L+DS R+   +  +S    N+T+++F   +  I
Sbjct: 172 EHAFQGIDHHREAST-FVTGGAQ--IHLWDSNRS-KPISNLSWGADNITSVKFNQNEVDI 227

Query: 302 VMSSGEDRRVIMWDL 316
           + S+G D  ++++DL
Sbjct: 228 LASTGSDNAIVLYDL 242

>TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.672
           YPL151C
          Length = 423

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 57/221 (25%), Positives = 100/221 (45%), Gaps = 27/221 (12%)

Query: 155 NGY--GLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNG 212
           NG+   +  +PVD     +GS+D+ I +WD+ +   K      S H   V D      + 
Sbjct: 111 NGWVRCVQIDPVDNEWFATGSNDTTIKIWDLASGKLKIT---LSGHAMTVRDIAISNRHP 167

Query: 213 NTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHST-NLFAAAGTDSLIYLYD 271
             F S SED   +  D     ++ D    ++  +T+    H T +L A AG DS++ L+D
Sbjct: 168 YLF-SASEDKLAKCWDLEKNTAIRDYHGHLSGVHTVDI--HPTLDLIATAGRDSVVKLWD 224

Query: 272 SRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDG 331
            R    V+ T+ GH+S +  +        ++ SS  D  + +WD++             G
Sbjct: 225 IRSRVPVV-TLIGHKSPINKVHCLPVNPQVI-SSSVDATIRLWDIVA------------G 270

Query: 332 SPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWK 372
               V+ H  H+  + D + +P+  + MA+A  ++I + WK
Sbjct: 271 KASKVLTH--HKRSIRDIAFHPS-EFSMATACTDDI-RSWK 307

>ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 RiboSome Assembly 2
          Length = 516

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 74/161 (45%), Gaps = 13/161 (8%)

Query: 221 DCTLQ--LHDQRVKDSVTDKIKTVTAFNT----IAFSKHSTNLFAAAGTDSLIYLYDSRR 274
           DC+ Q  L  +     +TDK     A N     I +S   + +FA +GTD  + ++D+R 
Sbjct: 299 DCSGQIFLTQRHTSKWITDKQPFTAANNQSVEDIQWSPTESTVFATSGTDGYVRIWDTRS 358

Query: 275 TGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVI-MWDLMEIGAEQVPDDADDGSP 333
             +     +   +   N+  +  K G +++SG+D     +WDL +      P +++   P
Sbjct: 359 KKHKPAISTRASNTDVNVISWNEKLGYLLASGDDNGSWGVWDLRQFS----PANSEGVQP 414

Query: 334 EVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCS 374
             V  +  HR P+   S NP    ++A A E+N V +W  S
Sbjct: 415 --VAQYDFHRGPITSISFNPLDDSVVAVASEDNTVTLWDLS 453

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 3/64 (4%)

Query: 127 NGSGTVF-LYDRSKDGDEGL--LSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDI 183
           NGS  V+ L   S    EG+  ++   FH      +SFNP+D   +   S+D+ + LWD+
Sbjct: 393 NGSWGVWDLRQFSPANSEGVQPVAQYDFHRGPITSISFNPLDDSVVAVASEDNTVTLWDL 452

Query: 184 TTNS 187
           +  +
Sbjct: 453 SVEA 456

 Score = 30.8 bits (68), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 50/265 (18%), Positives = 96/265 (36%), Gaps = 56/265 (21%)

Query: 123 IATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYG---LSFNPVDKGKLLSGSDDSKIA 179
           + T + SG +FL  R     + +     F   N      + ++P +     +   D  + 
Sbjct: 295 LLTGDCSGQIFLTQRHTS--KWITDKQPFTAANNQSVEDIQWSPTESTVFATSGTDGYVR 352

Query: 180 LWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKI 239
           +WD  +   KP  +  + + D VN   W+E  G    S  ++ +  + D R         
Sbjct: 353 IWDTRSKKHKPAISTRASNTD-VNVISWNEKLGYLLASGDDNGSWGVWDLR--------- 402

Query: 240 KTVTAFNTIAFSKHSTNLFAAAGTDSL--IYLYDSRRTGNVLHTMSGHESNVTNLEFYAA 297
                             F+ A ++ +  +  YD             H   +T++ F   
Sbjct: 403 -----------------QFSPANSEGVQPVAQYDF------------HRGPITSISFNPL 433

Query: 298 KDGIVMSSGEDRRVIMWDL-MEIGAEQVPDDADDGS------PEVVMIHAGHRSPVNDFS 350
            D +V  + ED  V +WDL +E   +++     +        P+++ +H   +  V D  
Sbjct: 434 DDSVVAVASEDNTVTLWDLSVEADDDEIQQQTKEYKELQKIPPQLLFVH--WQKEVKDVK 491

Query: 351 MNPNIPWLMASAEEENIVQVWKCSS 375
            +  IP  + S   + +  VWK  S
Sbjct: 492 WHKQIPGCLVSTGTDGL-NVWKTIS 515

>ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR093W
          Length = 518

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 94/216 (43%), Gaps = 13/216 (6%)

Query: 93  FTKSNIKIIKKFKHEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFH 152
           F+    ++IK F   ++V  +     D  L+A  + +G V +YD        LL S+   
Sbjct: 66  FSSRTRQVIKTFSRFKDVVYSSSFRPDGKLLAAGDATGLVSVYDSY--NPRNLLVSIKAS 123

Query: 153 EDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNG 212
               +   F+P+DK  L++ +DD  + +WDI +++ +P         D V    +     
Sbjct: 124 THPAHVTKFHPLDKQTLVTATDDRVVRVWDI-SHAYEPTLELLGA-SDYVRSVCFVPGAP 181

Query: 213 NTFGSVSEDCTLQLHDQRVKDS--VTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLY 270
           +   S   D  ++LHD R + +  VT     ++  + +A S   T L +  G+   ++  
Sbjct: 182 HMVVSGCYDGVVRLHDTRTRSAQPVTQLNHGMSVEDIVAIS--PTQLVSCGGSKFKVW-- 237

Query: 271 DSRRTGN-VLHTMSGHESNVTNLEFYAAKDGIVMSS 305
               TGN +LH        VT L++    DG  M+S
Sbjct: 238 --DLTGNKLLHERGNFAKTVTCLDYVNMPDGGAMNS 271

 Score = 37.4 bits (85), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 52/105 (49%), Gaps = 11/105 (10%)

Query: 217 SVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFS---KHSTNLFAAAGTDSLIYLYDSR 273
           +V+    +QL   R +      IKT + F  + +S   +    L AA     L+ +YDS 
Sbjct: 56  AVTSSTRVQLFSSRTRQV----IKTFSRFKDVVYSSSFRPDGKLLAAGDATGLVSVYDSY 111

Query: 274 RTGNVLHTM--SGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL 316
              N+L ++  S H ++VT  +F+      ++++ +DR V +WD+
Sbjct: 112 NPRNLLVSIKASTHPAHVT--KFHPLDKQTLVTATDDRVVRVWDI 154

>Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON}
           YCR057C (REAL)
          Length = 916

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 113/238 (47%), Gaps = 24/238 (10%)

Query: 92  GFTKSNIKI--IKKFKHEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDG-------- 141
           GFT    ++  +  F   Q+++    M Q+     ++N +G    +  SK G        
Sbjct: 273 GFTSGEFRLYDLPDFTLIQQLS----MGQNPVNTVSVNSTGEWLAFGSSKLGQLLVYEWQ 328

Query: 142 -DEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQD 200
            +  +L   G H D+   L+++P D  ++++ SDD KI +WDIT+     ++T+E  H  
Sbjct: 329 SESYILKQQG-HFDSTNCLAYSP-DGSRVVTASDDGKIKVWDITSGFC--LATFEE-HTS 383

Query: 201 GVNDCKWHELNGNTFGSVSEDCTLQLHDQ-RVKDSVTDKIKTVTAFNTIAFSKHSTNLFA 259
            V   ++ +  G    S S D T++  D  R ++  T        FN +A       + A
Sbjct: 384 SVTAVQFAK-RGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCA 442

Query: 260 AAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLM 317
            +  +  I+++ S +TG +L  +SGHE  V+ L F + ++ ++ S+  D+ + +W + 
Sbjct: 443 GSLDNFDIHVW-SVQTGQLLDALSGHEGPVSCLSF-SQENSVLASASWDKTIRIWSIF 498

>KNAG0G00130 Chr7 complement(8702..10888) [2187 bp, 728 aa] {ON}
           Anc_1.534 YKL213C
          Length = 728

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 68/153 (44%), Gaps = 13/153 (8%)

Query: 166 KGKLLSGSDDSKIALWDITTNSTKPVSTWE-SCHQDGVNDCKWHELN--GNTFGSVSEDC 222
           KG L+SGS D    +W       +    W+   H   V D K    N   N F +VS D 
Sbjct: 117 KGTLISGSWDKTAKVW------MEGTCKWDLKGHAASVWDAKSIPGNETSNRFITVSADM 170

Query: 223 TLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTM 282
           T+++ +     S  D I        +A    +  LFA    D  I + D +  G V  T+
Sbjct: 171 TIKIWENDKCVSTFDNIHQ-DVIRHVAILDDAGKLFATCSNDGFIKILDDK--GKVKKTL 227

Query: 283 SGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWD 315
            GHES V +++    K G ++S GEDR V +WD
Sbjct: 228 EGHESFVYSVQL-NRKTGELVSCGEDRSVRIWD 259

>TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {ON}
           Anc_6.325 YCR057C
          Length = 927

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 87/178 (48%), Gaps = 8/178 (4%)

Query: 152 HEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELN 211
           H D   GL+++P D  ++++ S+D KI +WD+ +     ++T+E  H   V+  ++ +  
Sbjct: 340 HFDTLNGLTYSP-DGSRVVTASEDGKIKIWDVVSGFC--LATFEE-HTSAVSAVQFSK-R 394

Query: 212 GNTFGSVSEDCTLQLHDQ-RVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLY 270
           G    S S D T++  D  R ++  T        FN++A    S  +  A   D+     
Sbjct: 395 GQVLFSASLDGTVRAWDLIRYRNFRTFTAAERIQFNSLAVDP-SGEVVCAGSIDNYEIQV 453

Query: 271 DSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDA 328
            S +TG +L  ++GHE  V+ L F + ++ ++ S+  D+ + +W +     +  P D 
Sbjct: 454 WSVQTGQLLDCLAGHEGPVSCLAF-SQENNVLASASWDKTIRVWSIFGRSQQVEPIDV 510

>Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C
           (REAL)
          Length = 523

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 79/183 (43%), Gaps = 26/183 (14%)

Query: 161 FNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSE 220
           +N VD   ++S S D+   +WD+   S+  V T    H   V D ++   +   F S   
Sbjct: 251 WNMVDTNLIISSSIDTTCIVWDL--QSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGG 308

Query: 221 DCTLQLHDQRV-------------------KDSVTDKIKTVTAFNTIAFSKHSTNLFAAA 261
           D ++++ D R                     D+ T   K   A   +  S +  N+ A  
Sbjct: 309 DGSVRVFDLRSLAHSTIIYEPPASSAPGLNADTTTPASKGSDALLRLEPSPYDPNVLATF 368

Query: 262 GTDS-LIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL---- 316
             +S  I + D R   + +  + GH S+V  ++++  K  +++S G+D +V+ WDL    
Sbjct: 369 AAESNKIIILDMRNPESPILNLEGHSSSVNEIKWHPTKRNVLLSCGDDCQVLYWDLNNSF 428

Query: 317 MEI 319
           MEI
Sbjct: 429 MEI 431

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 42/94 (44%), Gaps = 3/94 (3%)

Query: 234 SVTDKIKTVTAFNTIA---FSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVT 290
           + TD +K +  F  I    ++   TNL  ++  D+   ++D + +  V   +  H+S V 
Sbjct: 232 AATDDMKVIGTFPPITSFDWNMVDTNLIISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVF 291

Query: 291 NLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQV 324
           ++ F      +  S G D  V ++DL  +    +
Sbjct: 292 DVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTI 325

>Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON}
           YCR057C (REAL)
          Length = 924

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 113/238 (47%), Gaps = 24/238 (10%)

Query: 92  GFTKSNIKI--IKKFKHEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDG-------- 141
           GFT    ++  +  F   Q+++    M Q+     ++N +G    +  SK G        
Sbjct: 276 GFTTGEFRLYDMPDFTLIQQLS----MGQNPVNTVSVNNTGEWLAFGSSKLGQLLVYEWQ 331

Query: 142 -DEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQD 200
            +  +L   G H D+   L+++P D  ++++ SDD KI +WDIT+     ++T+E  H  
Sbjct: 332 SESYILKQQG-HFDSTNSLAYSP-DGSRVVTASDDGKIKVWDITSGFC--LATFEE-HTS 386

Query: 201 GVNDCKWHELNGNTFGSVSEDCTLQLHDQ-RVKDSVTDKIKTVTAFNTIAFSKHSTNLFA 259
            V   ++ +  G    S S D T++  D  R ++  T        FN +A       + A
Sbjct: 387 SVTAVQFAK-RGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCA 445

Query: 260 AAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLM 317
            +  +  I+++ S +TG +L  +SGHE  V+ L F + ++ ++ S+  D+ + +W + 
Sbjct: 446 GSLDNFDIHVW-SVQTGQLLDALSGHEGPVSCLSF-SQENSVLASASWDKTIRIWSIF 501

>Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}
           YPL247C (REAL)
          Length = 526

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 81/199 (40%), Gaps = 28/199 (14%)

Query: 161 FNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSE 220
           +N VD   ++S S D+   +WD+   S+  V T    H   V D ++   +   F S   
Sbjct: 251 WNTVDTNLIISSSIDTTCIVWDL--QSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGG 308

Query: 221 DCTLQLHDQR---------------------VKDSVTDKIKTVTAFNTIAFSKHSTNLFA 259
           D ++++ D R                        + T       A   +  S +  N+ A
Sbjct: 309 DGSVRVFDLRSLAHSTIIYEPPSSSSSSSAPAAGTTTPSSDGSYALLRLEPSPYDPNVLA 368

Query: 260 AAGTDS-LIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL-- 316
               DS  I + D R   + + T+ GH S+V  ++++  K  +++S  +D +V+ WDL  
Sbjct: 369 TFAADSNKIIILDMRNPESPILTLEGHSSSVNEIKWHPTKRNVLLSCSDDCQVLYWDLNN 428

Query: 317 --MEIGAEQVPDDADDGSP 333
             MEI    V      G+P
Sbjct: 429 SFMEINGGSVKSPGASGTP 447

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 58/142 (40%), Gaps = 21/142 (14%)

Query: 106 HEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLL---------------SSLG 150
           H+ EV   R++ + + L A+  G G+V ++D        ++                +  
Sbjct: 286 HDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPSSSSSSSAPAAGTTT 345

Query: 151 FHEDNGYGL---SFNPVDKGKLLS-GSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCK 206
              D  Y L     +P D   L +  +D +KI + D+  N   P+ T E  H   VN+ K
Sbjct: 346 PSSDGSYALLRLEPSPYDPNVLATFAADSNKIIILDMR-NPESPILTLEG-HSSSVNEIK 403

Query: 207 WHELNGNTFGSVSEDCTLQLHD 228
           WH    N   S S+DC +   D
Sbjct: 404 WHPTKRNVLLSCSDDCQVLYWD 425

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 42/94 (44%), Gaps = 3/94 (3%)

Query: 234 SVTDKIKTVTAFNTIA---FSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVT 290
           + T+ +K +  F  I    ++   TNL  ++  D+   ++D + +  V   +  H+S V 
Sbjct: 232 ATTEDMKVIGTFPPITSFDWNTVDTNLIISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVF 291

Query: 291 NLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQV 324
           ++ F      +  S G D  V ++DL  +    +
Sbjct: 292 DVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTI 325

 Score = 30.8 bits (68), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 35/74 (47%), Gaps = 1/74 (1%)

Query: 110 VTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKL 169
           + R    P D N++AT        +    ++ +  +L+  G H  +   + ++P  +  L
Sbjct: 354 LLRLEPSPYDPNVLATFAADSNKIIILDMRNPESPILTLEG-HSSSVNEIKWHPTKRNVL 412

Query: 170 LSGSDDSKIALWDI 183
           LS SDD ++  WD+
Sbjct: 413 LSCSDDCQVLYWDL 426

>Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON}
           (56367..60125) [3759 nt, 1253 aa]
          Length = 1252

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 48/207 (23%), Positives = 94/207 (45%), Gaps = 18/207 (8%)

Query: 127 NGSGTVFLYDRSKDGDEGL--LSSLGFHEDNGYGLSFNPVDKGKLLSGSD-DSKIALWDI 183
           NG+  +F +D      + L  LS    H+ +   L FN      L+SGSD + +I +WD+
Sbjct: 83  NGNIELFNFDNKSQTIKSLGNLSDSNKHKGSVKTLKFNTKQSNLLVSGSDKNGEILIWDL 142

Query: 184 TTNSTKPVST-WESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSV-----TD 237
                 P++        + +    W++   + F   S    + + D + K  V     T+
Sbjct: 143 NNLDKTPLTPGMPMTPTNEITSLAWNKSLSHVFSCSSNTSNVSIFDLKAKKEVIHLNYTN 202

Query: 238 KIKTVTAFNTIA--FSKHSTNLFAAA-GTDSL----IYLYDSRRTGNVLHTMS--GHESN 288
            +  V +  ++     K+ST +  A    DS     I+++D R +   L  +S  GH + 
Sbjct: 203 PVNNVKSLFSVVEWHPKNSTRIATATLNNDSTESDSIFIWDLRNSHTPLQILSKDGHSNG 262

Query: 289 VTNLEFYAAKDGIVMSSGEDRRVIMWD 315
           + +L++ +  + +++SSG D  V++W+
Sbjct: 263 ILSLDWCSTDENLLLSSGRDNSVMLWN 289

>KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {ON}
           Anc_6.325 YCR057C
          Length = 906

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 110/238 (46%), Gaps = 24/238 (10%)

Query: 92  GFTKSNIKI--IKKFKHEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDG-------- 141
           GFT    ++  +  F   Q+++    M Q+     +IN SG    +  SK G        
Sbjct: 273 GFTTGEFRLYELPSFTLIQQLS----MGQNPINSVSINESGEWLAFGSSKLGQLLVYEWQ 328

Query: 142 -DEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQD 200
            +  +L   G H D+   L+++P D  ++++ ++D KI +WD+ +     ++T+E  H  
Sbjct: 329 SESYILKQQG-HFDSTNSLTYSP-DGSRVVTAAEDGKIKVWDVVSGFC--LATFEE-HTS 383

Query: 201 GVNDCKWHELNGNTFGSVSEDCTLQLHDQ-RVKDSVTDKIKTVTAFNTIAFSKHSTNLFA 259
            V   ++ +  G    S S D T++  D  R ++           FN++A    S  +  
Sbjct: 384 SVTQVQFAK-KGQVLFSASLDGTVRAWDLIRYRNFRVFTAAERIQFNSLAVDP-SGEVVC 441

Query: 260 AAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLM 317
           A   DS      S +TG +L T++GHE  ++ L F + ++ I+ S+  D+ + +W + 
Sbjct: 442 AGSVDSFDIHVWSVQTGQLLDTLAGHEGPISCLAF-SQENSILASASWDKTIRIWSIF 498

>TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.401
           YMR131C
          Length = 514

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 63/292 (21%), Positives = 118/292 (40%), Gaps = 47/292 (16%)

Query: 122 LIATINGSGTVFLYDRS--------------KDGDEGLLSSLGFHEDNGYGLSFNPVDK- 166
           L AT++ +G V+++D                K   + L +        GYGL ++P+ K 
Sbjct: 231 LTATMSENGEVYIHDLGPQTKAFETPGYQIPKSAKKPLHTIRNHGNVEGYGLDWSPLIKT 290

Query: 167 GKLLSGSDDSKIALWDITTNSTKPVSTWESCHQ-------DGVNDCKWHELNGNTFGSVS 219
           G LL+G    ++ L      + +  S W +  Q         + D +W       F +  
Sbjct: 291 GALLTGDCSGQVYL------TQRHTSKWVTDKQPFTFSNNKSIEDIQWSRTESTVFATSG 344

Query: 220 EDCTLQLHDQRVKD--SVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRR--- 274
            D  +++ D R K          + T  N I++++    L A+   D    ++D R+   
Sbjct: 345 CDGYIRIWDTRSKKHKPAISTRASATDVNVISWNEKIGYLLASGDDDGRWGVWDLRQLSP 404

Query: 275 --TGNV--LHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL-MEIGAEQVPDDAD 329
             + NV  +     H+  +T++ F    + I+  + ED  V +WDL +E   E++   A 
Sbjct: 405 NNSENVQPVAQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAA 464

Query: 330 DGS------PEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSS 375
           +        P+++ +H   +  V D   +  IP  + S   + +  VWK  S
Sbjct: 465 ETKELQQIPPQLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDGL-NVWKTIS 513

>NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {ON}
           Anc_5.429 YDR364C
          Length = 448

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 87/188 (46%), Gaps = 10/188 (5%)

Query: 152 HEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELN 211
           H +    L+F P     LLSG +D+ + +WD      + +      H   +N   +++ +
Sbjct: 154 HTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDFY--HKRNLLRDYKGHSKAINSLDFND-D 210

Query: 212 GNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYD 271
           G  F S S D T+++ D   +  V  K+   +  N + F   +++ F     +S IY YD
Sbjct: 211 GTNFISSSFDHTIKIWDTE-QGKVKTKLHFKSTPNDVKFRPFNSSEFIVGFANSKIYHYD 269

Query: 272 SRRTGN--VLHTMSGHESNVTNLEFYAAKDG-IVMSSGEDRRVIMWD-LMEIGAEQVPDD 327
           +R + N   +     H S++  L+F+   DG   +SS ED+ V +WD  + +  +Q+ D 
Sbjct: 270 TRISENDGRVQVYDHHMSSILALKFFP--DGSKFISSSEDKTVRIWDNQVNVPIKQISDT 327

Query: 328 ADDGSPEV 335
                P +
Sbjct: 328 TQYSMPSI 335

 Score = 30.8 bits (68), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 19/94 (20%), Positives = 38/94 (40%), Gaps = 14/94 (14%)

Query: 278 VLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVM 337
           + + M GH +  T+L F      +++S G D  V +WD                   ++ 
Sbjct: 147 IKYAMDGHTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDFYH-------------KRNLLR 193

Query: 338 IHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVW 371
            + GH   +N    N +    ++S+ +  I ++W
Sbjct: 194 DYKGHSKAINSLDFNDDGTNFISSSFDHTI-KIW 226

>TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 65/305 (21%), Positives = 119/305 (39%), Gaps = 50/305 (16%)

Query: 112 RARYMP----QDSNLIATINGSGTVFLYDRS--------------KDGDEGLLSSLGFHE 153
           R R  P    Q   L +T++ +G VF+YD +              K     L +      
Sbjct: 220 RLRISPYATVQQEILTSTMSENGEVFIYDLTPQTRAFETPGYQIPKTAKRPLHTIRNHGN 279

Query: 154 DNGYGLSFNPVDK-GKLLSGSDDSKIALWDITTNSTKPVSTWES-------CHQDGVNDC 205
             GYGL ++P+ K G LL+G     + L      + +  S W +        +   + D 
Sbjct: 280 VEGYGLDWSPLIKTGALLTGDCSGMVYL------TQRHTSKWVTDKTPFTVGNNKSIEDI 333

Query: 206 KWHELNGNTFGSVSEDCTLQLHDQRVKD--SVTDKIKTVTAFNTIAFSKHSTNLFAAAGT 263
           +W       F +   D  +++ D R K    V   + + T  N I++++    L A+   
Sbjct: 334 QWSRTESTVFATAGCDGYIRIWDTRSKKHKPVISTVVSNTDVNVISWNEKMGYLLASGDD 393

Query: 264 DSLIYLYDSRR------TGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL- 316
                ++D R+          +     H+  +T++ F    + IV  + ED  V +WDL 
Sbjct: 394 KGTWGIWDLRQFSPNSEKALPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLS 453

Query: 317 MEIGAEQVPD------DADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQV 370
           +E   E++        + +   P+++ +H   +  V D   +  IP  + S   + +  V
Sbjct: 454 VEADDEEIKQQKAEIKELEQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NV 510

Query: 371 WKCSS 375
           WK  S
Sbjct: 511 WKTIS 515

>KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {ON}
           some similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 725

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 106/228 (46%), Gaps = 20/228 (8%)

Query: 159 LSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSV 218
           + F+P D   L +G++D  I +WD+TT   + V T +   QD +    +   +G+   S 
Sbjct: 454 VCFSP-DGKFLATGAEDKLIRIWDLTTR--RIVMTLQGHEQD-IYSLDYFP-SGDKLVSG 508

Query: 219 SEDCTLQLHDQRV-KDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGN 277
           S D T+++ D R  + S+T  I+      T+A S     L AA   D  + ++DS  TG 
Sbjct: 509 SGDRTVRIWDLRAGQCSLTLSIE--DGVTTVAVSPGDGKLIAAGSLDRTVRIWDS-ETGF 565

Query: 278 VLHTM-------SGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADD 330
           ++  +       +GH+ +V ++ F     G+V S   DR V +W+L           A+ 
Sbjct: 566 LVERLDSENELGTGHKDSVYSVVFTRDGHGVV-SGSLDRSVKLWNLRSANGGSTEGKANT 624

Query: 331 GSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSKLP 378
            + EV   + GH+  V   +   N  ++++ +++  ++  W   S  P
Sbjct: 625 AASEVT--YTGHKDFVLSVATTQNDEFILSGSKDRGVL-FWDTPSGNP 669

 Score = 37.4 bits (85), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 72/342 (21%), Positives = 134/342 (39%), Gaps = 81/342 (23%)

Query: 59  GTHTSEEEPNYLKIAAIDL--------PDE--IVPGKEDRERDGFTKSNIKIIKKFK-HE 107
           G   +E+ P     A+ DL        PD   +  G ED+    +  +  +I+   + HE
Sbjct: 431 GAENAEQTPAVSTSASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLTTRRIVMTLQGHE 490

Query: 108 QEVTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKG 167
           Q++    Y P    L++  +G  TV ++D  + G   L  S+   ED    ++ +P D  
Sbjct: 491 QDIYSLDYFPSGDKLVSG-SGDRTVRIWDL-RAGQCSLTLSI---EDGVTTVAVSPGDGK 545

Query: 168 KLLSGSDDSKIALWDITT-------NSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSE 220
            + +GS D  + +WD  T       +S   + T    H+D V    +   +G+   S S 
Sbjct: 546 LIAAGSLDRTVRIWDSETGFLVERLDSENELGTG---HKDSVYSVVFTR-DGHGVVSGSL 601

Query: 221 DCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLH 280
           D +++L + R  +  + + K  TA + + ++ H   + + A T +               
Sbjct: 602 DRSVKLWNLRSANGGSTEGKANTAASEVTYTGHKDFVLSVATTQN--------------- 646

Query: 281 TMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHA 340
                             D  ++S  +DR V+ W            D   G+P  +++  
Sbjct: 647 ------------------DEFILSGSKDRGVLFW------------DTPSGNP--LLMLQ 674

Query: 341 GHRSPV------NDFSMNPNIPWLMASAEEENIVQVWKCSSK 376
           GHR+ V      ND  + P    + A+   +   ++WK + K
Sbjct: 675 GHRNSVISVAVANDHPLGPEY-GVFATGSGDCKARIWKYTKK 715

>Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}
           similar to Ashbya gossypii AFL157C
          Length = 435

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 59/265 (22%), Positives = 107/265 (40%), Gaps = 58/265 (21%)

Query: 110 VTRARYMPQDSNLIATINGSGTVF-LYDRSKDGDEGLLSSLGFHED---NGYGLS----- 160
           V+R ++MP  S  +AT + S  ++ L D+ K+     L   G       NG+ L      
Sbjct: 110 VSRIQWMPMSSEKLATCSDSLRIWSLGDQLKEQVNLSLVKYGKGVGDVANGHTLGKLPPV 169

Query: 161 ----FNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFG 216
               +N +D   +LS S D+   +WD+   ++  V T    H   V D K+   + N F 
Sbjct: 170 TSFDWNSIDTNIILSSSIDTTCTVWDL--QASNYVKTQLIAHDSEVFDAKFLTQSSNLFA 227

Query: 217 SVSEDCTLQLHDQRVKDSVT------DKIKTVT--------------------------- 243
           S   D ++++ D R     T       +I+T T                           
Sbjct: 228 SCGGDGSVRVFDLRCLAHSTIIYEPQSQIQTHTPSQIQLSAQGHDDGHARKNNQNAAETS 287

Query: 244 ---------AFNTIAFSKHSTNLFAAAGTDS-LIYLYDSRRTGNVLHTMSGHESNVTNLE 293
                    A   +  S    N+ A    DS ++ + D R  G+ + T++GH   +  L 
Sbjct: 288 LAVSSLESQALLRLEPSPFDPNILATIQQDSNVVIILDMRYPGSPILTLNGHYCALNQLR 347

Query: 294 FYAAKDGIVMSSGEDRRVIMWDLME 318
           ++ +K  ++ + G+D +++ WDL++
Sbjct: 348 WHPSKPNVLATCGDDCQILYWDLLD 372

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 24/41 (58%)

Query: 96  SNIKIIKKFKHEQEVTRARYMPQDSNLIATINGSGTVFLYD 136
           SN    +   H+ EV  A+++ Q SNL A+  G G+V ++D
Sbjct: 199 SNYVKTQLIAHDSEVFDAKFLTQSSNLFASCGGDGSVRVFD 239

>Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar to
           Ashbya gossypii AAR057W
          Length = 923

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 99/212 (46%), Gaps = 18/212 (8%)

Query: 116 MPQDSNLIATINGSGTVFLYDRSKDG---------DEGLLSSLGFHEDNGYGLSFNPVDK 166
           M Q+     ++N SG    +  SK G         +  +L   G H D    L+++P D 
Sbjct: 312 MGQNPVNTVSVNKSGEWLAFGSSKLGQLLVYEWQSESYILKQQG-HFDTMNDLAYSP-DG 369

Query: 167 GKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQL 226
            ++++ S D KI +WDI +     ++T+E  H   V   ++ +  G    S   D T++ 
Sbjct: 370 SRIVTASSDGKIKIWDIVSGFC--LATFEE-HVSAVTAVQFAK-KGQIMFSACLDGTVKA 425

Query: 227 HDQ-RVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGH 285
            D  R ++  T        FN +A       + A +  D  I+++ S +TG +L T+SGH
Sbjct: 426 WDLIRYRNFRTFTATERIQFNCLAVDPSGEIVCAGSLDDFNIHVW-SVQTGQLLDTLSGH 484

Query: 286 ESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLM 317
           E  V+ L F + ++ ++ S+  D+ + +W + 
Sbjct: 485 EGPVSCLSF-SNENSVLASASWDKTIRIWSIF 515

>Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W
           (REAL)
          Length = 1270

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 97/214 (45%), Gaps = 17/214 (7%)

Query: 119 DSNLIATINGSGTVFLYDRSKDGDE-GLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSK 177
           ++ +IA    +G++ LY  ++  D    ++    H  +   + FN      L SG ++ +
Sbjct: 73  NNKIIAGALDNGSLELYSTNEVNDAISSMAKFSNHSSSVKTVKFNAKQDNVLASGGNNGE 132

Query: 178 IALWDI-----TTNSTKPVSTWESCHQ-DGVNDCKWHELNGNTFGSVSEDCTLQLHDQRV 231
           I +WD+     +  +  P++  +S    D VN   W++   + F S        + D + 
Sbjct: 133 IFIWDMNKCTESPANYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKA 192

Query: 232 KDSVTDKIKTVT------AFNTIAF-SKHSTNLFAAAGTDS--LIYLYDSRRTGNVLHTM 282
           K  V     T          + + +  K+ST +  A G+D+   I ++D R     L T+
Sbjct: 193 KKEVIHLCYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQTL 252

Query: 283 S-GHESNVTNLEFYAAKDGIVMSSGEDRRVIMWD 315
           + GH+  + +L++    + +++SSG D  V++W+
Sbjct: 253 NQGHQKGILSLDWCHQDENLLLSSGRDNTVLLWN 286

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 77/172 (44%), Gaps = 11/172 (6%)

Query: 210 LNGNTFGSVSEDCTLQLHDQRVKDS--VTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLI 267
           ++G    + S D +L+L      DS      ++  + FN + +S H+  + A A  +  +
Sbjct: 28  VSGTVDANFSSDSSLELWSLLASDSEKPIASLQVDSKFNDLDWS-HNNKIIAGALDNGSL 86

Query: 268 YLYDSRRTGNVLHTM---SGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQV 324
            LY +    + + +M   S H S+V  ++F A +D ++ S G +  + +WD+ +    + 
Sbjct: 87  ELYSTNEVNDAISSMAKFSNHSSSVKTVKFNAKQDNVLASGGNNGEIFIWDMNK--CTES 144

Query: 325 PDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSK 376
           P +    +P   M        VN  + N ++  + ASA   N   +W   +K
Sbjct: 145 PANYTPLTPGQSMSSVDE---VNSLAWNQSLAHVFASAGSSNFASIWDLKAK 193

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 61/149 (40%), Gaps = 12/149 (8%)

Query: 133 FLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSD-DSKIALWDITTNSTKPV 191
             Y     G +  LS + +H  N   ++          +GSD D  I +WD+  N+  P+
Sbjct: 199 LCYTSPNSGIKQQLSVVEWHPKNSTRVA--------TATGSDNDPSILVWDLR-NANTPL 249

Query: 192 STWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTD-KIKTVTAFNTIAF 250
            T    HQ G+    W   + N   S   D T+ L +  + + ++    +    F T  F
Sbjct: 250 QTLNQGHQKGILSLDWCHQDENLLLSSGRDNTVLLWNPELAEQLSQFPTRGNWCFKT-KF 308

Query: 251 SKHSTNLFAAAGTDSLIYLYDSRRTGNVL 279
           +  + +LFA A  D+ I +   +   N L
Sbjct: 309 APEAPDLFACASFDNKIEVQTLQNLTNTL 337

>Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 65/293 (22%), Positives = 115/293 (39%), Gaps = 49/293 (16%)

Query: 122 LIATINGSGTVFLYDR--------------SKDGDEGLLSSLGFHEDNGYGLSFNPVDK- 166
           L AT++ +G V++YD               SK     + +        GYGL ++P+ K 
Sbjct: 226 LTATMSENGDVYIYDLAPQSKAFSTPGYQISKSAKRPIHTVKSHGNVEGYGLDWSPLIKT 285

Query: 167 GKLLSGSDDSKIALWDITTNSTKPVSTWESCHQ-------DGVNDCKWHELNGNTFGSVS 219
           G LLSG    +I        + +  S W +  Q         + D +W       F +  
Sbjct: 286 GALLSGDCSGQIYF------TQRHTSRWVTDKQPFTVSNNKSIEDIQWSRTESTVFATAG 339

Query: 220 EDCTLQLHDQRVKD---SVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRR-- 274
            D  +++ D R K    +++ K    T  N I++S     L A+   +    ++D R+  
Sbjct: 340 CDGYIRIWDTRSKKHKPAISVKASN-TDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFT 398

Query: 275 -----TGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL-MEIGAEQVPDDA 328
                T   +     H+  +T++ F    + IV    ED  V +WDL +E   E++    
Sbjct: 399 PSNADTVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQT 458

Query: 329 DDGS------PEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSS 375
            +        P+++ +H   +  V D   +  IP  + S   + +  VWK  S
Sbjct: 459 AETKELQEIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NVWKTIS 508

>TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {ON}
           Anc_6.325 YCR057C
          Length = 912

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 93/179 (51%), Gaps = 16/179 (8%)

Query: 152 HEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELN 211
           H D    L+++P D  ++++ S+D KI +WD+ +     ++T+E  H   V   ++ +  
Sbjct: 335 HFDALNDLTYSP-DGSRVVTSSEDGKIKIWDVVSGFC--LATFEE-HTSSVTAVQFAK-R 389

Query: 212 GNTFGSVSEDCTLQLHDQ-RVKD----SVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSL 266
           G    S S D T++  D  R ++    + TD+I+    FN +A       + A +  +  
Sbjct: 390 GQVLFSASLDGTVRAWDLIRYRNFRTFTSTDRIQ----FNCLAVDPSGEVVCAGSLDNFE 445

Query: 267 IYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVP 325
           I+++ S +TG +L T++GHE  V+ L F + ++G++ S+  D+ + +W +     +  P
Sbjct: 446 IHVW-SVQTGQLLDTLAGHEGPVSCLAF-SQENGVLASASWDKTIRIWSIFARSQQVEP 502

>AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR142C (PEX7)
          Length = 370

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/249 (22%), Positives = 105/249 (42%), Gaps = 51/249 (20%)

Query: 114 RYMPQDSNLIATINGS-------GTVFLYDRSKDGDEGLLSSLGFHEDNG-YGLSFNPVD 165
           +Y P   N +A  +GS       G +F+ D +  G   ++ S  F   +G + +++N + 
Sbjct: 15  QYSPFFDNKLAVASGSNFGLVGNGRLFIMDLTAQGT--MVESNSFLTKDGLFDVAWNELH 72

Query: 166 KGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQ 225
           + ++L+   D  + L+DIT     P++ ++  HQ  V  C W+ L+ +TF S S D T++
Sbjct: 73  ENQVLAAQGDGSLRLFDITLQQ-YPIALFQE-HQREVFSCNWNLLHKDTFVSSSWDGTVK 130

Query: 226 L---------------------------------HDQRVKDSVTDKIKTVTAFNTIAFSK 252
           +                                 + Q+ KD+  +K     A     FS 
Sbjct: 131 VWTPARPQSMLTLLPAPANRSVMVEPGARGLPLSNQQQHKDAADNKDCIYQA----QFSP 186

Query: 253 HSTNLFAAAGTDSLIYLYDSRR--TGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRR 310
           H  NL  +   +S + L+D R+    N    ++       + +F   +  ++ + G D+ 
Sbjct: 187 HDPNLVMSCSGNSYVSLFDLRQPAASNQQRFIAHSGLEALSCDFNKYRPHVIATGGVDKM 246

Query: 311 VIMWDLMEI 319
           V +WDL  +
Sbjct: 247 VKVWDLRMV 255

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 64/170 (37%), Gaps = 25/170 (14%)

Query: 110 VTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKL 169
           + +A++ P D NL+ + +G+  V L+D  +         +           FN      +
Sbjct: 179 IYQAQFSPHDPNLVMSCSGNSYVSLFDLRQPAASNQQRFIAHSGLEALSCDFNKYRPHVI 238

Query: 170 LSGSDDSKIALWD-------ITTNSTKPVSTWE-SCHQDGVNDCKWHELNGNTFGSVSED 221
            +G  D  + +WD       +TT+ T PVS  E   H   V    W   + N   S S D
Sbjct: 239 ATGGVDKMVKVWDLRMVRQTLTTSRTAPVSINEMQGHSLAVRKVVWSPHHSNILLSTSYD 298

Query: 222 CTLQL-----------HDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAA 260
            T +            H  R  +S  D  +      +  FSKHS  +F A
Sbjct: 299 MTCRAWHDLADGPGGQHSGRTNNS--DPQRGC----SYVFSKHSEFVFGA 342

>ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR131C
           (RRB1)
          Length = 521

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/244 (22%), Positives = 105/244 (43%), Gaps = 34/244 (13%)

Query: 156 GYGLSFNPVDK-GKLLSGSDDSKIALWDITTNSTKPVSTWESCHQ-------DGVNDCKW 207
           GYGL ++P+ K G LL+G    ++ L      + +  S W +  Q         + D KW
Sbjct: 287 GYGLDWSPLIKTGALLTGDCSGRVFL------TQRTSSKWITDKQPFTVDNNKSIEDIKW 340

Query: 208 HELNGNTFGSVSEDCTLQLHDQRVKD---SVTDKIKTVTAFNTIAFSKHSTNLFAAAGTD 264
                  F +   D  +++ D R K    +++ K+   T  N +++++  + L A    +
Sbjct: 341 SPSENTVFATCGVDGHVRIWDIRSKKHKPALSVKVSD-TDVNVMSWNQKISYLLATGDDN 399

Query: 265 SLIYLYDSRRTGNVLHTMSG------HESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL-M 317
               ++D R+  N    +S       H+  +T++ F    + I+  + ED  V +WDL +
Sbjct: 400 GTWGVWDLRQFSNQQGGVSPVAQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSV 459

Query: 318 EIGAEQVPDDADDGS------PEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVW 371
           E   E++   A +        P+++ +H   +  V D   +  IP  + S   + +  VW
Sbjct: 460 EADDEEIKQQAAEVKELQQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NVW 516

Query: 372 KCSS 375
           K  S
Sbjct: 517 KTIS 520

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 41/72 (56%), Gaps = 4/72 (5%)

Query: 120 SNLIATINGSGTVFLYD-RSKDGDEGLLSSLG---FHEDNGYGLSFNPVDKGKLLSGSDD 175
           S L+AT + +GT  ++D R     +G +S +    FH+     +SFNP+D+  +   S+D
Sbjct: 390 SYLLATGDDNGTWGVWDLRQFSNQQGGVSPVAQYDFHKGAITSISFNPLDESIIAVASED 449

Query: 176 SKIALWDITTNS 187
           + + LWD++  +
Sbjct: 450 NTVTLWDLSVEA 461

>NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {ON}
           Anc_6.325
          Length = 915

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 60/249 (24%), Positives = 111/249 (44%), Gaps = 24/249 (9%)

Query: 92  GFTKSNIKI--IKKFKHEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDG-------- 141
           GFT    ++  +  F   Q+++    M Q+      +N SG    +  SK G        
Sbjct: 276 GFTNGEFRLYELPHFTLLQQLS----MGQNPINTVAVNSSGEWLAFGSSKLGQLLVYEWQ 331

Query: 142 -DEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQD 200
            +  +L   G H D    L+++P D  ++++ ++D KI +WD+ +     ++T++  H  
Sbjct: 332 SESYILKQQG-HFDATNSLTYSP-DGSRVVTAAEDGKIKVWDVVSGFC--LATFQE-HTS 386

Query: 201 GVNDCKWHELNGNTFGSVSEDCTLQLHDQ-RVKDSVTDKIKTVTAFNTIAFSKHSTNLFA 259
            V   ++ +  G    S S D T++  D  R ++  T        FN +A    S  +  
Sbjct: 387 SVTQVQFAK-RGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCLAVDP-SGEVVC 444

Query: 260 AAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEI 319
           A   D+      S +TG +L T+SGHE  V+ L F + ++ ++ S+  D+ V +W +   
Sbjct: 445 AGSLDNFDIHVWSVQTGQLLDTLSGHEGPVSCLAF-SQENSVLASASWDKTVRVWSIFGR 503

Query: 320 GAEQVPDDA 328
             +  P D 
Sbjct: 504 SQQVEPFDV 512

>KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} similar
           to uniprot|Q12417 Saccharomyces cerevisiae YPL151C PRP46
           Splicing factor that is found in the Cef1p subcomplex of
           the spliceosome
          Length = 437

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 76/165 (46%), Gaps = 11/165 (6%)

Query: 155 NGY--GLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNG 212
           NG+   +  +PVD     +GS+D+ I +WD+ +   K            +   + H L  
Sbjct: 125 NGWVRCVCVDPVDNEWFATGSNDTTIKVWDLASGKLKLTLAGHVMTVRSIAISQRHPL-- 182

Query: 213 NTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHST-NLFAAAGTDSLIYLYD 271
               S SED  ++  D      V D     +  +T+    H T +L A+AG D+++ L+D
Sbjct: 183 --MFSASEDKLVKCWDLEKNTVVRDYHGHFSGVHTVDV--HPTLDLIASAGRDAVVRLWD 238

Query: 272 SRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL 316
            R    V+ T++GH+  +  ++ +   D  +MS   D  V +WD+
Sbjct: 239 IRTRVPVM-TLAGHKGPINQVKCFPV-DPQIMSGSADSTVRLWDI 281

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 77/160 (48%), Gaps = 24/160 (15%)

Query: 215 FGSVSEDCTLQLHDQ---RVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYD 271
           F + S D T+++ D    ++K ++   + TV    +IA S+    +F+A+  D L+  +D
Sbjct: 141 FATGSNDTTIKVWDLASGKLKLTLAGHVMTV---RSIAISQRHPLMFSAS-EDKLVKCWD 196

Query: 272 SRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDG 331
             +   V+    GH S V  ++ +   D ++ S+G D  V +WD+      +VP      
Sbjct: 197 LEKN-TVVRDYHGHFSGVHTVDVHPTLD-LIASAGRDAVVRLWDIRT----RVP------ 244

Query: 332 SPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVW 371
               VM  AGH+ P+N     P  P +M S   ++ V++W
Sbjct: 245 ----VMTLAGHKGPINQVKCFPVDPQIM-SGSADSTVRLW 279

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 60/121 (49%), Gaps = 17/121 (14%)

Query: 258 FAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLM 317
           FA    D+ I ++D   +G +  T++GH   V ++   + +  ++ S+ ED+ V  WDL 
Sbjct: 141 FATGSNDTTIKVWD-LASGKLKLTLAGHVMTVRSIAI-SQRHPLMFSASEDKLVKCWDLE 198

Query: 318 EIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSKL 377
           +                VV  + GH S V+   ++P +  L+ASA  + +V++W   +++
Sbjct: 199 K--------------NTVVRDYHGHFSGVHTVDVHPTLD-LIASAGRDAVVRLWDIRTRV 243

Query: 378 P 378
           P
Sbjct: 244 P 244

>KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 essential nuclear protein involved in early
           steps of ribosome biogenesis
          Length = 523

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/245 (22%), Positives = 102/245 (41%), Gaps = 35/245 (14%)

Query: 156 GYGLSFNPVDK-GKLLSGSDDSKIALWDITTNSTKPVSTWESCHQ-------DGVNDCKW 207
           GY   ++P+ K G +LSG    ++ L      + +  S W +  Q         + D +W
Sbjct: 288 GYANDWSPIIKTGAMLSGDCSGQVFL------TQRHTSKWITDKQAFTVANNKSIEDLQW 341

Query: 208 HELNGNTFGSVSEDCTLQLHDQRVKD---SVTDKIKTVTAFNTIAFSKHSTNLFAAAGTD 264
                  F S   D  +++ D R K    +++ K    T  N I++S+    L A+   D
Sbjct: 342 SRTESTVFASCGIDGYIRIWDTRSKKHKPAISVKASN-TDVNVISWSEKIGYLLASGDDD 400

Query: 265 SLIYLYDSRR-------TGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL- 316
               ++D R+       T + +     H+  +T++ F    + I+  + ED  V +WDL 
Sbjct: 401 GTWGVWDLRQFTPQNASTASPVAQYQFHKGAITSISFNPLDESIIAVASEDNTVTLWDLS 460

Query: 317 MEIGAEQVPDDADDGS------PEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQV 370
           +E   E++   A +        P+++ +H   +  V D   +  IP  + S   + +  V
Sbjct: 461 VEADDEEIKQQAAETKELQQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NV 517

Query: 371 WKCSS 375
           WK  S
Sbjct: 518 WKTIS 522

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/42 (28%), Positives = 25/42 (59%)

Query: 146 LSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNS 187
           ++   FH+     +SFNP+D+  +   S+D+ + LWD++  +
Sbjct: 422 VAQYQFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEA 463

>ZYRO0D05852g Chr4 (498219..499334) [1116 bp, 371 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 371

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/299 (20%), Positives = 113/299 (37%), Gaps = 45/299 (15%)

Query: 114 RYMPQDSNLIATINGS-------GTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDK 166
           +Y P   N +A  +GS       G +F+ D    G     +S    +D  + +++N   +
Sbjct: 15  QYSPYFDNRLAVASGSNFGLVGNGKLFILDIDPQGRILEFNSF-LTQDCLFDVAWNEAHE 73

Query: 167 GKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQL 226
            ++L    D  + L+D T     P++ +   HQ  V  C W+ +    F S S D  +++
Sbjct: 74  NQVLVAQGDGTLRLFD-TKLKQYPIAIFNE-HQKEVFSCNWNLVGKQNFVSSSWDGAVKI 131

Query: 227 HDQRVKDSVTDKIKTVTAFNTIA----------------------------FSKHSTNLF 258
              + K+S+   +      +T+A                            FS H  NL 
Sbjct: 132 WSPQRKESLLTVVPRPMDVSTMACAGPQVPMSNQKGHADIAKNKNCIYQALFSPHDPNLV 191

Query: 259 AAAGTDSLIYLYDSRR---TGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWD 315
                +S + L+DSR+     N    ++         +F   +   +++ G D  + +WD
Sbjct: 192 MCCSGNSYVTLFDSRQPPTPANQKSFLAHSGLEALTCDFNKYRPHSLVTGGVDNCIRIWD 251

Query: 316 LMEIGAEQVPDDADDGSPEVVM--IHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWK 372
           L  +G         + SP V    I  GH   V   S +P+   ++ S   +    +W+
Sbjct: 252 LRMVGPSAA--SRANASPAVCTNEIVGGHELAVRKVSWSPHHSNILLSTSYDMTCCIWQ 308

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 52/134 (38%), Gaps = 12/134 (8%)

Query: 105 KHEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHED-NGYGLSFNP 163
           K++  + +A + P D NL+   +G+  V L+D  +        S   H         FN 
Sbjct: 173 KNKNCIYQALFSPHDPNLVMCCSGNSYVTLFDSRQPPTPANQKSFLAHSGLEALTCDFNK 232

Query: 164 VDKGKLLSGSDDSKIALWDI---------TTNSTKPVSTWE--SCHQDGVNDCKWHELNG 212
                L++G  D+ I +WD+           N++  V T E    H+  V    W   + 
Sbjct: 233 YRPHSLVTGGVDNCIRIWDLRMVGPSAASRANASPAVCTNEIVGGHELAVRKVSWSPHHS 292

Query: 213 NTFGSVSEDCTLQL 226
           N   S S D T  +
Sbjct: 293 NILLSTSYDMTCCI 306

>Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON}
           YOL138C (REAL)
          Length = 1326

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 53/110 (48%), Gaps = 11/110 (10%)

Query: 121 NLIATINGSGTVFLYDRSKDG--DEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKI 178
           N IA  N S  + +YD +K    D  L++SL  H  +     FN V+   L+SG  DS +
Sbjct: 224 NCIAVCNNSTAISIYDLNKSSSIDNPLITSLYEHTRSINSFDFNMVESNLLISGGQDSCV 283

Query: 179 ALWDITTNSTKPVSTWES-----CHQDGVNDCKWHELNGNTFGSVSEDCT 223
            +WD+ +N  KP S+  S        D + D KW  + G  F + SE  T
Sbjct: 284 KIWDLRSN--KPKSSNRSDISINTASDSIRDVKW--MPGYNFATKSEQGT 329

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 40/80 (50%), Gaps = 8/80 (10%)

Query: 245 FNTIAFSK----HSTNLFAAAGTDSLIYLYDSRRTGNV----LHTMSGHESNVTNLEFYA 296
           F+TIA  K    +  N  A     + I +YD  ++ ++    + ++  H  ++ + +F  
Sbjct: 209 FSTIADVKTGFNNYKNCIAVCNNSTAISIYDLNKSSSIDNPLITSLYEHTRSINSFDFNM 268

Query: 297 AKDGIVMSSGEDRRVIMWDL 316
            +  +++S G+D  V +WDL
Sbjct: 269 VESNLLISGGQDSCVKIWDL 288

>TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {ON}
           Anc_8.672 YPL151C
          Length = 414

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 93/205 (45%), Gaps = 24/205 (11%)

Query: 164 VDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCT 223
           V+     +GS D+ I +WD+ +   K      S H   V D    + +   F S SED  
Sbjct: 113 VENKWFATGSSDTTIKIWDLESGKLKITL---SGHVMPVRDIAISKRSPYLF-SASEDKL 168

Query: 224 LQLHDQRVKDSVTDKIKTVTAFNTIAFSKHST-NLFAAAGTDSLIYLYDSRRTGNVLHTM 282
           ++  D     ++ +    ++  NT+    H T +L A AG DS I L+D R    V+ T+
Sbjct: 169 IKCWDLEKNMAIREYFGHLSGVNTVDV--HPTLDLIATAGRDSTIRLWDIRSRTAVM-TL 225

Query: 283 SGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGH 342
            GH++ VT ++     D  V+S+  D  V +WD++             G     + H  H
Sbjct: 226 IGHKAPVTTVKCIPV-DPQVVSASNDATVKLWDIVA------------GKAIKTLTH--H 270

Query: 343 RSPVNDFSMNPNIPWLMASAEEENI 367
           +  V D ++NP   + +ASA  ++I
Sbjct: 271 KRTVRDIAVNPT-EFSIASACTDDI 294

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 106/228 (46%), Gaps = 25/228 (10%)

Query: 97  NIKIIKKFKHEQEVTRARYMPQDSNLIATINGSGTVFLYD-RSKDGDEGLLSSLGFHEDN 155
           N+ I + F H   V      P   +LIAT     T+ L+D RS+     +++ +G H+  
Sbjct: 177 NMAIREYFGHLSGVNTVDVHPT-LDLIATAGRDSTIRLWDIRSR---TAVMTLIG-HKAP 231

Query: 156 GYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTF 215
              +   PVD  +++S S+D+ + LWDI   + K + T  + H+  V D     +N   F
Sbjct: 232 VTTVKCIPVDP-QVVSASNDATVKLWDIV--AGKAIKT-LTHHKRTVRDI---AVNPTEF 284

Query: 216 GSVSEDCTLQLHDQRVKD-SVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSR- 273
            S++  CT  +   R+ + S+    ++ T     + S +  N+ AA G + ++  +D + 
Sbjct: 285 -SIASACTDDIRSWRLPEGSLLTNFESDTLGIVNSISINQDNIMAACGDNGVLSFFDYKS 343

Query: 274 --RTGNVLHT-MSG---HESNVTNLEFYAAKDGIVMSSGE-DRRVIMW 314
             +   +  T MSG    E  + +  F A   G +  +GE D+ + MW
Sbjct: 344 GHKYQKIATTAMSGSLESEKGILSGTFDAT--GQIFITGETDKSIKMW 389

 Score = 30.4 bits (67), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 20/90 (22%), Positives = 41/90 (45%), Gaps = 15/90 (16%)

Query: 282 MSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAG 341
           ++GH   V  +E    ++    +   D  + +WDL            + G  ++ +  +G
Sbjct: 98  INGHLGWVRCVEVDTVENKWFATGSSDTTIKIWDL------------ESGKLKITL--SG 143

Query: 342 HRSPVNDFSMNPNIPWLMASAEEENIVQVW 371
           H  PV D +++   P+L  SA E+ +++ W
Sbjct: 144 HVMPVRDIAISKRSPYLF-SASEDKLIKCW 172

>TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {ON}
           Anc_4.309 YLR429W
          Length = 588

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 77/178 (43%), Gaps = 24/178 (13%)

Query: 161 FNPVDKGKLLSGSDDSKIALWDITTNST--------------KPVSTWESCHQDGVNDCK 206
           F+P D  KL S +DDSKIA+W+I  + T              KPV    S H+  V    
Sbjct: 89  FDPFDDKKLASSADDSKIAIWEIPEDYTLKSYVDEDGEPKVIKPVKIL-SGHKRKVGHIL 147

Query: 207 WHELNGNTFGSVSEDCTLQLHD-QRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDS 265
           +H +  N   S S D T+++ D +  KD +T  +       +++FS ++ N  A    D 
Sbjct: 148 YHPVAQNVLASSSLDYTVKIWDIENEKDMLT--LTHPDMVTSMSFS-YNGNFLATVARDK 204

Query: 266 LIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSG----EDRRVIMWDLMEI 319
            + ++D R  G ++     H         +      + ++G     DR++ +WD   +
Sbjct: 205 KLRVWDVRE-GKIVSEGPAHTGAKNQRVVWLGNSDRLATTGFSRLSDRQLGVWDAFNL 261

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 57/116 (49%), Gaps = 4/116 (3%)

Query: 259 AAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLME 318
           +  G  ++I + +  +  + +    GH + V + +F    D  + SS +D ++ +W++ E
Sbjct: 54  SGGGAFAVIPVGEVGKCPDQIPLFRGHTAQVLDTDFDPFDDKKLASSADDSKIAIWEIPE 113

Query: 319 IGAEQVPDDADDGSPEV---VMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVW 371
               +   D +DG P+V   V I +GH+  V     +P    ++AS+  +  V++W
Sbjct: 114 DYTLKSYVD-EDGEPKVIKPVKILSGHKRKVGHILYHPVAQNVLASSSLDYTVKIW 168

>Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa]
           {ON} YCR072C - Protein required for cell viability
           [contig 17] FULL
          Length = 514

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 84/181 (46%), Gaps = 14/181 (7%)

Query: 147 SSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCK 206
           S++  H       +F P   G++++GS D+   +WD  TN+  P+ T +  H + V    
Sbjct: 136 SAIAGHGSTILCSAFAPHTSGRMVTGSGDNTARIWDCNTNT--PMYTLKG-HFNWVLCVA 192

Query: 207 WHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIK------TVTAFNTIAFSKHSTN-LFA 259
           W   +G    + S D T++L D    +S  + ++      T   +  +   K       A
Sbjct: 193 WCP-DGELIATGSMDNTIRLWDSNKGESYGEALRGHAKWITSLTWEPMHLVKAGDQPRLA 251

Query: 260 AAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEI 319
           +A  D  I ++D+ R   VL T+SGH ++V+ +++     GI+ S   D+ +  WD+   
Sbjct: 252 SASKDGTIKIWDTTRRVCVL-TLSGHTNSVSCVKW--GGRGILYSGSHDKTIRAWDMAAG 308

Query: 320 G 320
           G
Sbjct: 309 G 309

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 73/318 (22%), Positives = 121/318 (38%), Gaps = 71/318 (22%)

Query: 119 DSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPV------DKGKLLSG 172
           D  LIAT +   T+ L+D +K    G   +L  H      L++ P+      D+ +L S 
Sbjct: 196 DGELIATGSMDNTIRLWDSNKGESYG--EALRGHAKWITSLTWEPMHLVKAGDQPRLASA 253

Query: 173 SDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVK 232
           S D  I +WD T      V T  S H + V+  KW         S S D T++  D    
Sbjct: 254 SKDGTIKIWDTTRRVC--VLT-LSGHTNSVSCVKWG--GRGILYSGSHDKTIRAWDMAAG 308

Query: 233 DSVTDKIKT-----------------VTAFNTI---------AFSKHSTN---------- 256
               + +K+                 V AF+           A +K   N          
Sbjct: 309 GKCINILKSHAHWINHLSLNTDYALRVGAFDHTGEKPSSPEEARAKALKNYEKIAKKNGQ 368

Query: 257 ---LFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDG-IVMSSGEDRRVI 312
              L   A  D  +YL+D  +    +  M+GH+  V ++ F  + DG  ++S+  D  + 
Sbjct: 369 LEELMVTASDDFTMYLWDPLKASKPITRMTGHQKLVNHVAF--SPDGRYIVSASFDNSIK 426

Query: 313 MWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWK 372
           +W            D  +G+   +    GH + V   + + +   L+ S  ++  ++VW 
Sbjct: 427 LW------------DGRNGT--FIATFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVWD 471

Query: 373 CSSKLPRVGGLPKVDDSV 390
             +K   V  LP  +D V
Sbjct: 472 VRTKKLSV-DLPGHNDEV 488

>KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]
           {ON} similar to uniprot|Q12417 Saccharomyces cerevisiae
           YPL151C PRP46 Splicing factor that is found in the Cef1p
           subcomplex of the spliceosome
          Length = 434

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 76/166 (45%), Gaps = 7/166 (4%)

Query: 159 LSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSV 218
           +  +PVD     +GS+D+ I +WD+     K        H   V D    + +   F S 
Sbjct: 128 VCVDPVDNEWFATGSNDTTIKIWDLAAGKLKITLI---GHVMSVRDIAISKRHPYMF-SA 183

Query: 219 SEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNV 278
           SED  ++  D     ++ D    ++  +T+     S ++ A AG D+++ L+D R    +
Sbjct: 184 SEDKLVKCWDLERNTAIRDFHGHLSGVHTVDVHP-SLDIIATAGRDAVVRLWDIRSRSEI 242

Query: 279 LHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQV 324
           +  + GH+S +  ++       I+  SG D  V +WD++   A +V
Sbjct: 243 M-VLPGHKSPINKVKCLPVDPQIISCSG-DATVRLWDIIAGKASKV 286

>YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}
           PWP2Conserved 90S pre-ribosomal component essential for
           proper endonucleolytic cleavage of the 35 S rRNA
           precursor at A0, A1, and A2 sites; contains eight
           WD-repeats; PWP2 deletion leads to defects in cell cycle
           and bud morphogenesis
          Length = 923

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 110/238 (46%), Gaps = 24/238 (10%)

Query: 92  GFTKSNIKI--IKKFKHEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDG-------- 141
           GFT    ++  +  F   Q+++    M Q+     ++N +G    +  SK G        
Sbjct: 278 GFTSGEFRLYDLPDFTLIQQLS----MGQNPVNTVSVNQTGEWLAFGSSKLGQLLVYEWQ 333

Query: 142 -DEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQD 200
            +  +L   G H D+   L+++P D  ++++ S+D KI +WDIT+     ++T+E  H  
Sbjct: 334 SESYILKQQG-HFDSTNSLAYSP-DGSRVVTASEDGKIKVWDITSGFC--LATFEE-HTS 388

Query: 201 GVNDCKWHELNGNTFGSVSEDCTLQLHDQ-RVKDSVTDKIKTVTAFNTIAFSKHSTNLFA 259
            V   ++ +  G    S S D T++  D  R ++  T        FN +A    S  +  
Sbjct: 389 SVTAVQFAK-RGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDP-SGEVVC 446

Query: 260 AAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLM 317
           A   D+      S +TG +L  +SGHE  V+ L F + ++ ++ S+  D+ + +W + 
Sbjct: 447 AGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLSF-SQENSVLASASWDKTIRIWSIF 503

>TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa]
           {ON} Anc_7.356 YLR196W
          Length = 572

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 73/167 (43%), Gaps = 5/167 (2%)

Query: 152 HEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELN 211
           H D    L+ N + +  L S S DS + LWD+ +  T   S  +  H   V+  +WH+ +
Sbjct: 292 HTDAVLSLAHNQLFRAILASTSADSTVKLWDLNS-GTAARSLNQVHHGSRVSSSQWHQTD 350

Query: 212 GNTFGSVSEDCTLQLHDQRVKDSVT-DKIKTVTAFNTIAFSKHSTNLFAAAGTDS-LIYL 269
           G+   +   D  + L D R+ D     K   V +   I  +    +    AGTD+  +Y 
Sbjct: 351 GSILLTAGYDSKIALTDVRISDEKNMSKYWNVMSGEEIETASFINDYTVLAGTDNGNVYS 410

Query: 270 YDSRRT-GNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVI-MW 314
           +D R      L T+  H++ +  L       G++++     +VI +W
Sbjct: 411 FDVRSVESKPLWTLKAHDAGIAGLSVPKNIPGMLLTGAMGEKVIKLW 457

>ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {ON}
           similar to uniprot|P40968 Saccharomyces cerevisiae
           YDR364C CDC40 Pre-mRNA splicing factor important for
           catalytic step II of pre-mRNA splicing and plays a role
           in cell cycle progression required for DNA synthesis
           during mitosis and meiosis has WD repeats
          Length = 455

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 86/206 (41%), Gaps = 21/206 (10%)

Query: 146 LSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDC 205
           + S   H      L F P      LSG +D+ + +WD              C +D +   
Sbjct: 155 IHSFTGHTRGTSALQFLPKTGHLFLSGGNDNILKIWDFYHERI--------CLRDYIGHS 206

Query: 206 K------WHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFA 259
           K      ++E +GN+F S S D  ++L D      V  + +     N + +     N F 
Sbjct: 207 KPIKTVNFNE-DGNSFLSASFDQNVKLWDTET-GQVKSRYRYNATPNDLKYRPGHLNEFV 264

Query: 260 AAGTDSLIYLYDSRRTGN--VLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWD-L 316
              ++S I  YD R   N  ++     H S++ +LEF+     ++ SS ED+ V +W+  
Sbjct: 265 VGLSNSKINHYDDRVAANQGLVQVYDHHLSSILSLEFFPDGSKLI-SSSEDKTVRIWENQ 323

Query: 317 MEIGAEQVPDDADDGSPEVVMIHAGH 342
           + I  +Q+ D A    P  + +H  H
Sbjct: 324 VNIPIKQISDTAQHSMP-FLRVHPEH 348

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 5/59 (8%)

Query: 152 HEDNGYGLS--FNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWH 208
           H+  GYG+   F+P D   ++SG    K+ +WD TT  TK + T E   +  V    WH
Sbjct: 380 HQSAGYGIHIDFSP-DGHYIISGDSRGKLMVWDWTT--TKILKTLEVPGRQPVTQVAWH 435

>KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.325
           YCR057C
          Length = 918

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/235 (23%), Positives = 112/235 (47%), Gaps = 24/235 (10%)

Query: 92  GFTKSNIKI--IKKFKHEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDG-------- 141
           GFT    ++  +  F   Q+++    M Q+     T+N +G    +  SK G        
Sbjct: 274 GFTNGEFRLYELPHFTLIQQLS----MGQNPVNTVTVNSTGEWLAFGSSKLGQLLVYEWQ 329

Query: 142 -DEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQD 200
            +  +L   G H D+   L+++P D  ++++ ++D KI +WD+ +     ++T +  H  
Sbjct: 330 SESYILKQQG-HFDSTNSLTYSP-DGSRVVTAAEDGKIKVWDVVSGFC--LATLDE-HTA 384

Query: 201 GVNDCKWHELNGNTFGSVSEDCTLQLHDQ-RVKDSVTDKIKTVTAFNTIAFSKHSTNLFA 259
            V   ++ +  G    S S D T++  D  R ++           FN++A       + A
Sbjct: 385 AVTQVQFAK-KGQVLFSASLDGTVKAWDLIRYRNFRVFTAAERIQFNSLAVDPSGEVVCA 443

Query: 260 AAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMW 314
            +  +  I+++ S +TG +L ++SGHE  V+ L F + ++G++ S+  D+ + +W
Sbjct: 444 GSMDNFDIHVW-SVQTGQLLDSLSGHEGPVSCLAF-SQENGVLASASWDKTIRIW 496

>NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa]
           {ON} Anc_5.429 YDR364C
          Length = 435

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 88/194 (45%), Gaps = 10/194 (5%)

Query: 148 SLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKW 207
           +L  H +    L   P     +LSG +D+ + +WD   +  + V      H   +    +
Sbjct: 137 TLSGHINGTTSLKLLPKTGHLILSGGNDNVVKIWDFYHD--RKVLRDYKGHSKAIKSLCF 194

Query: 208 HELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLI 267
           ++ +G  F S S D T+++ D     S+  K++     N I F   ++N F    ++S I
Sbjct: 195 ND-DGTKFISSSFDRTVKIWDTE-SGSIQKKLRFGCIPNAIKFRPLNSNEFIVGLSNSKI 252

Query: 268 YLYDSRRTGN--VLHTMSGHESNVTNLEFYAAKDG-IVMSSGEDRRVIMWD-LMEIGAEQ 323
           Y YD R +     +     H S++  LE++   DG   +SS ED+ V +W+  + I  +Q
Sbjct: 253 YHYDDRISAKDGRVQVYDHHMSSILALEYFP--DGSKFISSSEDKTVRLWENQINIPIKQ 310

Query: 324 VPDDADDGSPEVVM 337
           + D A    P + +
Sbjct: 311 ISDTAQHSMPYISI 324

 Score = 33.5 bits (75), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 45/99 (45%), Gaps = 9/99 (9%)

Query: 218 VSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGN 277
           +S  C L    +R K +++  I   T+   +  + H   L  + G D+++ ++D      
Sbjct: 124 LSYKCYLP---KRTKYTLSGHINGTTSLKLLPKTGH---LILSGGNDNVVKIWDFYHDRK 177

Query: 278 VLHTMSGHESNVTNLEFYAAKDGI-VMSSGEDRRVIMWD 315
           VL    GH   + +L F    DG   +SS  DR V +WD
Sbjct: 178 VLRDYKGHSKAIKSLCF--NDDGTKFISSSFDRTVKIWD 214

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/109 (22%), Positives = 45/109 (41%), Gaps = 18/109 (16%)

Query: 280 HTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIH 339
           +T+SGH +  T+L+       +++S G D  V +WD                  +V+  +
Sbjct: 136 YTLSGHINGTTSLKLLPKTGHLILSGGNDNVVKIWDFYH-------------DRKVLRDY 182

Query: 340 AGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSS----KLPRVGGLP 384
            GH   +     N +    ++S+ +   V++W   S    K  R G +P
Sbjct: 183 KGHSKAIKSLCFNDDGTKFISSSFDRT-VKIWDTESGSIQKKLRFGCIP 230

>TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON}
           Anc_8.631 YOR212W
          Length = 433

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 50/83 (60%), Gaps = 7/83 (8%)

Query: 251 SKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRR 310
           +++ TN FA+ G+D  IYL+D  RTG+V  T    +S++  ++F+  KDG  ++SG D  
Sbjct: 245 AENGTNTFASCGSDGYIYLWDV-RTGSVAQTFFVSDSDINAVQFF--KDGNALASGSDDG 301

Query: 311 VI-MWDL---MEIGAEQVPDDAD 329
           +I ++DL    +IG   + D  D
Sbjct: 302 IIRLFDLRSDCQIGTYSLADSLD 324

>Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {ON}
           complement(40550..41851) [1302 nt, 434 aa]
          Length = 433

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 93/206 (45%), Gaps = 24/206 (11%)

Query: 163 PVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDC 222
           PV+     +GS D+ + +WD+ +   K      S H   V D    + +   F S SED 
Sbjct: 131 PVENTWFATGSTDTTVKVWDLVSGHLKLT---LSGHVMPVRDITVSDRHPYLF-SASEDK 186

Query: 223 TLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHST-NLFAAAGTDSLIYLYDSRRTGNVLHT 281
            ++  D     ++ D    ++   ++A   H T +L A AG DS++ L+D R    V+ T
Sbjct: 187 LVKCWDLEKNMAIRDYHGHLSGVYSVAI--HPTLDLIATAGRDSVVRLWDIRSRMEVM-T 243

Query: 282 MSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAG 341
           + GH+  +  +      D  ++S   D  V +WD++             G    V+ H  
Sbjct: 244 LIGHKGPINKVRSLPV-DPQIISCSTDATVHLWDIVA------------GKSAKVLTH-- 288

Query: 342 HRSPVNDFSMNPNIPWLMASAEEENI 367
           H+  V D ++NP+  + +ASA  ++I
Sbjct: 289 HKRSVRDIALNPS-EFSLASACTDDI 313

>Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011W
           (SOF1) - 56 kDa nucleolar snRNP protein that shows
           homology to beta subunits of G-proteins and the splicing
           factor Prp4 [contig 94] FULL
          Length = 473

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 77/174 (44%), Gaps = 13/174 (7%)

Query: 138 SKDGDEGLLSS-----LGFHEDNGY-GLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPV 191
           S+ GDE ++ S       FH ++ + G+  +  +   +  G++   I LWD T   ++P+
Sbjct: 153 SERGDEEVIKSGNGLIKTFHGEHAFLGIDHHRSNSNFVTGGAE---INLWDST--RSRPI 207

Query: 192 STWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFS 251
           +   S   D V+  K+++   + F S   D ++ L+D R  +S T K       N + ++
Sbjct: 208 TNL-SWGADNVSTVKFNQNETDIFASAGSDNSVVLYDLRT-NSPTQKFVQKMRTNALCWN 265

Query: 252 KHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSS 305
                 F  A  D   Y YD R     LH    H S V +++F    D IV  S
Sbjct: 266 PMEAYNFVVANEDHNAYYYDMRNLSRALHVFKDHVSAVMDVDFSPTGDEIVTGS 319

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 85/193 (44%), Gaps = 27/193 (13%)

Query: 145 LLSSLGF-HEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQ--DG 201
            +  LG+ H D  Y ++ N     KL + S D  +  W+++T   + V ++++ +    G
Sbjct: 58  FVGQLGYGHRDGVYTIAKNYHVLNKLATASADGVVKYWNMSTR--EEVCSFKAHYGLIHG 115

Query: 202 VNDCKWH---ELNGNTFGSVSEDCTLQL------------HDQRVKDSVTDKIKTV---T 243
           +     H     N N   S  +D T++L             D+ V  S    IKT     
Sbjct: 116 LCVTPQHLSQNKNENYMLSCGDDRTVKLWSVNTDDFSSERGDEEVIKSGNGLIKTFHGEH 175

Query: 244 AFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVM 303
           AF  I   + ++N F   G +  I L+DS R+  +   +S    NV+ ++F   +  I  
Sbjct: 176 AFLGIDHHRSNSN-FVTGGAE--INLWDSTRSRPIT-NLSWGADNVSTVKFNQNETDIFA 231

Query: 304 SSGEDRRVIMWDL 316
           S+G D  V+++DL
Sbjct: 232 SAGSDNSVVLYDL 244

>CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131c Ribosome assembly protein
          Length = 513

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 62/295 (21%), Positives = 122/295 (41%), Gaps = 53/295 (17%)

Query: 122 LIATINGSGTVFLYDRSKDGDEGLLSSLGFH----------------EDNGYGLSFNPVD 165
           L AT++ +G V+++D          +S G+                    GYGL ++P+ 
Sbjct: 230 LTATMSENGEVYIFDIGAQAK--CFNSPGYQIPKQSKRPVHTIRNHGNVEGYGLDWSPLI 287

Query: 166 K-GKLLSGSDDSKIALWDITTNSTKPVSTWESCHQ-------DGVNDCKWHELNGNTFGS 217
           K G LLSG    +I L      + +  S W +  Q         + D +W +     F +
Sbjct: 288 KSGALLSGDCSGQIYL------TQRHTSKWVTDKQAYSVGNNKSIEDIQWSKTESTVFAT 341

Query: 218 VSEDCTLQLHDQRVKD---SVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRR 274
              D  +++ D R K    +++ K    T  N I++++    L A+   +    ++D R+
Sbjct: 342 AGCDGYIRVWDTRSKKHKPAISVKASN-TDVNVISWNEKIGYLLASGDDNGSWGVWDLRQ 400

Query: 275 -----TGNV--LHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL-MEIGAEQVPD 326
                  N+  +   + H+  +T++ F   ++ IV    ED  V +WDL +E   E++  
Sbjct: 401 FTPDNAANIQPVAQYNFHKGAITSIAFNPLEESIVAVGSEDNTVTLWDLSVEADDEEIKQ 460

Query: 327 DADDGS------PEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSS 375
             ++        P+++ +H   +  + D   +  IP  + S   + +  +WK  S
Sbjct: 461 QTEETKELKEIPPQLLFVH--WQKEIKDVKWHKQIPGCLVSTGTDGL-NIWKTIS 512

>Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/225 (26%), Positives = 85/225 (37%), Gaps = 47/225 (20%)

Query: 139 KDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNST--------KP 190
           KD D+    +L  H    Y  SF+P D   LLSGS+D  + LW + T++          P
Sbjct: 513 KDADDPTCKTLVGHSGTVYATSFSP-DNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHP 571

Query: 191 VSTWE----------------------SC-----------HQDGVNDCKWHELNGNTFGS 217
           V  W+                      SC           H + V DC     NG    +
Sbjct: 572 V--WDVNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDV-DCVSFHPNGCYVFT 628

Query: 218 VSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGN 277
            S D T ++ D    DSV   +        IA S     L +    D +I ++D   TG 
Sbjct: 629 GSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWL-STGSEDGIINIWDIG-TGK 686

Query: 278 VLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAE 322
            L  M GH  N      Y+ +  +++S G D  V +WDL +   E
Sbjct: 687 RLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLKKATTE 731

>Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar to
           Ashbya gossypii ABL044C
          Length = 517

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/239 (23%), Positives = 105/239 (43%), Gaps = 28/239 (11%)

Query: 93  FTKSNIKIIKKFKHEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFH 152
           F+    ++IK F   ++V  +    QD  L+   + +G V +YD     ++ +      H
Sbjct: 66  FSSRTRQVIKTFSRFKDVVYSASFRQDGKLLVAGDATGLVSIYDSYNPRNQLVTFQASSH 125

Query: 153 EDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNG 212
               +   F+P+D   L + +DD  + LWDI +++ +P+        D V    +     
Sbjct: 126 PT--HVTKFHPMDSKSLTTANDDRVVRLWDI-SHAYQPILELTGA-SDYVRSICFLPGTP 181

Query: 213 NTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFN-------TIAFSKHSTNLFAAAGTDS 265
           +   S S D  ++L+D R++ S     + VT  N       TI+ S+  T L +  G+  
Sbjct: 182 HMVVSGSYDGVIRLYDTRMESS-----QPVTTLNHGMPIEDTISMSQ--TQLISCGGSKF 234

Query: 266 LIYLYDSRRTGN-VLHTMSGHESNVTNLEFY-----AAKDGIVMSSGEDRRVIMWDLME 318
            ++      TGN +L++       VT L +      AA D  +++S  D  V ++D ++
Sbjct: 235 KVW----DLTGNKLLYSRGNFAKTVTCLNYVNMPSDAAMDSCLLASSLDGHVKVFDPLD 289

>Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON}
           similar to Ashbya gossypii AGR067W
          Length = 1132

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/160 (20%), Positives = 72/160 (45%), Gaps = 2/160 (1%)

Query: 166 KGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQ 225
           K   +  + + K  +W+++  S+  +      H   + D  +H  +     + S D  + 
Sbjct: 81  KPHWVVSTSNQKALVWNLSRTSSNAIEYELHGHFRAITDINFHPSHPELLATCSIDTYVH 140

Query: 226 LHDQRVKDSVTDKIKTVTA-FNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSG 284
             D R            +A  + + ++  + N+ A++  +S ++++D R+    L+ +SG
Sbjct: 141 AWDMRSPQRPYYSTSDWSAGASQVKWNLQNANVLASSHANS-VFIWDIRKGCTPLYKLSG 199

Query: 285 HESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQV 324
           + S+V N++F   K+  +MSS  D  V  WD  +   E +
Sbjct: 200 NNSSVNNIDFNKVKENEIMSSSNDGTVKFWDYSKSSTEPL 239

 Score = 37.0 bits (84), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 48/84 (57%), Gaps = 3/84 (3%)

Query: 110 VTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKL 169
            ++ ++  Q++N++A+ + + +VF++D  K      L  L  +  +   + FN V + ++
Sbjct: 161 ASQVKWNLQNANVLAS-SHANSVFIWDIRKGCTP--LYKLSGNNSSVNNIDFNKVKENEI 217

Query: 170 LSGSDDSKIALWDITTNSTKPVST 193
           +S S+D  +  WD + +ST+P+ T
Sbjct: 218 MSSSNDGTVKFWDYSKSSTEPLFT 241

>YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON}
           RRB1Essential nuclear protein involved in early steps of
           ribosome biogenesis; physically interacts with the
           ribosomal protein Rpl3p
          Length = 511

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 64/295 (21%), Positives = 119/295 (40%), Gaps = 53/295 (17%)

Query: 122 LIATINGSGTVFLYDRSKDGDEGLLSSLGFH----------------EDNGYGLSFNPVD 165
           L AT++ +G V++Y+ +        S+ G+                    GYGL ++P+ 
Sbjct: 228 LTATMSENGDVYIYNLAPQS--KAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLI 285

Query: 166 K-GKLLSGSDDSKIALWDITTNSTKPVSTWESCHQ-------DGVNDCKWHELNGNTFGS 217
           K G LLSG    +I        + +  S W +  Q         + D +W       F +
Sbjct: 286 KTGALLSGDCSGQIYF------TQRHTSRWVTDKQPFTVSNNKSIEDIQWSRTESTVFAT 339

Query: 218 VSEDCTLQLHDQRVKD---SVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRR 274
              D  +++ D R K    +++ K    T  N I++S     L A+   +    ++D R+
Sbjct: 340 AGCDGYIRIWDTRSKKHKPAISVKASN-TDVNVISWSDKIGYLLASGDDNGTWGVWDLRQ 398

Query: 275 ----TGNVLHTMSG---HESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL-MEIGAEQVPD 326
                 + +  ++    H+  +T++ F    + IV    ED  V +WDL +E   E++  
Sbjct: 399 FTPSNADAVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQ 458

Query: 327 DADDGS------PEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSS 375
            A +        P+++ +H   +  V D   +  IP  + S   + +  VWK  S
Sbjct: 459 QAAETKELQEIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NVWKTIS 510

>TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.276
           YPL247C
          Length = 531

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/192 (21%), Positives = 81/192 (42%), Gaps = 38/192 (19%)

Query: 161 FNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSE 220
           +NP+D   L+S S D+   +WD+ +N+   V T    H   V D ++   +   F S   
Sbjct: 251 WNPIDTNFLISSSIDTTCIVWDLQSNNY--VKTQLIAHDSEVFDVRFLTQSTQLFASCGG 308

Query: 221 DCTLQLHDQR-------VKDSVTD----------------KIKTVTAFNTIAFSKHST-- 255
           D ++++ D R       + +S  +                 + T +   ++  S  S   
Sbjct: 309 DGSVRVFDLRSLAHSTIIYESAANTSMSNLSSGGMVDHPGSLNTSSRVGSVDLSSKSNAL 368

Query: 256 ----------NLFAAAGTDS-LIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMS 304
                     N+ A  G DS  + + D R  G  + T+ GH + +  ++++  K   ++S
Sbjct: 369 LRLEPSPTDPNVIATFGADSNSVLILDMRNPGTPVLTLDGHSAPINQIKWHPTKKNTILS 428

Query: 305 SGEDRRVIMWDL 316
           S +D +V+ W+L
Sbjct: 429 SSDDCQVLYWNL 440

 Score = 37.0 bits (84), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 79/201 (39%), Gaps = 44/201 (21%)

Query: 57  ILGTHTSEEEPNYLKIAAIDLPDEIVPGKEDRERDGFTKSNIKIIKKFKHEQEVTRARYM 116
           I   H +  + N+L  ++ID    +     D + + + K+ +       H+ EV   R++
Sbjct: 246 ITSFHWNPIDTNFLISSSIDTTCIV----WDLQSNNYVKTQL-----IAHDSEVFDVRFL 296

Query: 117 PQDSNLIATINGSGTV------------FLYDRSKDGDEGLLSSLGFHEDNG-------- 156
            Q + L A+  G G+V             +Y+ + +     LSS G  +  G        
Sbjct: 297 TQSTQLFASCGGDGSVRVFDLRSLAHSTIIYESAANTSMSNLSSGGMVDHPGSLNTSSRV 356

Query: 157 ------------YGLSFNPVDKGKLLS-GSDDSKIALWDITTNSTKPVSTWESCHQDGVN 203
                         L  +P D   + + G+D + + + D+  N   PV T +  H   +N
Sbjct: 357 GSVDLSSKSNALLRLEPSPTDPNVIATFGADSNSVLILDMR-NPGTPVLTLDG-HSAPIN 414

Query: 204 DCKWHELNGNTFGSVSEDCTL 224
             KWH    NT  S S+DC +
Sbjct: 415 QIKWHPTKKNTILSSSDDCQV 435

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 26/120 (21%), Positives = 53/120 (44%), Gaps = 6/120 (5%)

Query: 205 CKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTD 264
           CK+++L  NT  + + D    +    V  SV  +   +T+F+   ++   TN   ++  D
Sbjct: 212 CKYNKLRQNTTTNGTNDSRTSVG---VDPSVLGQFPPITSFH---WNPIDTNFLISSSID 265

Query: 265 SLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQV 324
           +   ++D +    V   +  H+S V ++ F      +  S G D  V ++DL  +    +
Sbjct: 266 TTCIVWDLQSNNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRSLAHSTI 325

 Score = 33.5 bits (75), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 39/91 (42%), Gaps = 3/91 (3%)

Query: 94  TKSNIKIIKKFKHEQEVTRARYMPQDSNLIATING-SGTVFLYDRSKDGDEGLLSSLGFH 152
           T S +  +        + R    P D N+IAT    S +V + D    G   L  +L  H
Sbjct: 352 TSSRVGSVDLSSKSNALLRLEPSPTDPNVIATFGADSNSVLILDMRNPGTPVL--TLDGH 409

Query: 153 EDNGYGLSFNPVDKGKLLSGSDDSKIALWDI 183
                 + ++P  K  +LS SDD ++  W++
Sbjct: 410 SAPINQIKWHPTKKNTILSSSDDCQVLYWNL 440

>KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 65/295 (22%), Positives = 120/295 (40%), Gaps = 53/295 (17%)

Query: 122 LIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDN----------------GYGLSFNPVD 165
           L AT++ +G V+++D          SS G+                    GY L ++P+ 
Sbjct: 233 LTATMSENGEVYIFDLGPQSK--AFSSPGYQVPKSSKRPVHTIKNHGNVEGYALDWSPLI 290

Query: 166 K-GKLLSGSDDSKIALWDITTNSTKPVSTWESCHQ-------DGVNDCKWHELNGNTFGS 217
           K G LL+G    +I L      + +  S W +  Q         V D +W       F S
Sbjct: 291 KTGALLTGDCSGQIYL------TQRNTSKWVTDKQPFTVGNNKSVEDIQWSRTEATVFAS 344

Query: 218 VSEDCTLQLHDQRVKD---SVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRR 274
              D  +++ D R K    +++ K    T  N I++++    L A+   +    ++D R+
Sbjct: 345 CGCDGYVRIWDTRSKQHKPALSVKASN-TDVNVISWNEKIGYLLASGDDNGSWGVWDLRQ 403

Query: 275 -----TGNV--LHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL-MEIGAEQVPD 326
                  NV  +     H+  +T++ F   ++ I+  + ED  V +WDL +E   E++  
Sbjct: 404 FTPDNINNVQPVAQYDFHKGAITSISFNPLEESIIAVASEDNTVTLWDLSVEADDEEIKQ 463

Query: 327 DADDGS------PEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSS 375
            A +        P+++ +H   +  V D   +  IP  + S   + +  +WK  S
Sbjct: 464 QAAETKELESIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NIWKTIS 515

>NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}
           Anc_1.534 YKL213C
          Length = 722

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 68/245 (27%), Positives = 103/245 (42%), Gaps = 43/245 (17%)

Query: 91  DGFTKSNIKIIKKFKHEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLG 150
           D    +N K +    +++E     Y  QDS     +NG   V L   S + +E  + +L 
Sbjct: 52  DTILATNEKYLNALTYDEERGIIFYSGQDS----IVNG---VLL---SSNLEEDPIFTLV 101

Query: 151 FHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTK------PVSTWESCHQDGVND 204
            HE N   L  +      L+SGS D    +W     S K        S W +    GV  
Sbjct: 102 GHESNVCSLEMS---NETLVSGSWDKTAKVWQ--NGSLKYDLKGHEASVWCAKSFPGVE- 155

Query: 205 CKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNT-----IAFSKHSTNLFA 259
                   N + SVS D T+++ +  V       IKT+   +T     +  SK + N   
Sbjct: 156 --------NKYVSVSADQTIKIWENNVA------IKTLGGIHTDVIRRVEISKSNPNEII 201

Query: 260 AAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEI 319
               DS I L  +  +G ++    GHES V +++ +   + +V S GEDR VI+WD    
Sbjct: 202 TCSNDSTIKL-SNIESGEIIRNWCGHESFVYSVKQFNLSNDLV-SCGEDRSVIIWDSNNS 259

Query: 320 GAEQV 324
           G +QV
Sbjct: 260 GPKQV 264

>KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} similar
           to uniprot|P40968 Saccharomyces cerevisiae YDR364C CDC40
           Pre-mRNA splicing factor important for catalytic step II
           of pre-mRNA splicing and plays a role in cell cycle
           progression required for DNA synthesis during mitosis
           and meiosis has WD repeats
          Length = 429

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 89/188 (47%), Gaps = 10/188 (5%)

Query: 152 HEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELN 211
           H++    L F P     LLSG +D+ I LWD   +  + + T+E  H   + D  + + N
Sbjct: 134 HKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDF-YHERELLRTYEG-HSMTIKDLNFTD-N 190

Query: 212 GNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYD 271
           G++F S S D  +++ +   K  +  +++  +  N I F     N      ++S I  YD
Sbjct: 191 GHSFASASFDKWVKIWNTE-KGIIDKRLRFNSVPNCITFHPKDKNQLVVGLSNSEIRHYD 249

Query: 272 SRRTGN--VLHTMSGHESNVTNLEFYAAKDG-IVMSSGEDRRVIMWD-LMEIGAEQVPDD 327
            R + N   +     H+ ++  L+++   DG  ++SS ED+ V +W+  + I  +Q+   
Sbjct: 250 LRLSENHGEVQKYDHHQGSILALKYFP--DGKKLISSSEDKTVRIWENRINIPIKQISGT 307

Query: 328 ADDGSPEV 335
           A    P +
Sbjct: 308 AQHSMPWI 315

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 55/264 (20%), Positives = 106/264 (40%), Gaps = 53/264 (20%)

Query: 99  KIIKKFKHEQEVTRARYMPQDSNLIATINGSGTVFLYD--------RSKDGDEGLLSSLG 150
           KI + + H+   T  R++P+  +L+ +      + L+D        R+ +G    +  L 
Sbjct: 127 KIAEYYGHKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYHERELLRTYEGHSMTIKDLN 186

Query: 151 FHEDNGYG--------------------------------LSFNPVDKGKLLSGSDDSKI 178
           F  DNG+                                 ++F+P DK +L+ G  +S+I
Sbjct: 187 F-TDNGHSFASASFDKWVKIWNTEKGIIDKRLRFNSVPNCITFHPKDKNQLVVGLSNSEI 245

Query: 179 ALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDK 238
             +D+  +           HQ  +   K+   +G    S SED T+++ + R+  ++  K
Sbjct: 246 RHYDLRLSENHGEVQKYDHHQGSILALKYFP-DGKKLISSSEDKTVRIWENRI--NIPIK 302

Query: 239 IKTVTAFNTIAF--SKHSTNLFAAAGTDSLIYLYD----SRRTGNVLHTMSGHESNVTNL 292
             + TA +++ +         F     D+ IY Y      +R  N   T  GH +    +
Sbjct: 303 QISGTAQHSMPWIDINPQGQSFCTQSMDNTIYTYSMLPKYKRHPN--KTFKGHNTTGYGI 360

Query: 293 EFYAAKDGIVMSSGEDR-RVIMWD 315
            F  + DG  ++SG+ + +  +WD
Sbjct: 361 HFAFSPDGQYIASGDSKGQTFIWD 384

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 36/88 (40%), Gaps = 14/88 (15%)

Query: 284 GHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHR 343
           GH++  T+L F      +++S G D  + +WD                  E++  + GH 
Sbjct: 133 GHKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYH-------------ERELLRTYEGHS 179

Query: 344 SPVNDFSMNPNIPWLMASAEEENIVQVW 371
             + D +   N     ASA  +  V++W
Sbjct: 180 MTIKDLNFTDN-GHSFASASFDKWVKIW 206

>CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} similar
           to uniprot|P16649 Saccharomyces cerevisiae YCR084c TUP1
           general transcription repressor
          Length = 643

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 95/235 (40%), Gaps = 61/235 (25%)

Query: 152 HEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELN 211
           HE + Y L +      KL+SGS D  I +WD+ T                          
Sbjct: 414 HEQDIYSLDYFQ-SGNKLVSGSGDRTIRIWDLHTG------------------------- 447

Query: 212 GNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYD 271
                     C+L L    ++D VT          T+A S  + N  AA   D  + ++D
Sbjct: 448 ---------QCSLTLS---IEDGVT----------TVAVSPGNGNYVAAGSLDRTVRVWD 485

Query: 272 S------RRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGE-DRRVIMWDLMEI-GAEQ 323
           S       R  +   T  GH+ +V ++ F   +DG  + SG  DR V +W+L  I GA  
Sbjct: 486 SNSGFLVERLDSEGETGVGHKDSVYSVVF--TRDGKNIVSGSLDRSVKLWNLRNINGAST 543

Query: 324 VPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSKLP 378
            P    +G+ E  M + GH+  V   +   N  ++++ +++  ++  W   S +P
Sbjct: 544 SPQPKTEGNCE--MTYIGHKDFVLSVTTTENDQYILSGSKDRGVI-FWDKVSGVP 595

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 34/60 (56%), Gaps = 2/60 (3%)

Query: 257 LFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL 316
             A    D LI ++D  +   ++  + GHE ++ +L+++ + + +V  SG DR + +WDL
Sbjct: 387 FLATGAEDKLIRIWDIAQR-KIVMVLRGHEQDIYSLDYFQSGNKLVSGSG-DRTIRIWDL 444

>CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa]
           {ON} highly similar to uniprot|Q12417 Saccharomyces
           cerevisiae YPL151c PRP46 Pre-mRNA splicing factor PRP46
          Length = 427

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 87/196 (44%), Gaps = 21/196 (10%)

Query: 159 LSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSV 218
           ++ + VD     +GS+D  I +W++ +   K        H   V D      +   F SV
Sbjct: 121 IAMDKVDNEWFATGSNDKTIKIWNLASGKLKVTL---KAHDMTVRDLAISNRHPYMF-SV 176

Query: 219 SEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNV 278
           SED T++  D     ++ +    ++  +T+     + ++   AG DS++ ++D R    V
Sbjct: 177 SEDKTVKCWDLEKNTAIRNYHGHLSGVHTVDIHP-TVDVVVTAGRDSVVKVWDIRTRLPV 235

Query: 279 LHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMI 338
           + T+ GH+  +T +      D  V+SS  D  + +WDL+             G    V+ 
Sbjct: 236 M-TLPGHKGPITKVRCLPV-DPQVISSSVDASIRLWDLVA------------GKSMKVLT 281

Query: 339 HAGHRSPVNDFSMNPN 354
           H  H+  V D S++P+
Sbjct: 282 H--HQRTVRDISVHPS 295

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 62/137 (45%), Gaps = 18/137 (13%)

Query: 248 IAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGE 307
           IA  K     FA    D  I +++   +G +  T+  H+  V +L   + +   + S  E
Sbjct: 121 IAMDKVDNEWFATGSNDKTIKIWN-LASGKLKVTLKAHDMTVRDLAI-SNRHPYMFSVSE 178

Query: 308 DRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENI 367
           D+ V  WDL +  A              +  + GH S V+   ++P +  ++ +A  +++
Sbjct: 179 DKTVKCWDLEKNTA--------------IRNYHGHLSGVHTVDIHPTVD-VVVTAGRDSV 223

Query: 368 VQVWKCSSKLPRVGGLP 384
           V+VW   ++LP V  LP
Sbjct: 224 VKVWDIRTRLP-VMTLP 239

>Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429W
           (REAL)
          Length = 645

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 75/178 (42%), Gaps = 24/178 (13%)

Query: 161 FNPVDKGKLLSGSDDSKIALWDITTN--------------STKPVSTWESCHQDGVNDCK 206
           F+P D  ++ SGSDDSKI +W+I  N                KPV  + + H   V    
Sbjct: 89  FDPFDDHRIASGSDDSKIGIWNIPENYKFHDHADEDGEPIDIKPVK-FLTGHARKVGHIL 147

Query: 207 WHELNGNTFGSVSEDCTLQLHDQRV-KDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDS 265
           +H +  N   S S D T++L D    KD +T  +K      +++FS +  N  A    D 
Sbjct: 148 YHPVAKNVLASSSGDNTVKLWDVETGKDMIT--LKHPNMVTSMSFS-YDGNHLATVARDK 204

Query: 266 LIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSG----EDRRVIMWDLMEI 319
            + +++  R G ++     H         +      + ++G     DR++ +WD   +
Sbjct: 205 KLRVWNI-RDGRIVSEGPAHTGAKNQRVVWLGNSDRLATTGFSKLSDRQIGIWDAFNL 261

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 54/117 (46%), Gaps = 6/117 (5%)

Query: 259 AAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLME 318
           +  G  ++I + +  +  + +    GH + V + +F    D  + S  +D ++ +W++ E
Sbjct: 54  SGGGAFAVIPIEEVGKAPDQVPLFRGHTAQVLDTDFDPFDDHRIASGSDDSKIGIWNIPE 113

Query: 319 IGAEQVPDDAD-DGSP---EVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVW 371
               +  D AD DG P   + V    GH   V     +P    ++AS+  +N V++W
Sbjct: 114 --NYKFHDHADEDGEPIDIKPVKFLTGHARKVGHILYHPVAKNVLASSSGDNTVKLW 168

>KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {ON}
           Anc_6.276 YPL247C
          Length = 504

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 73/170 (42%), Gaps = 16/170 (9%)

Query: 161 FNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSE 220
           +N VD   L+S S D+   +WD+   S   V T    H   V D ++   + + F S   
Sbjct: 254 WNTVDTNLLVSSSIDTTCIVWDL--QSPNYVKTQLIAHDSEVYDVRFLSQSTHLFASCGG 311

Query: 221 DCTLQLHDQRV-------------KDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSL- 266
           D ++++ D R              + +V D      A   +  S    N+ A    DS  
Sbjct: 312 DGSVRVFDLRSLAHSTIVYEPPAGEGTVNDVTAQNNALLRLEPSLMDPNIIATLVADSKD 371

Query: 267 IYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL 316
           I + D R   +   T+ GH S V  ++++  K  +++S  +D +V+ WDL
Sbjct: 372 ILILDMRNPESPALTLKGHSSLVNQIKWHPTKRNVLLSCSDDCQVLYWDL 421

 Score = 34.3 bits (77), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 24/120 (20%), Positives = 51/120 (42%), Gaps = 3/120 (2%)

Query: 205 CKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTD 264
           CK+ +   NT G+      L      +K++ T  +  +    +  ++   TNL  ++  D
Sbjct: 212 CKYKKQRNNTAGN---KVNLAAAGGCLKNTTTAILGELPPVTSFDWNTVDTNLLVSSSID 268

Query: 265 SLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQV 324
           +   ++D +    V   +  H+S V ++ F +    +  S G D  V ++DL  +    +
Sbjct: 269 TTCIVWDLQSPNYVKTQLIAHDSEVYDVRFLSQSTHLFASCGGDGSVRVFDLRSLAHSTI 328

>KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {ON}
           Anc_3.259 YDR030C
          Length = 369

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/219 (22%), Positives = 85/219 (38%), Gaps = 30/219 (13%)

Query: 165 DKGKLLSGSDDSKIALWD---------ITTNSTKPVSTWESCHQDGVNDCKWHELNGNTF 215
           DK   L+G+++  ++LW+         I  N     ST    H  G+ND KW+ ++   F
Sbjct: 60  DKTSFLAGNNNGTVSLWNLDNTLSTSHILNNKLARTSTKPHSHLFGINDMKWYSIDDGMF 119

Query: 216 GSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRT 275
            +   D  ++L D     +V D       FN+  F   + N F     D         R 
Sbjct: 120 FTCGNDKFVKLWDTNKFINVQD-----LEFNSNLFQMDTANQFILVTLDDYYPRLIDLRN 174

Query: 276 GNVLHTMSGHESNVTNL--EFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSP 333
            N+  T+ G   N   L  +    +D ++ SS  D  + +WD+  +    + +       
Sbjct: 175 MNLGITIFGKHLNSKTLCCKINPVRDNLIASSDNDGMIRIWDV-RMNYRSIEE------- 226

Query: 334 EVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWK 372
                   H   +ND   N N   L+++  +  I Q+W+
Sbjct: 227 -----WKAHSRSINDMVWNDNGTKLISTGVDGKI-QIWR 259

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 3/65 (4%)

Query: 162 NPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSED 221
           NPV    + S  +D  I +WD+  N  + +  W++ H   +ND  W++ NG    S   D
Sbjct: 196 NPVRDNLIASSDNDGMIRIWDVRMNY-RSIEEWKA-HSRSINDMVWND-NGTKLISTGVD 252

Query: 222 CTLQL 226
             +Q+
Sbjct: 253 GKIQI 257

>KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 477

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 73/171 (42%), Gaps = 10/171 (5%)

Query: 136 DRSKDGDEGLLSSLGFHEDNGY-GLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTW 194
           D  +   +GL+ +  FH D  + G+  +      + +G++   I LWD + +      +W
Sbjct: 157 DEEQSSTDGLIKT--FHGDYAFLGIDHHRSKPYFVTAGAE---INLWDSSRSRPTANLSW 211

Query: 195 ESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHS 254
            +   D V+  K+++   + F S   D ++ L+D R  +S T K       N + ++   
Sbjct: 212 GA---DNVSTVKFNQNETDIFASAGSDNSVVLYDLRT-NSPTQKFTQRMRTNALCWNPME 267

Query: 255 TNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSS 305
              F  A  D   Y YD R     LH    H S V +++F    D IV  S
Sbjct: 268 AYNFVVASEDHNAYYYDMRNLSRALHVFKDHVSAVMDVDFSPTGDEIVTGS 318

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 83/191 (43%), Gaps = 24/191 (12%)

Query: 145 LLSSLGF-HEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQ--DG 201
            +  LG+ H D  Y ++ N     KL S S D  +  W+++T   + + ++++ +    G
Sbjct: 58  FIGQLGYGHRDGVYTIAKNYHALNKLASASADGVVKYWNMSTR--EEICSFKAHYGLVHG 115

Query: 202 VNDCKWH---ELNGNTFGSVSEDCTLQLHDQRVKDSVTDK-----------IKTVTA-FN 246
           +     H     N N   S  +D T++L     +D  + K           IKT    + 
Sbjct: 116 LCVTPQHLSANKNENYMLSCGDDKTVKLWSVNTEDFSSSKNDEEQSSTDGLIKTFHGDYA 175

Query: 247 TIAFSKH-STNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSS 305
            +    H S   F  AG +  I L+DS R+    + +S    NV+ ++F   +  I  S+
Sbjct: 176 FLGIDHHRSKPYFVTAGAE--INLWDSSRSRPTAN-LSWGADNVSTVKFNQNETDIFASA 232

Query: 306 GEDRRVIMWDL 316
           G D  V+++DL
Sbjct: 233 GSDNSVVLYDL 243

>KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON}
           similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1133

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 69/151 (45%), Gaps = 2/151 (1%)

Query: 173 SDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRV- 231
           + + K  +W+++ +S+K V      H   + D  +H L      + S D      D R  
Sbjct: 88  TSNQKAIVWNLSRSSSKAVEHVLHGHFRAITDINFHPLQPEILATSSIDTYALAWDMRSP 147

Query: 232 KDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTN 291
           K          +    + ++  ++N+ A + ++ ++Y++D R+  + L  + GH  +V +
Sbjct: 148 KKPYFRTSNWRSGAAQVKWNHKNSNVLATSHSN-IVYVWDVRKGTSPLSVLEGHSGSVNS 206

Query: 292 LEFYAAKDGIVMSSGEDRRVIMWDLMEIGAE 322
           ++F    +  +MSSG D  V  WD  ++  E
Sbjct: 207 IDFNPFNETEIMSSGNDGTVKFWDYNKVEDE 237

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 39/73 (53%), Gaps = 3/73 (4%)

Query: 110 VTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKL 169
             + ++  ++SN++AT + S  V+++D  K      LS L  H  +   + FNP ++ ++
Sbjct: 161 AAQVKWNHKNSNVLAT-SHSNIVYVWDVRKGTSP--LSVLEGHSGSVNSIDFNPFNETEI 217

Query: 170 LSGSDDSKIALWD 182
           +S  +D  +  WD
Sbjct: 218 MSSGNDGTVKFWD 230

>Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa]
           {ON} YCR057C (PWP2) - regulatory protein [contig 16]
           FULL
          Length = 913

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 97/212 (45%), Gaps = 18/212 (8%)

Query: 116 MPQDSNLIATINGSGTVFLYDRSKDG---------DEGLLSSLGFHEDNGYGLSFNPVDK 166
           M Q++     +N SG    +  SK G         +  +L   G H D    ++++P D 
Sbjct: 296 MGQNAVNTVCVNDSGEWLAFGSSKLGQLLVYEWQSESYILKQQG-HFDATNAVTYSP-DG 353

Query: 167 GKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQL 226
            ++++ S+D KI +WD+ +     + T++  H   V+   + +  G    S S D T++ 
Sbjct: 354 SRVVTASEDGKIKIWDVVSGFC--LVTFQE-HTAAVSALAFAK-RGQVLFSASLDGTVRA 409

Query: 227 HDQ-RVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGH 285
            D  R ++  T        FN +A +  S  +  A   DS      S +TG ++ T+ GH
Sbjct: 410 WDLVRYRNFRTFTAAERIQFNCLA-ADPSGEVVCAGSVDSFAVHVWSVQTGQLVETLDGH 468

Query: 286 ESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLM 317
           E  V+ L F + ++ ++ S+  D+ + +W + 
Sbjct: 469 EGPVSCLSF-SQENSVLASASWDKTIRIWSIF 499

>Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON}
           (125940..128657) [2718 nt, 906 aa]
          Length = 905

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 86/175 (49%), Gaps = 8/175 (4%)

Query: 152 HEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELN 211
           H D+  GL+++P D  ++++ ++D KI +WD+ +     ++T+ S H   V   ++ +  
Sbjct: 337 HFDSLNGLTYSP-DGARVVTAANDGKIKVWDVVSGFC--LATF-SEHTSSVTAVQFAK-R 391

Query: 212 GNTFGSVSEDCTLQLHDQ-RVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLY 270
           G    S S D T++  D  R ++  T        FN +A    S  +  A  +DS     
Sbjct: 392 GQVLFSSSLDGTVRAWDLIRFRNFRTFTSTQRIPFNCLAVDP-SGEVVCAGSSDSFEIHV 450

Query: 271 DSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVP 325
            S +TG +L ++ GHE  V+ L F + ++ ++ S+  D+ + +W +     +  P
Sbjct: 451 WSVQTGQLLDSLDGHEGPVSCLAF-SQENSVLASASWDKTIRIWSIFSRSQQVEP 504

>KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {ON}
           highly similar to uniprot|P25636 Saccharomyces
           cerevisiae YCR057C PWP2 part of small (ribosomal)
           subunit (SSU) processosome (contains U3 snoRNA) Eight
           WD-repeats with homology with G protein beta subunits
           flanked by nonhomologous N-terminal and C-terminal
           extensions regulatory protein
          Length = 915

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 97/212 (45%), Gaps = 18/212 (8%)

Query: 116 MPQDSNLIATINGSGTVFLYDRSKDG---------DEGLLSSLGFHEDNGYGLSFNPVDK 166
           M Q++    ++N +G    +  SK G         +  +L   G H D    ++++P D 
Sbjct: 296 MGQNAVNAVSVNNTGEWLAFGSSKLGQLLVYEWQSESYILKQQG-HFDATNAVTYSP-DG 353

Query: 167 GKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQL 226
            ++++ S+D KI +WD+ +     + T++  H   V    + +  G    S S D T++ 
Sbjct: 354 SRVVTASEDGKIKIWDVVSGFC--LVTFQE-HTSAVTGLAFAK-KGQVLFSASLDGTVRA 409

Query: 227 HDQ-RVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGH 285
            D  R ++  T        FN +A +  S  +  A   DS      S +TG ++ T+ GH
Sbjct: 410 WDLVRYRNFRTFTAAERIQFNCLA-ADPSGEVVCAGSVDSFAIHVWSVQTGQLVETLDGH 468

Query: 286 ESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLM 317
           E  V+ L F + ++ ++ S+  D+ + +W + 
Sbjct: 469 EGPVSCLSF-SRENSVLASASWDKTIRVWSIF 499

>KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} similar
           to uniprot|P40968 Saccharomyces cerevisiae YDR364C CDC40
           Pre-mRNA splicing factor important for catalytic step II
           of pre-mRNA splicing and plays a role in cell cycle
           progression required for DNA synthesis during mitosis
           and meiosis has WD repeats
          Length = 462

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 53/221 (23%), Positives = 93/221 (42%), Gaps = 19/221 (8%)

Query: 145 LLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESC-HQDGVN 203
           ++ S   H +    +   P      LSG +D+K+ LWD+     K     + C H   V 
Sbjct: 161 MIHSYRGHHNGTTTIKMLPKSGHLFLSGGNDNKVKLWDVY---HKRELLRDYCGHSKAVR 217

Query: 204 DCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGT 263
           D  +   +G +F SVS D  +++ +    D +  + K     N   FS  ++N      +
Sbjct: 218 DVSF-SGSGTSFLSVSYDQHMKIWNTETGD-IEHRYKFPAVPNCAEFSPANSNELIVGLS 275

Query: 264 DSLIYLYDSR--RTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWD-LMEIG 320
           +S +  YD R      ++     H S++  L+++      + SS ED+ + +WD  + I 
Sbjct: 276 NSEVRHYDLRVAHKDGLVQVYDHHLSSIIALKYFPDGSKFI-SSSEDKSMRIWDNQVNIP 334

Query: 321 AEQVPDDADDGSPEVVMIHAGHR--------SPVNDFSMNP 353
            +Q+ D A    P  + IH  H         + +  FSM P
Sbjct: 335 IKQISDTAQYSMP-FIDIHPEHHYFATQSMDNAIYAFSMKP 374

>KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1101

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 67/151 (44%), Gaps = 2/151 (1%)

Query: 166 KGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQ 225
           K   +  + + K  +W+++ +S+  V      H   + D  +H  N     + S D  + 
Sbjct: 81  KPSWVVSTSNQKALVWNLSRSSSNAVEHVLHGHSRAITDINFHPTNPEILATCSIDAYVH 140

Query: 226 LHDQRVKDSVTDKIKTVTA-FNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSG 284
             D R            +A    + ++  + N+ A+A ++  I+++D R+    LH + G
Sbjct: 141 AWDMRSSRRAFYSASVWSAGAAQVKWNFKNPNVMASAHSND-IFIWDLRKGCMPLHILKG 199

Query: 285 HESNVTNLEFYAAKDGIVMSSGEDRRVIMWD 315
           H ++V +++F    +  +MSS  D  V  WD
Sbjct: 200 HANSVNSIDFSRFNETEIMSSSNDGTVKFWD 230

 Score = 30.8 bits (68), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 18/84 (21%), Positives = 44/84 (52%), Gaps = 3/84 (3%)

Query: 110 VTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKL 169
             + ++  ++ N++A+ + S  +F++D  K      L  L  H ++   + F+  ++ ++
Sbjct: 161 AAQVKWNFKNPNVMASAH-SNDIFIWDLRKGCMP--LHILKGHANSVNSIDFSRFNETEI 217

Query: 170 LSGSDDSKIALWDITTNSTKPVST 193
           +S S+D  +  WD + N  +P+ T
Sbjct: 218 MSSSNDGTVKFWDYSVNDKEPLRT 241

>Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 520
           aa] {ON} ANNOTATED BY YGOB -
          Length = 520

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 62/293 (21%), Positives = 121/293 (41%), Gaps = 49/293 (16%)

Query: 122 LIATINGSGTVFLYDRSKD-------------GDEGLLSSLGFHED-NGYGLSFNPVDK- 166
           L AT++ +G V+++D +                 +  + ++  H +  GY L ++P+ K 
Sbjct: 237 LTATMSENGEVYIFDLASQVKAFKTPGYQIPKAAKKPIHTIKSHGNVEGYALDWSPLIKT 296

Query: 167 GKLLSGSDDSKIALWDITTNSTKPVSTWES-------CHQDGVNDCKWHELNGNTFGSVS 219
           G LL+G    ++ L      + +  S W S        +   V D +W       F S  
Sbjct: 297 GALLTGDCSGQVYL------TQRHTSKWISDKEPFTVANNQSVEDIQWSRTESTVFASCG 350

Query: 220 EDCTLQLHDQRVKD---SVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRR-- 274
            D  +++ D R K    +++ K    T  N I++S+    L A+   +    ++D R+  
Sbjct: 351 CDGYIRVWDTRSKKHKPAISVKASN-TDVNVISWSEKIGYLLASGDDNGTWGVWDLRQFS 409

Query: 275 -----TGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL-MEIGAEQVPDDA 328
                  + +     H+  +T++ F    + IV  + ED  V +WDL +E   E++   A
Sbjct: 410 PSNSNNTSPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQA 469

Query: 329 DDGS------PEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSS 375
            +        P+++ +H   +  V D   +  IP  + S   + +  +WK  S
Sbjct: 470 AETKELQQIPPQLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDGL-NIWKTIS 519

>KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1321

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 85/216 (39%), Gaps = 43/216 (19%)

Query: 121 NLIATINGSGTVFLYD--RSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKI 178
           N +A    S TV L+D  R+   D  L+SSL  H  +     FN +    L+SG  D  +
Sbjct: 205 NYVAVCTNSTTVSLFDINRANQTDSALVSSLAEHTRSVNSFDFNMMQTNLLISGGQDGCV 264

Query: 179 ALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDK 238
            +WDI TN+   +          VN C    +N  TFGS+ +                  
Sbjct: 265 KIWDIRTNNPTKI----------VNTCDV-RIN-TTFGSIRD------------------ 294

Query: 239 IKTVTAFNTIAFSKHSTNL-------FAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTN 291
           IK +  +N     ++ T+L       FA+      +  +D R+       ++ H      
Sbjct: 295 IKWMPGYNFSGNDRNYTDLRSHGGYKFASIHDSGALLKFDMRQPNQPEKRINAHTGPGLC 354

Query: 292 LEFYAAKDGIVMSSGEDRRVIMW---DLMEIGAEQV 324
           L ++  +D I  S G D +  +W   D ME  A  +
Sbjct: 355 LNWHPHQDYIA-SGGRDGKCCLWYFGDRMEQSATNL 389

>TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 58/215 (26%), Positives = 91/215 (42%), Gaps = 19/215 (8%)

Query: 106 HEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVD 165
           HE+ V   R+ P     IA+ +   T  L+D   + +  LL   G H    + L+F   D
Sbjct: 264 HERRVAGCRFHPF-GRYIASASFDNTWRLWD--AETNHELLLQEG-HGKEVFCLAFQS-D 318

Query: 166 KGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQ 225
              L S   D    +WDI + +   V    S H   +    W    G    + S D T+ 
Sbjct: 319 GSLLCSAGLDCTGMIWDIRSGNCAMVL---SGHTKPIYSVDWSP-RGFEVATASGDGTVN 374

Query: 226 LHDQRVKDSVTDKIKTVTAFNTIA----FSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHT 281
           + D R     T++ + + A N+I     F KH+     + G D  I +Y S  + N +  
Sbjct: 375 IWDIRK----TNQPQVLLAHNSIVSGIRFEKHNGKFLMSCGYDKNINVY-SGDSWNKITI 429

Query: 282 MSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL 316
           + GH   +  L+     DG V+S+G DR V  W++
Sbjct: 430 LKGHTDKILALDL-GTHDGSVVSAGWDRSVKSWNV 463

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 55/245 (22%), Positives = 102/245 (41%), Gaps = 35/245 (14%)

Query: 156 GYGLSFNPVDK-GKLLSGSDDSKIALWDITTNSTKPVSTWESCHQ-------DGVNDCKW 207
           GY L ++P+ K G LL+G    +I        + +  S W +  Q         + D +W
Sbjct: 276 GYALDWSPLTKTGALLTGDCSGQIYF------TQRHTSKWITDKQPFTVANNQSIEDIQW 329

Query: 208 HELNGNTFGSVSEDCTLQLHDQRVKD---SVTDKIKTVTAFNTIAFSKHSTNLFAAAGTD 264
                  F S   D  +++ D R K    +++ K    T  N I++S+    L A+   +
Sbjct: 330 SRTESTVFASAGCDGYIRIWDTRSKKHKPAISVKASN-TDVNVISWSEKLGYLLASGDDN 388

Query: 265 SLIYLYDSRR-----TGNV--LHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL- 316
               ++D R+      G+V  +     H+  +T++ F    + I+    ED  V +WDL 
Sbjct: 389 GTWGVWDLRQFSPENAGSVQPVAQYDFHKGAITSISFNPLDESIIAVGSEDNTVTLWDLS 448

Query: 317 MEIGAEQVPDDADDGS------PEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQV 370
           +E   E++   A +        P+++ +H   +  V D   +  IP  + S   + +  +
Sbjct: 449 VEADDEEIKQQAAETKELQQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NI 505

Query: 371 WKCSS 375
           WK  S
Sbjct: 506 WKTIS 510

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 39/71 (54%), Gaps = 5/71 (7%)

Query: 122 LIATINGSGTVFLYDRSKDGDEGL-----LSSLGFHEDNGYGLSFNPVDKGKLLSGSDDS 176
           L+A+ + +GT  ++D  +   E       ++   FH+     +SFNP+D+  +  GS+D+
Sbjct: 381 LLASGDDNGTWGVWDLRQFSPENAGSVQPVAQYDFHKGAITSISFNPLDESIIAVGSEDN 440

Query: 177 KIALWDITTNS 187
            + LWD++  +
Sbjct: 441 TVTLWDLSVEA 451

>AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL247C
          Length = 438

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/213 (21%), Positives = 85/213 (39%), Gaps = 51/213 (23%)

Query: 161 FNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSE 220
           +N +D   +L  S D+   +WD+   ++  V T    H   V D K+   + N F S   
Sbjct: 172 WNALDTNLILFSSIDTTCTVWDL--QASNYVKTQLIAHDSEVFDAKFLTQSSNLFASCGG 229

Query: 221 DCTLQLHDQRV----------KDSVTDKIKTVTAFNTIAF-------------------- 250
           D ++++ D R           +  V  +  + T  +T+A                     
Sbjct: 230 DGSVRVFDLRCLAHSTIIYEPQQQVQGQTPSQTQVHTLAAHEQDGQLQKNSQSSALSSSA 289

Query: 251 -----------------SKHSTNLFAAAGTDS-LIYLYDSRRTGNVLHTMSGHESNVTNL 292
                            S    N+ A    DS ++ + D R  G+ +  + GH + V  L
Sbjct: 290 SSSLGALDNCALLRLEPSPFDPNILATIQQDSNVVIILDMRYPGSPMLLLEGHAAPVNQL 349

Query: 293 EFYAAKDGIVMSSGEDRRVIMWDLME-IGAEQV 324
           +++ +K  ++ + G+D +++ WDL+E + A QV
Sbjct: 350 KWHPSKPNVLATCGDDCQILYWDLLELLSASQV 382

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 37/177 (20%), Positives = 60/177 (33%), Gaps = 45/177 (25%)

Query: 96  SNIKIIKKFKHEQEVTRARYMPQDSNLIATINGSGTVFLYD-----------------RS 138
           SN    +   H+ EV  A+++ Q SNL A+  G G+V ++D                 + 
Sbjct: 197 SNYVKTQLIAHDSEVFDAKFLTQSSNLFASCGGDGSVRVFDLRCLAHSTIIYEPQQQVQG 256

Query: 139 KDGDEGLLSSLGFHEDNG---------------------------YGLSFNPVDKGKLLS 171
           +   +  + +L  HE +G                             L  +P D   L +
Sbjct: 257 QTPSQTQVHTLAAHEQDGQLQKNSQSSALSSSASSSLGALDNCALLRLEPSPFDPNILAT 316

Query: 172 GSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHD 228
              DS + +         P+   E  H   VN  KWH    N   +  +DC +   D
Sbjct: 317 IQQDSNVVIILDMRYPGSPMLLLEG-HAAPVNQLKWHPSKPNVLATCGDDCQILYWD 372

>AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL011W
           (SOF1)
          Length = 479

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 69/149 (46%), Gaps = 5/149 (3%)

Query: 176 SKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSV 235
           ++I LWD+  N  KP+S   S   D V+  ++++   +   S   D ++ L+D R  +S 
Sbjct: 196 AQIQLWDV--NRKKPLSNL-SWGVDNVSFVRFNQNEEDILASTGSDNSIVLYDLRT-NSP 251

Query: 236 TDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFY 295
           T K+      N + ++      FA A  D   Y YD R     LH    H S V +++F 
Sbjct: 252 TQKVVQRMRTNALCWNPMEPFNFAIANEDHNAYYYDMRNMSRALHVFKDHVSAVMDVDFS 311

Query: 296 AAKDGIVMSSGEDRRVIMWDLMEIGAEQV 324
              + IV  S  D+ + +++L    + +V
Sbjct: 312 PTGEEIVTGS-YDKTIRIFNLKHGHSREV 339

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 61/251 (24%), Positives = 94/251 (37%), Gaps = 56/251 (22%)

Query: 145 LLSSLGF-HEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNS---------------- 187
            +  LG+ H D  Y L+ N     KL SGS D  +  W++ T                  
Sbjct: 58  FVGQLGYGHRDGCYVLAKNYNVLNKLASGSADGVVKYWNMATREELCSFRAHYGLVTGLC 117

Query: 188 --------TKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDK- 238
                   TK  S   SC  D     K   +N + F S+ +D  +      V D+     
Sbjct: 118 VTPTHLSPTKKDSFMLSCGDDKT--IKLWSVNSDDFNSIKDDTKI------VSDTGDGAL 169

Query: 239 IKTVT---AFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFY 295
           +KT     AF +I   + + N F   G    I L+D  R    L  +S    NV+ + F 
Sbjct: 170 LKTFYGEHAFQSIDHHRRNPN-FVTGGAQ--IQLWDVNRK-KPLSNLSWGVDNVSFVRFN 225

Query: 296 AAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNI 355
             ++ I+ S+G D  ++++DL               SP   ++    R   N    NP  
Sbjct: 226 QNEEDILASTGSDNSIVLYDLRT------------NSPTQKVV---QRMRTNALCWNPME 270

Query: 356 PWLMASAEEEN 366
           P+  A A E++
Sbjct: 271 PFNFAIANEDH 281

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 47/105 (44%), Gaps = 7/105 (6%)

Query: 126 INGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITT 185
           + G   + L+D ++   +  LS+L +  DN   + FN  ++  L S   D+ I L+D+ T
Sbjct: 192 VTGGAQIQLWDVNR---KKPLSNLSWGVDNVSFVRFNQNEEDILASTGSDNSIVLYDLRT 248

Query: 186 NSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQR 230
           NS     T +   +   N   W+ +    F   +ED     +D R
Sbjct: 249 NS----PTQKVVQRMRTNALCWNPMEPFNFAIANEDHNAYYYDMR 289

>SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247C Hypothetical ORF
          Length = 415

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 55/246 (22%), Positives = 97/246 (39%), Gaps = 41/246 (16%)

Query: 110 VTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLS--------- 160
           VTR +++P+    +AT + S  ++    S      L       + NG   S         
Sbjct: 111 VTRCQWLPKGGGKLATCSDSLRIWSVGDSLQEQLNLSLCKYSKQSNGSTASAALGSLPPV 170

Query: 161 ----FNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFG 216
               +N VD   ++S S D+   +WD+   S+  V T    H   V D K+   +   F 
Sbjct: 171 TSFDWNSVDTNLIISSSIDTTCTVWDL--QSSNYVKTQLIAHDSEVYDVKFLTNSTQLFA 228

Query: 217 SVSEDCTLQLHDQR-------------------VKDSVTDKI------KTVTAFNTIAFS 251
           S   D ++++ D R                   VK S    +         TA   +  S
Sbjct: 229 SCGGDGSVRVFDLRCLAHSTIIYEPLAGLTSGTVKSSGEGNVGGNEDGTNHTALLRLEPS 288

Query: 252 KHSTNLFAAAGTDS-LIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRR 310
               N+ A    DS  + + D R  G+ + T+ GH S V  + ++  +  ++++ G+D +
Sbjct: 289 PFDPNVVATFTQDSNAVLILDMRYPGSPILTLEGHSSAVNQMRWHPTQRNVLLTCGDDCQ 348

Query: 311 VIMWDL 316
           V+ WD+
Sbjct: 349 VLYWDI 354

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 35/158 (22%), Positives = 57/158 (36%), Gaps = 29/158 (18%)

Query: 96  SNIKIIKKFKHEQEVTRARYMPQDSNLIATINGSGTVFLYDRS----------------- 138
           SN    +   H+ EV   +++   + L A+  G G+V ++D                   
Sbjct: 200 SNYVKTQLIAHDSEVYDVKFLTNSTQLFASCGGDGSVRVFDLRCLAHSTIIYEPLAGLTS 259

Query: 139 ---KDGDEGLLSSLGFHEDNG-----YGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKP 190
              K   EG   ++G +ED         L  +P D   + + + DS   L         P
Sbjct: 260 GTVKSSGEG---NVGGNEDGTNHTALLRLEPSPFDPNVVATFTQDSNAVLILDMRYPGSP 316

Query: 191 VSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHD 228
           + T E  H   VN  +WH    N   +  +DC +   D
Sbjct: 317 ILTLEG-HSSAVNQMRWHPTQRNVLLTCGDDCQVLYWD 353

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 40/96 (41%), Gaps = 13/96 (13%)

Query: 117 PQDSNLIATING-SGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDD 175
           P D N++AT    S  V + D    G   L  +L  H      + ++P  +  LL+  DD
Sbjct: 289 PFDPNVVATFTQDSNAVLILDMRYPGSPIL--TLEGHSSAVNQMRWHPTQRNVLLTCGDD 346

Query: 176 SKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELN 211
            ++  WDI        ++W   H  G    KW+  N
Sbjct: 347 CQVLYWDI--------NSW--LHHSGAATSKWNTNN 372

>YKL213C Chr11 complement(31960..34107) [2148 bp, 715 aa] {ON}
           DOA1WD repeat protein required for ubiquitin-mediated
           protein degradation, forms complex with Cdc48p, plays a
           role in controlling cellular ubiquitin concentration;
           also promotes efficient NHEJ in postdiauxic/stationary
           phase
          Length = 715

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 54/177 (30%), Positives = 79/177 (44%), Gaps = 21/177 (11%)

Query: 141 GDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWES--CH 198
           G++ L + +G H+ N   LSF     G ++SGS       WD T    K  S   +   H
Sbjct: 88  GEDPLYTLIG-HQGNVCSLSFQ---DGVVISGS-------WDKTAKVWKEGSLVYNLQAH 136

Query: 199 QDGVNDCKWHELNGNTFGSVSEDCTLQL-HDQRVKDSVTDKIKTVTAFNTIAFSKHSTNL 257
              V D K    + N F + S D T++L  + +V  + +     V     +    H    
Sbjct: 137 NASVWDAKVVSFSENKFLTASADKTIKLWQNDKVIKTFSGIHNDVVRHLAVVDDGH---- 192

Query: 258 FAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMW 314
           F +   D LI L D   TG+VL T  GHES V  ++     +G ++S GEDR V +W
Sbjct: 193 FISCSNDGLIKLVD-MHTGDVLRTYEGHESFVYCIKLLP--NGDIVSCGEDRTVRIW 246

>Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}
           similar to Ashbya gossypii AGL190W
          Length = 374

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 62/302 (20%), Positives = 120/302 (39%), Gaps = 50/302 (16%)

Query: 113 ARYMPQDSNLIATINGS-------GTVFLYDRSKDGDEGLLSSLGFHEDNG-YGLSFNPV 164
            +Y P   N +A   GS       G +F+ D +  G   ++ S  F   +G + +++N +
Sbjct: 15  VQYSPFFDNKLAVATGSNFGLVGNGKLFILDITPQGK--IVESNSFLTKDGLFDVAWNEL 72

Query: 165 DKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTL 224
            + ++L+   D  + L+DI      PV+ ++  H+  V  C W+ ++  TF S S D T+
Sbjct: 73  HENQVLAAQGDGSLRLFDINLQK-YPVAIFQE-HEREVFSCNWNLIDKQTFLSSSWDGTV 130

Query: 225 QLHDQRVKDSVTDKIKTVTAFNTI--------------------------------AFSK 252
           ++     K S+   + T T  NT+                                 +S 
Sbjct: 131 KIWSPARKQSLRTLLPTPTN-NTVLVDSTVLKQDVPVSNQAQHKYSSNNKDCIYQALYSP 189

Query: 253 HSTNLFAAAGTDSLIYLYDSRRTGNV-LHTMSGHES-NVTNLEFYAAKDGIVMSSGEDRR 310
           H +NL  +   +S + ++D R+  N    +   H        +F   +  IV + G D+ 
Sbjct: 190 HDSNLVMSCSGNSYVSIFDIRQPVNTEQQSFIAHRGLEALTCDFNKYRPHIVATGGVDKL 249

Query: 311 VIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQV 370
           + +WDL  +    +   +   SP  +    GH   V     +P+   ++ S   +   + 
Sbjct: 250 IKVWDLRMVRQSLLHTRS---SPVSINEMQGHSLAVRRVFWSPHHSDMLLSTSYDMTCRT 306

Query: 371 WK 372
           W+
Sbjct: 307 WQ 308

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 33/74 (44%)

Query: 110 VTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKL 169
           + +A Y P DSNL+ + +G+  V ++D  +  +    S +           FN      +
Sbjct: 182 IYQALYSPHDSNLVMSCSGNSYVSIFDIRQPVNTEQQSFIAHRGLEALTCDFNKYRPHIV 241

Query: 170 LSGSDDSKIALWDI 183
            +G  D  I +WD+
Sbjct: 242 ATGGVDKLIKVWDL 255

>SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 88/185 (47%), Gaps = 15/185 (8%)

Query: 147 SSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCK 206
           S++  H       +F P    ++++G+ D+   +WD  T +  P+ST +  H + V    
Sbjct: 137 SAIAGHGSTILCSAFAPHTSSRMITGAGDNTARIWDCNTQT--PMSTLKG-HFNWVLCVS 193

Query: 207 WHELNGNTFGSVSEDCTLQLHD----QRVKDSVTDKIKTVTAFN--TIAFSKHSTN-LFA 259
           W   +G    + S D T++L +    Q V D++    K +T+ +   I   K       A
Sbjct: 194 WSP-DGELIATGSMDNTIRLWEGNKGQPVGDALRGHGKWITSLSWEPIHLVKPGQKPRLA 252

Query: 260 AAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEI 319
           +A  D  I ++D+ R    L T+SGH S+V+ +++     G++ S   D+ +  WD M +
Sbjct: 253 SASKDGTIKIWDTTRR-VCLITLSGHTSSVSCIKW--GGQGVLYSGSHDKTIRAWD-MNL 308

Query: 320 GAEQV 324
           G + +
Sbjct: 309 GGKCI 313

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 54/265 (20%), Positives = 106/265 (40%), Gaps = 38/265 (14%)

Query: 117 PQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDS 176
           P     +A+ +  GT+ ++D ++      L +L  H  +   + +    +G L SGS D 
Sbjct: 245 PGQKPRLASASKDGTIKIWDTTR---RVCLITLSGHTSSVSCIKWG--GQGVLYSGSHDK 299

Query: 177 KIALWDITTNSTKPVSTWESCHQDGVNDCKW---HELNGNTFGSVSEDCTLQLHDQRVKD 233
            I  WD+     K ++  +S H   VN       + L    F   SE  +     Q+   
Sbjct: 300 TIRAWDMNLGG-KCINILKS-HAHWVNHLSLSTDYALRIGAFDHTSEKPSTPEEAQK--- 354

Query: 234 SVTDKIKTVTAFNTIAFSKHSTN-LFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNL 292
                 + +  +  IA        L   A  D  +YL++  ++   +  M+GH+  V ++
Sbjct: 355 ------RALKNYEKIAKRNGEVEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHV 408

Query: 293 EFYAAKDGI-VMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSM 351
            F  + DG  ++S+  D  + +W            +  DG  + +    GH + V   + 
Sbjct: 409 AF--SPDGRHIVSASFDNSIKLW------------NGRDG--KFISTFRGHVASVYQVAW 452

Query: 352 NPNIPWLMASAEEENIVQVWKCSSK 376
           + +   L+ S  ++  ++VW   +K
Sbjct: 453 SSDCR-LLVSCSKDTTLKVWDVKTK 476

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 64/295 (21%), Positives = 121/295 (41%), Gaps = 53/295 (17%)

Query: 122 LIATINGSGTVFLYDRSKDGDEGLLSSLGFH----------------EDNGYGLSFNPVD 165
           L AT++ +G V+++D +        S+ G+                    GY L ++P+ 
Sbjct: 234 LTATMSENGEVYIFDLAPQS--KAFSTPGYQIPKTARRPIHTVRNHGNVEGYALDWSPMI 291

Query: 166 K-GKLLSGSDDSKIALWDITTNSTKPVSTWESCHQ-------DGVNDCKWHELNGNTFGS 217
           K G LL+G    +I        + +  S W +  Q         V D +W       F S
Sbjct: 292 KNGALLTGDCSGQIYF------TQRHTSKWITDKQPFTAENNKSVEDIQWSRTESTVFAS 345

Query: 218 VSEDCTLQLHDQRVKD---SVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRR 274
              D  +++ D R K    +++ K    T  N I++S+    L A+   + L  ++D R+
Sbjct: 346 AGCDGYIRIWDTRSKKHKPALSVKASN-TDVNVISWSEKIGYLLASGDDNGLWGVWDLRQ 404

Query: 275 TG----NVLHTMSG---HESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL-MEIGAEQVPD 326
                 N +  ++    H+  +T++ F    D I+  + ED  V +WDL +E   E++  
Sbjct: 405 FSPDNINDVQPVAQYDFHKGAITSINFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQ 464

Query: 327 ------DADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSS 375
                 + +   P+++ +H   +  V D   +  IP  + S   + +  +WK  S
Sbjct: 465 QIAETKELEKIPPQLLFVH--WQKDVKDVKWHKQIPGCLVSTGTDGL-NIWKTIS 516

>KNAG0C04950 Chr3 (955701..957023) [1323 bp, 440 aa] {ON} Anc_5.429
           YDR364C
          Length = 440

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 87/196 (44%), Gaps = 13/196 (6%)

Query: 152 HEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELN 211
           H +    L F P      +SG +D+ + LWD   +  + V  + S H  G+   ++   +
Sbjct: 145 HRNGTNTLQFIPNTGHLFMSGGNDAVVRLWDF-YHDRRCVRDYRS-HSKGIRATRFVP-D 201

Query: 212 GNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFS-KHSTNLFAAAGTDSLIYLY 270
           G+ F S S D T+   D     +V   +   +    + F  +H T+ +    +DS I  Y
Sbjct: 202 GSQFLSASFDQTVNRWDTET-GTVLQSLSLRSTPTAVDFRPQHGTDEYLVGLSDSRILHY 260

Query: 271 DSR---RTGNVLHTMSGHESNVTNLEFYAAKDGI-VMSSGEDRRVIMWDL-MEIGAEQVP 325
           D+R   R G ++ T   H   +  L ++   DG   +SS ED+ V +WD  + I  +Q+ 
Sbjct: 261 DTRVDTRDG-LVQTYDHHLGGILALRYFP--DGTKFISSSEDKTVRIWDSGVNIPVKQIS 317

Query: 326 DDADDGSPEVVMIHAG 341
           D      P V +  AG
Sbjct: 318 DTTQHSMPSVSLHPAG 333

>Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178W
           (REAL)
          Length = 465

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 56/208 (26%), Positives = 92/208 (44%), Gaps = 13/208 (6%)

Query: 106 HEQEVTRARYMPQDSNLIATINGSGTV--FLYDRSKDGDEGLLSSLGFHEDNGYGLSFNP 163
           H  ++   ++ P+ +N I +    G +  F Y  +++GD  LL SL  HE     L ++P
Sbjct: 217 HVGKIGAVQWHPESNNQIISCAEDGLIKNFQY-LNEEGDLRLLGSLVGHERRVSDLKYHP 275

Query: 164 VDKGKLL-SGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDC 222
              GK + S S D    LWD +T     +   +  H  GV  C   + +G+   S   D 
Sbjct: 276 --SGKFIGSASHDMTWRLWDASTYQELLL---QEGHAKGVF-CLSFQCDGSLVCSGGMDS 329

Query: 223 TLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSR-RTGNVLHT 281
              + D R  + V           T+ +S +   + A  G D LI ++D R R G  +H 
Sbjct: 330 LAMIWDIRSGNKVMSLTGHSKPVYTVDWSPNGYQV-ATGGGDGLINVWDIRQRDGGQVHQ 388

Query: 282 MSGHESNVTNLEFYAAKDG-IVMSSGED 308
           +  H + VT ++F    +G  ++S G D
Sbjct: 389 ILAHRNIVTKVQFSKDDNGKKLISCGYD 416

>AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR364C
           (CDC40)
          Length = 467

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 76/161 (47%), Gaps = 6/161 (3%)

Query: 159 LSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSV 218
           ++F+P +K +LL G  DSKI  +D+  +    V      H   +N  ++   +G+ F S 
Sbjct: 265 MTFHPQNKEQLLVGFSDSKIRHFDLRVDKKDGVIQIYDHHLAAINALRYFP-DGSKFISS 323

Query: 219 SEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHST-NLFAAAGTDSLIYLYD--SRRT 275
           S+D ++++ + ++   +  +I     +       H   N FAA   D+ IY+Y    +  
Sbjct: 324 SDDKSIRIWENQINIPI-KQISDTDQYPAPWIQLHPEHNQFAAQSMDNSIYVYSMKPKYK 382

Query: 276 GNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDR-RVIMWD 315
            +      GH+S   N  F  A DG  +++G+   R+ +WD
Sbjct: 383 RHPRKAFRGHKSAGYNSMFDIAPDGRYVAAGDTSGRLFIWD 423

 Score = 33.9 bits (76), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 43/96 (44%), Gaps = 16/96 (16%)

Query: 277 NVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVV 336
            +LH   GH+   T LEF      + +S G D  + +WD+     E++          ++
Sbjct: 165 RILHVYDGHDRGTTALEFLRKTGHLFLSGGNDGVLKIWDMYH---ERL----------LL 211

Query: 337 MIHAGHRSPVNDFSM-NPNIPWLMASAEEENIVQVW 371
             + GHR  ++  S  + N+    AS+  +  V++W
Sbjct: 212 RDYCGHRKAISATSFSHDNVQ--FASSSYDKTVKIW 245

>Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {ON}
           similar to Ashbya gossypii AGL234W
          Length = 646

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 58/252 (23%), Positives = 108/252 (42%), Gaps = 43/252 (17%)

Query: 145 LLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVND 204
           +L +L  HE + Y L + P    KL+SGS D  + +WD+ T       + E    DGV  
Sbjct: 403 ILMTLQGHEQDIYSLDYFPAGD-KLVSGSGDRTVRIWDLRTGQCSLTLSIE----DGVTT 457

Query: 205 CKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNT--------IAFSKHSTN 256
                 +G    + S D T+++ D      + +++ +    +T        + F++   +
Sbjct: 458 VAVSPGDGKYIAAGSLDRTVRVWDSET-GFLVERLDSENELSTGHKDSVYSVVFTRDGRS 516

Query: 257 LFAAAGTDSLIYLYDSR-RTGNVLH-----TMSGHESNVTNLEFYAAKDGIVMSSGEDRR 310
           + + +  D  + L+D R   G   H     T +GH+  V ++      D  ++S  +DR 
Sbjct: 517 VVSGS-LDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVAT-TQDDEYILSGSKDRG 574

Query: 311 VIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHR------SPVNDFSMNPNIPWLMASAEE 364
           V+ WD               G+P  +++  GHR      + VN F + P+I  + A+   
Sbjct: 575 VLFWDTAS------------GNP--LLMLQGHRNSVISVAVVNGFPLGPDI-GVFATGSG 619

Query: 365 ENIVQVWKCSSK 376
           +   ++WK + K
Sbjct: 620 DCKARIWKYTKK 631

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 40/72 (55%), Gaps = 3/72 (4%)

Query: 245 FNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMS 304
             ++ FS     L A    D LI ++D   +  +L T+ GHE ++ +L+++ A D +V  
Sbjct: 372 IRSVCFSPDGKYL-ATGAEDKLIRIWD-LSSKKILMTLQGHEQDIYSLDYFPAGDKLVSG 429

Query: 305 SGEDRRVIMWDL 316
           SG DR V +WDL
Sbjct: 430 SG-DRTVRIWDL 440

>KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa]
           {ON} Anc_4.309 YLR429W
          Length = 634

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 77/177 (43%), Gaps = 22/177 (12%)

Query: 161 FNPVDKGKLLSGSDDSKIALWDITTNST--------------KPVSTWESCHQDGVNDCK 206
           F+P ++ +L SGSDDSKI +WDI  + +              KPV    + H   V    
Sbjct: 89  FDPFNQRRLASGSDDSKIGIWDIPEDYSFHNYLDSNGDPKDIKPVKML-AGHSRKVGHVL 147

Query: 207 WHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSL 266
           +H L  +   S S D T+++ +    + V   +K      +++FS +  +L A    D  
Sbjct: 148 YHPLAQDILASSSLDYTVKIWNVETGE-VLFTLKHPDMVTSMSFSYNGAHL-ATVARDKK 205

Query: 267 IYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSG----EDRRVIMWDLMEI 319
           + ++D R+ G V+   + H         +      + ++G     DR++ +WD   +
Sbjct: 206 LRVWDVRK-GEVVSEGTAHAGAKNQRVVWLGNSDRLATTGFSKLSDRQIGIWDAFHL 261

>Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa]
           {ON} complement(166721..169273) [2553 nt, 851 aa]
          Length = 850

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 61/137 (44%), Gaps = 19/137 (13%)

Query: 248 IAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGE 307
           + FS    NLFA A  D    L+   R    L  M+GH ++V  + F++    I   S  
Sbjct: 622 VEFSPSCNNLFATASNDQTARLWSCDRVY-PLRVMAGHLNDVDCVSFHSNGRYIFTGSS- 679

Query: 308 DRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENI 367
           D+ V MWD+               + + V +  GH S V   S++P+  W+ ++  ++ I
Sbjct: 680 DKTVRMWDI--------------NTGDSVRLFMGHNSTVTSLSVSPDGKWI-STGSDDGI 724

Query: 368 VQVWKCSS--KLPRVGG 382
           + +W   S  KL  + G
Sbjct: 725 ITIWDIGSGRKLKNMRG 741

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 50/110 (45%), Gaps = 18/110 (16%)

Query: 281 TMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHA 340
           T  GH   V +  F +A D  ++S+ ED+ V +W         V DD      + ++ + 
Sbjct: 569 TFIGHSGTVYSTSF-SAGDEYLLSASEDKTVRLW--------SVQDD------KPLVSYK 613

Query: 341 GHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSKLP-RV--GGLPKVD 387
           GH  PV D   +P+   L A+A  +   ++W C    P RV  G L  VD
Sbjct: 614 GHEKPVWDVEFSPSCNNLFATASNDQTARLWSCDRVYPLRVMAGHLNDVD 663

 Score = 37.7 bits (86), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 87/219 (39%), Gaps = 26/219 (11%)

Query: 117 PQDSNLIATINGSGTVFLYDRSKDGDEGLLS-------------------SLGFHEDNGY 157
           P  S     I  SGTV+    S  GDE LLS                   S   HE   +
Sbjct: 562 PISSTCKTFIGHSGTVYSTSFSA-GDEYLLSASEDKTVRLWSVQDDKPLVSYKGHEKPVW 620

Query: 158 GLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGS 217
            + F+P       + S+D    LW  + +   P+    + H + V DC     NG    +
Sbjct: 621 DVEFSPSCNNLFATASNDQTARLW--SCDRVYPLRVM-AGHLNDV-DCVSFHSNGRYIFT 676

Query: 218 VSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGN 277
            S D T+++ D    DSV   +   +   +++ S       +    D +I ++D   +G 
Sbjct: 677 GSSDKTVRMWDINTGDSVRLFMGHNSTVTSLSVSPDG-KWISTGSDDGIITIWDIG-SGR 734

Query: 278 VLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL 316
            L  M GH  +  +   Y  +  +++S G D+ V +WDL
Sbjct: 735 KLKNMRGHGKSSIHSLSYNPEGTLLVSGGADQSVRVWDL 773

>Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {ON}
           YMR131C (RRB1) - RiboSome Assembly 2 [contig 204] FULL
          Length = 523

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 50/239 (20%), Positives = 106/239 (44%), Gaps = 23/239 (9%)

Query: 156 GYGLSFNPVDK-GKLLSGSDDSKIALWDI-TTNSTKPVSTWESCHQDGVNDCKWHELNGN 213
           GY L ++P++K G LL+G    ++ L    T+      + + + +   + D ++      
Sbjct: 288 GYALDWSPLNKSGSLLTGDCSGRVYLTQRHTSKWITDKTAFSAGNNQSIEDIQFSRTEAT 347

Query: 214 TFGSVSEDCTLQLHDQRVKD---SVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLY 270
            F +   D  +++ D R K    +++ K  + T  N I++++    L A+   +    ++
Sbjct: 348 VFATCGCDGYIRIWDTRSKKHKPAISVKASS-TDVNVISWNEKIGYLLASGDDNGTWGVW 406

Query: 271 DSRR-------TGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL-MEIGAE 322
           D R+       + + +   S H+  +T++ F    D I+  + ED  V +WDL +E   E
Sbjct: 407 DLRQFSPNNAASVSPVAQYSFHKGAITSIAFNPLDDSIIAVASEDNTVTLWDLSVEADDE 466

Query: 323 QVPDDADDGS------PEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSS 375
           ++   A +        P+++ +H   +  V D   +  IP  + S   + +  +WK  S
Sbjct: 467 EIKQQAAETKELQQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NIWKTIS 522

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 11/42 (26%), Positives = 24/42 (57%)

Query: 146 LSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNS 187
           ++   FH+     ++FNP+D   +   S+D+ + LWD++  +
Sbjct: 422 VAQYSFHKGAITSIAFNPLDDSIIAVASEDNTVTLWDLSVEA 463

>ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 83/170 (48%), Gaps = 18/170 (10%)

Query: 160 SFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVS 219
           +F P    ++++G+ D+   +WD  T +  P+S  +  H + V    W   +G    + S
Sbjct: 150 AFAPDTSSRMVTGAGDNTARIWDCATQT--PLSVLKG-HSNWVLCVAWSP-DGELIATGS 205

Query: 220 EDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAA--------AGTDSLIYLYD 271
            D T++L + +      D +K  + + T + +    +L AA        A  D  I ++D
Sbjct: 206 MDNTIRLWESKAGKPWGDAMKGHSKWIT-SLTWEPLHLVAAGDKPRLASASKDGTIKIWD 264

Query: 272 -SRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIG 320
            SRRT   L+T+SGH ++V+ +++     G++ +   D+ + +WD+   G
Sbjct: 265 ASRRT--CLYTLSGHTNSVSCVKW--GGQGLLYTGSHDKTIRVWDIKAGG 310

>AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR084C (TUP1)
          Length = 629

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 57/252 (22%), Positives = 107/252 (42%), Gaps = 43/252 (17%)

Query: 145 LLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVND 204
           +L +L  HE + Y L + P    KL+SGS D  + +WD+ T       + E    DGV  
Sbjct: 386 ILMTLQGHEQDIYSLDYFPAGD-KLVSGSGDRTVRIWDLRTGQCSLTLSIE----DGVTT 440

Query: 205 CKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNT--------IAFSKHSTN 256
                 +G    + S D T+++ D      + +++ +    +T        + F++    
Sbjct: 441 VAVSPGDGKYIAAGSLDRTVRVWDSET-GFLVERLDSENELSTGHKDSVYSVVFTRDGQG 499

Query: 257 LFAAAGTDSLIYLYDSR-RTGNVLH-----TMSGHESNVTNLEFYAAKDGIVMSSGEDRR 310
           + + +  D  + L+D R   G   H     T +GH+  V ++      D  ++S  +DR 
Sbjct: 500 VISGS-LDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVAT-TQDDEYILSGSKDRG 557

Query: 311 VIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHR------SPVNDFSMNPNIPWLMASAEE 364
           V+ WD               G+P  +++  GHR      + VN F + P++  + A+   
Sbjct: 558 VLFWDTAS------------GNP--LLMLQGHRNSVISVAVVNGFPLGPDV-GVFATGSG 602

Query: 365 ENIVQVWKCSSK 376
           +   ++WK + K
Sbjct: 603 DCKARIWKYTKK 614

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 40/72 (55%), Gaps = 3/72 (4%)

Query: 245 FNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMS 304
             ++ FS     L A    D LI ++D   T  +L T+ GHE ++ +L+++ A D +V  
Sbjct: 355 IRSVCFSPDGKYL-ATGAEDKLIRIWD-LTTKKILMTLQGHEQDIYSLDYFPAGDKLVSG 412

Query: 305 SGEDRRVIMWDL 316
           SG DR V +WDL
Sbjct: 413 SG-DRTVRIWDL 423

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/228 (24%), Positives = 106/228 (46%), Gaps = 25/228 (10%)

Query: 159 LSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSV 218
           + F+P D   L +G++D  I +WD+TT   K + T +   QD +    +    G+   S 
Sbjct: 358 VCFSP-DGKYLATGAEDKLIRIWDLTTK--KILMTLQGHEQD-IYSLDYFP-AGDKLVSG 412

Query: 219 SEDCTLQLHDQRV-KDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGN 277
           S D T+++ D R  + S+T  I+      T+A S       AA   D  + ++DS  TG 
Sbjct: 413 SGDRTVRIWDLRTGQCSLTLSIE--DGVTTVAVSPGDGKYIAAGSLDRTVRVWDS-ETGF 469

Query: 278 VLHTM-------SGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADD 330
           ++  +       +GH+ +V ++ F     G++ S   DR V +WDL  +  ++       
Sbjct: 470 LVERLDSENELSTGHKDSVYSVVFTRDGQGVI-SGSLDRSVKLWDLRGLNGQK-----SH 523

Query: 331 GSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSKLP 378
            + EV   + GH+  V   +   +  ++++ +++  ++  W  +S  P
Sbjct: 524 ATCEVT--YTGHKDFVLSVATTQDDEYILSGSKDRGVL-FWDTASGNP 568

>TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.429
           YDR364C
          Length = 441

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 86/194 (44%), Gaps = 8/194 (4%)

Query: 152 HEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELN 211
           H +    L F P      LSG +D+ I LWD   +  + +  ++  H+  V    ++  N
Sbjct: 147 HTNGTTDLKFFPNTAHMFLSGGNDNMIRLWDF-YHDRRCIRDYKG-HKKAVRSVDFNN-N 203

Query: 212 GNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYD 271
           G  F S S D T+++ D      V  K+K  +  N +     S + +    ++S I  YD
Sbjct: 204 GTVFFSSSYDQTVKIWDTET-GKVKAKVKCNSIPNDVKPRPLSDSEYIVGLSNSKINHYD 262

Query: 272 SRRTGN--VLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWD-LMEIGAEQVPDDA 328
            R +    ++ T   H+ ++  L+++      + SS ED+ V +W+  + I  +Q+ D  
Sbjct: 263 QRVSSKNGLVQTYDHHQGSILCLKYFPDGSKFI-SSSEDKTVRIWENKINIPIKQIADTT 321

Query: 329 DDGSPEVVMIHAGH 342
               P + +   GH
Sbjct: 322 QHSMPYMDIHPEGH 335

 Score = 33.9 bits (76), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 19/93 (20%), Positives = 37/93 (39%), Gaps = 14/93 (15%)

Query: 279 LHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMI 338
           L+   GH +  T+L+F+     + +S G D  + +WD                    +  
Sbjct: 141 LYRYKGHTNGTTDLKFFPNTAHMFLSGGNDNMIRLWDFYH-------------DRRCIRD 187

Query: 339 HAGHRSPVNDFSMNPNIPWLMASAEEENIVQVW 371
           + GH+  V     N N     +S+ ++  V++W
Sbjct: 188 YKGHKKAVRSVDFNNNGTVFFSSSYDQT-VKIW 219

>CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247c
          Length = 513

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 76/177 (42%), Gaps = 23/177 (12%)

Query: 161 FNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSE 220
           +NPVD   L+S S D+   +WD+   S+  V T    H   V D ++   +   F S   
Sbjct: 243 WNPVDTNILISSSIDTTCIVWDL--QSSNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGG 300

Query: 221 DCTLQLHDQRV-------------------KDSVTDKI-KTVTAFNTIAFSKHSTNLFAA 260
           D ++++ D R                      S +D   +   A   +  S H  N+ A 
Sbjct: 301 DGSVRVFDLRCLAHSTIIYEPPASEPGTGNNSSRSDSTDENSHALLRLEPSPHDPNVLAT 360

Query: 261 -AGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL 316
            A   + I + D R   + L  ++GH +++  ++++  K   ++S  +D +V+ WD+
Sbjct: 361 FAIASNEILILDMRNPDSPLVVLNGHSASINQIKWHPTKKNTLISCSDDCQVLFWDI 417

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 57/150 (38%), Gaps = 18/150 (12%)

Query: 96  SNIKIIKKFKHEQEVTRARYMPQDSNLIATINGSGTVFLYD--------------RSKDG 141
           SN    +   H+ EV   R++ Q + L A+  G G+V ++D               S+ G
Sbjct: 268 SNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRCLAHSTIIYEPPASEPG 327

Query: 142 DEGLLSSLGFHEDNGYGL---SFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCH 198
                S     ++N + L     +P D   L + +  S   L     N   P+      H
Sbjct: 328 TGNNSSRSDSTDENSHALLRLEPSPHDPNVLATFAIASNEILILDMRNPDSPLVVLNG-H 386

Query: 199 QDGVNDCKWHELNGNTFGSVSEDCTLQLHD 228
              +N  KWH    NT  S S+DC +   D
Sbjct: 387 SASINQIKWHPTKKNTLISCSDDCQVLFWD 416

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 39/81 (48%), Gaps = 1/81 (1%)

Query: 105 KHEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPV 164
           ++   + R    P D N++AT   +    L    ++ D  L+  L  H  +   + ++P 
Sbjct: 340 ENSHALLRLEPSPHDPNVLATFAIASNEILILDMRNPDSPLVV-LNGHSASINQIKWHPT 398

Query: 165 DKGKLLSGSDDSKIALWDITT 185
            K  L+S SDD ++  WDI++
Sbjct: 399 KKNTLISCSDDCQVLFWDISS 419

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 66/151 (43%), Gaps = 16/151 (10%)

Query: 168 KLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHEL--NGNTFGSVSEDCTLQ 225
           K+ + SD  +I  W + T   K         Q  ++ CK+H+   N   F  +S+   + 
Sbjct: 173 KIATASDSLRI--WSLNTEENKLE------EQLNLSLCKFHKQHPNNKAFVGLSQ---IP 221

Query: 226 LHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGH 285
                V  SV  +   +T+F+   ++   TN+  ++  D+   ++D + +  V   +  H
Sbjct: 222 TKTSDVNPSVLGEFPPITSFH---WNPVDTNILISSSIDTTCIVWDLQSSNYVKTQLIAH 278

Query: 286 ESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL 316
           +S V ++ F      +  S G D  V ++DL
Sbjct: 279 DSEVFDVRFLTQSTQLFASCGGDGSVRVFDL 309

>Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa]
           {ON} YDL195W (SEC31) - Component (p150) of COPII coat of
           secretory pathway vesicles [contig 161] FULL
          Length = 1296

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 76/184 (41%), Gaps = 14/184 (7%)

Query: 146 LSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWD---ITTNSTKP-VSTWESCHQDG 201
           ++ L  H      + FN      L SG    +I +WD   I T    P V        D 
Sbjct: 97  IAKLAQHSTPVKTVRFNAKQHNVLCSGGSKGEIYIWDANKIETPGYAPFVPGTAMTPMDE 156

Query: 202 VNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAF---NTIAF----SKHS 254
           +    W++  G+ F S        + D + K  V     T +     N ++       +S
Sbjct: 157 IYSLAWNQNQGHVFASAGSSGFASIWDLKAKKEVIHLSHTSSITGQKNQLSIVEWHPNNS 216

Query: 255 TNLFAAAGTDS--LIYLYDSRRTGNVLHTMS-GHESNVTNLEFYAAKDGIVMSSGEDRRV 311
           T +  A+G+DS   I ++D R     L T+S GH   V +L++    + +++SSG D   
Sbjct: 217 TRIATASGSDSDPSILVWDLRNANVPLQTLSQGHTKGVLSLDWCKQDETLLLSSGRDNSC 276

Query: 312 IMWD 315
           ++W+
Sbjct: 277 VLWN 280

>CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {ON}
           similar to uniprot|P40968 Saccharomyces cerevisiae
           YDR364c CDC40
          Length = 441

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 65/264 (24%), Positives = 102/264 (38%), Gaps = 52/264 (19%)

Query: 99  KIIKKFK-HEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGY 157
           K+I ++K H    T  R +P   +LI +     TV L+D   D     L     H     
Sbjct: 139 KVIYRYKGHHNGTTSLRLLPGTGHLILSGGNDNTVKLWDFYHD--RKCLRDFVGHSKPIK 196

Query: 158 GLSFNPVDKGKLLSGSDDSKIALWDITTNS-TKPVSTWES-------------------- 196
            L F   D  + LSGS D ++ +WD  T   TK ++T+ +                    
Sbjct: 197 TLDFTS-DSSQFLSGSYDQQVKIWDTETGKVTKRLNTYSTPNSAEFRPTSGNEFVVGLSS 255

Query: 197 ----------CHQDGVNDCKWHEL----------NGNTFGSVSEDCTLQLHDQRVKDSVT 236
                       +DG+     H L          +G+ F S SED TL++ + +V   + 
Sbjct: 256 SKIKHYDTRVSEKDGLVQVYDHHLSSILAIKYFPDGSKFISSSEDKTLRIWNNQVNIPIK 315

Query: 237 DKIKTVTAFNTIAFSKHST-NLFAAAGTDSLIYLYDSRRTGNVLH---TMSGHESNVTNL 292
            +I   T  +      H   N F+    DS+IY Y S +    +H      GH S    +
Sbjct: 316 -QISDTTQHSMPYIGIHPEHNYFSTQSMDSVIYSY-SMKPKYKMHPNKKFKGHNSAGYGI 373

Query: 293 EFYAAKDGIVMSSGEDR-RVIMWD 315
               + DG  + SG+ R ++ +WD
Sbjct: 374 GLTFSPDGRFLCSGDARGQLFLWD 397

>Smik_12.256 Chr12 (490929..492659) [1731 bp, 576 aa] {ON} YLR196W
           (REAL)
          Length = 576

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 78/170 (45%), Gaps = 10/170 (5%)

Query: 152 HEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQD-GVNDCKWHEL 210
           H D    ++ N   +  L S S D  + LWD+  NS     +  S H +  V+  +WH L
Sbjct: 285 HTDAVLSMAHNKHFRSVLASTSADHTVKLWDL--NSGNAARSLASIHSNKNVSSSEWHML 342

Query: 211 NGNTFGSVSEDCTLQLHDQRVKD-SVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDS-LIY 268
           NG+   +   D  + L D R+ D S   K  +V +   I  +  ++      GTDS  +Y
Sbjct: 343 NGSVLLTGGYDSRVALTDVRISDESQMSKYWSVMSGEEIETATFASENIILCGTDSGNVY 402

Query: 269 LYDSRRTGNV--LHTMSGHESNVTNLEFYAAKDGIVMSSGE--DRRVIMW 314
            +D R + N   + T+  H++ ++ L       G+ MS+G   ++ V +W
Sbjct: 403 SFDIRNSENCKPVWTLKAHDAGISTLCSNKFIPGM-MSTGAMGEKTVKLW 451

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 41/75 (54%), Gaps = 3/75 (4%)

Query: 244 AFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHES--NVTNLEFYAAKDGI 301
           A  ++A +KH  ++ A+   D  + L+D   +GN   +++   S  NV++ E++     +
Sbjct: 288 AVLSMAHNKHFRSVLASTSADHTVKLWD-LNSGNAARSLASIHSNKNVSSSEWHMLNGSV 346

Query: 302 VMSSGEDRRVIMWDL 316
           +++ G D RV + D+
Sbjct: 347 LLTGGYDSRVALTDV 361

>Smik_11.10 Chr11 complement(16139..18292) [2154 bp, 717 aa] {ON}
           YKL213C (REAL)
          Length = 717

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 76/177 (42%), Gaps = 21/177 (11%)

Query: 141 GDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWE--SCH 198
           G++ L + +G HE N   L F     G ++SGS       WD T    K  S       H
Sbjct: 88  GEDPLYTLIG-HEGNVCSLCFQ---DGIVVSGS-------WDKTAKVWKDGSLVYDLQAH 136

Query: 199 QDGVNDCKWHELNGNTFGSVSEDCTLQL-HDQRVKDSVTDKIKTVTAFNTIAFSKHSTNL 257
              V D K   L  N F + S D T++L  + +V  + T     V     +    H    
Sbjct: 137 SASVWDAKVVSLTENKFLTASADKTIKLWQNDKVIKTFTGIHNDVVRHLAMVDDGH---- 192

Query: 258 FAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMW 314
           F +   D LI L D   TG VL T  GHES V  ++     +G ++S GEDR + +W
Sbjct: 193 FISCSNDGLIKLVDIH-TGKVLKTYEGHESFVYCVKLLP--NGDIVSCGEDRSIRVW 246

>Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON}
           YOL138C (REAL)
          Length = 1332

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 53/105 (50%), Gaps = 7/105 (6%)

Query: 121 NLIATINGSGTVFLYDRSKDG--DEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKI 178
           N IA  N S  + +YD +K    +  L++SL  H  +     FN V+   ++SG  DS +
Sbjct: 225 NCIAVCNNSTAISIYDLNKSSSIENPLITSLCEHTRSINSFDFNMVESNLIISGGQDSCV 284

Query: 179 ALWDITTNSTKPVSTWE---SCHQDGVNDCKWHELNGNTFGSVSE 220
            +WD+ +N++K  +  +   +   D + D KW  + G  F S +E
Sbjct: 285 KIWDLRSNTSKSSNRADININTASDSIRDVKW--MPGYNFASKNE 327

 Score = 34.3 bits (77), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 22/110 (20%), Positives = 47/110 (42%), Gaps = 10/110 (9%)

Query: 211 NGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLY 270
           N NT   V+     +L  +  ++  +      T FN         N  A     + I +Y
Sbjct: 186 NNNTSTKVATSLLPKLSKRTRQNKFSTIADVKTGFNNYK------NCIAVCNNSTAISIY 239

Query: 271 DSRRTGNV----LHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL 316
           D  ++ ++    + ++  H  ++ + +F   +  +++S G+D  V +WDL
Sbjct: 240 DLNKSSSIENPLITSLCEHTRSINSFDFNMVESNLIISGGQDSCVKIWDL 289

>KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {ON}
           Anc_5.429 YDR364C
          Length = 439

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 87/196 (44%), Gaps = 11/196 (5%)

Query: 152 HEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELN 211
           H      + F P      LSG +D+ + +WD   +  K +  +   H   +    +++ +
Sbjct: 145 HSSGTTCMKFIPNTGHLFLSGGNDNIVKIWDF-YHDRKSLRDYRG-HTKAIKSMSFND-D 201

Query: 212 GNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYD 271
            + F + S D T++L D      V  ++K  +  N + F   + + F     DS I  YD
Sbjct: 202 AHNFITSSFDQTVKLWDTET-GQVKKRLKFKSTPNCVEFRPANNHEFIVGLADSKIAHYD 260

Query: 272 SRRTGN--VLHTMSGHESNVTNLEFYAAKDG-IVMSSGEDRRVIMWD-LMEIGAEQVPDD 327
           +R +    ++ T   H  ++ +L F+   DG   +SS ED+ V +W+  + I  +Q+ D 
Sbjct: 261 TRESSKHGLVQTYDHHLGSILSLRFFP--DGSKFISSSEDKTVRIWENQINIPIKQISDT 318

Query: 328 ADDGSPEVVMIHAGHR 343
                P  + IH  H+
Sbjct: 319 TQYSMP-FIGIHPEHK 333

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 72/162 (44%), Gaps = 8/162 (4%)

Query: 159 LSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSV 218
           + F P +  + + G  DSKIA +D   +S   +      H   +   ++   +G+ F S 
Sbjct: 237 VEFRPANNHEFIVGLADSKIAHYDTRESSKHGLVQTYDHHLGSILSLRFFP-DGSKFISS 295

Query: 219 SEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTN-LFAAAGTDSLIYLYDSRRTGN 277
           SED T+++ + ++   +  +I   T ++      H  +  F     D+ IY Y S R   
Sbjct: 296 SEDKTVRIWENQINIPIK-QISDTTQYSMPFIGIHPEHKYFCTQSLDNTIYSY-SLRPKY 353

Query: 278 VLH---TMSGHESNVTNLEFYAAKDGIVMSSGEDR-RVIMWD 315
             H      G +S   ++    + DG  + SG+ R ++++WD
Sbjct: 354 KKHPNKVFKGQKSAGYSIGLSFSPDGRYLLSGDSRSKIVLWD 395

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 22/35 (62%), Gaps = 3/35 (8%)

Query: 156 GY--GLSFNPVDKGKLLSGSDDSKIALWDITTNST 188
           GY  GLSF+P D   LLSG   SKI LWD  TN +
Sbjct: 368 GYSIGLSFSP-DGRYLLSGDSRSKIVLWDWNTNKS 401

>Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}
           similar to Ashbya gossypii ACR137W
          Length = 426

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 86/210 (40%), Gaps = 23/210 (10%)

Query: 145 LLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVND 204
           L+  +  H      +  +PVD     +GS+DS I +WD+ +   K        H   V D
Sbjct: 106 LMRVINGHRGWVRCVKVDPVDNEWFATGSNDSTIKVWDLASGKLKVTL---QGHIMTVKD 162

Query: 205 CKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHST-NLFAAAGT 263
                 +   F S SED  ++  D      + D   T++   ++    H T +L  +AG 
Sbjct: 163 IAISTRHPYMF-SASEDKLVKCWDLEKNMVIRDFYGTLSGVYSVDV--HPTLDLIVSAGR 219

Query: 264 DSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQ 323
           DS++ ++D R    V+ T++GH+  +      A  D  V+S   D  V +WD+       
Sbjct: 220 DSVVRIWDIRSRTCVM-TLAGHKGPINKARCLAV-DPQVVSCSTDATVRLWDITA----- 272

Query: 324 VPDDADDGSPEVVMIHAGHRSPVNDFSMNP 353
                  G     + H  H+  V D + NP
Sbjct: 273 -------GKTIKTLTH--HKRNVRDITFNP 293

>TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {ON}
           Anc_5.429 YDR364C
          Length = 447

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 91/191 (47%), Gaps = 9/191 (4%)

Query: 152 HEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELN 211
           HE+    LSF P      LSG +D+ + LWD+  +  K +  +   H   +    +++ +
Sbjct: 153 HENGTTALSFFPKSGHMFLSGGNDNTLRLWDV-YHERKCLRDYLG-HTRALKSFSFND-D 209

Query: 212 GNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYD 271
           G+ F S S D T+++ D      +T K+K  +  N + F   + + +    ++S I  +D
Sbjct: 210 GSKFLSSSYDQTVKMWDTETGKIIT-KLKLHSIPNDLTFRPLNPDEYIVGLSNSTIKHFD 268

Query: 272 SRRTGN--VLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWD-LMEIGAEQVPDDA 328
           +R +    ++ T   H S++  L+++      + SS ED+ V +W+  + +  + + D +
Sbjct: 269 NRVSSKQGLVQTYDHHLSSILKLQYFPDGSKFI-SSSEDKTVKIWENQINVPIKHISDTS 327

Query: 329 DDGSPEVVMIH 339
               P  + IH
Sbjct: 328 QYSMP-FINIH 337

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/94 (20%), Positives = 40/94 (42%), Gaps = 14/94 (14%)

Query: 278 VLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVM 337
           + +   GHE+  T L F+     + +S G D  + +WD+                 + + 
Sbjct: 146 IKYKFKGHENGTTALSFFPKSGHMFLSGGNDNTLRLWDVYH-------------ERKCLR 192

Query: 338 IHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVW 371
            + GH   +  FS N +    ++S+ ++  V++W
Sbjct: 193 DYLGHTRALKSFSFNDDGSKFLSSSYDQT-VKMW 225

>ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL317W (PFS2)
          Length = 449

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 73/153 (47%), Gaps = 9/153 (5%)

Query: 167 GKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQL 226
           G ++SGS D+ I LWD  T   + VST     +  V   K+    GN    VS+D ++++
Sbjct: 218 GLIVSGSKDNLIKLWDPRTG--RNVSTILGL-KHTVIKTKFQPTQGNLLAVVSKDKSIKI 274

Query: 227 HDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLI----YLYDSRRTGNVLHTM 282
           +D R        I+    + ++++   +  +F+    +  I     L+D+  +    HT+
Sbjct: 275 YDMRQHMRELQTIRDDMDYMSLSWHPINETIFSVGCYNGAIKHFDLLHDNSNSTPACHTI 334

Query: 283 S-GHESNVTNLEFYAAKDGIVMSSGEDRRVIMW 314
              HE +VT+L  Y+    I+ S+ +DR +  W
Sbjct: 335 PYAHEKSVTSLA-YSPVGHILASAAKDRTIRFW 366

 Score = 37.7 bits (86), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 70/153 (45%), Gaps = 14/153 (9%)

Query: 81  IVPGKED---RERDGFTKSNIKIIKKFKHEQEVTRARYMPQDSNLIATINGSGTVFLYDR 137
           IV G +D   +  D  T  N+  I   KH   V + ++ P   NL+A ++   ++ +YD 
Sbjct: 220 IVSGSKDNLIKLWDPRTGRNVSTILGLKHT--VIKTKFQPTQGNLLAVVSKDKSIKIYDM 277

Query: 138 SKDGDEGLLSSLGFHEDNGY-GLSFNPVDKGKLLSGSDDSKIALWDI---TTNSTKPVST 193
            +   E  L ++   +D  Y  LS++P+++     G  +  I  +D+    +NST    T
Sbjct: 278 RQHMRE--LQTI--RDDMDYMSLSWHPINETIFSVGCYNGAIKHFDLLHDNSNSTPACHT 333

Query: 194 WESCHQDGVNDCKWHELNGNTFGSVSEDCTLQL 226
               H+  V    +  + G+   S ++D T++ 
Sbjct: 334 IPYAHEKSVTSLAYSPV-GHILASAAKDRTIRF 365

>KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131C RRB1 RiboSome Assembly 2
          Length = 522

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/239 (21%), Positives = 106/239 (44%), Gaps = 23/239 (9%)

Query: 156 GYGLSFNPVDK-GKLLSGSDDSKIALWDI-TTNSTKPVSTWESCHQDGVNDCKWHELNGN 213
           GY L ++P++K G LL+G    ++ L    T+      + + + +   + D ++      
Sbjct: 287 GYALDWSPLNKSGSLLTGDCSGRVYLTQRHTSKWITDKTAFSAGNNQSIEDIQFSRTEAT 346

Query: 214 TFGSVSEDCTLQLHDQRVKD---SVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLY 270
            F S   D  +++ D R K    +++ K  + T  N I++++    L A+   +    ++
Sbjct: 347 VFASCGCDGYIRIWDTRSKKHKPAISVK-ASATDVNVISWNEKIGYLLASGDDNGSWGVW 405

Query: 271 DSRR-TGNVLHTMSG------HESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL-MEIGAE 322
           D R+ + N   + S       H+  +T++ F    D I+  + ED  V +WDL +E   E
Sbjct: 406 DLRQFSPNTAASTSPVAQYNFHKGAITSISFNPLDDSIIAVASEDNTVSLWDLSVEADDE 465

Query: 323 QVPDDADDG------SPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSS 375
           ++   A +        P+++ +H   +  V D   +  IP  + S   + +  +WK  S
Sbjct: 466 EIKQQAAETRELQEIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NIWKTIS 521

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 12/42 (28%), Positives = 25/42 (59%)

Query: 146 LSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNS 187
           ++   FH+     +SFNP+D   +   S+D+ ++LWD++  +
Sbjct: 421 VAQYNFHKGAITSISFNPLDDSIIAVASEDNTVSLWDLSVEA 462

>Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 62/293 (21%), Positives = 115/293 (39%), Gaps = 49/293 (16%)

Query: 122 LIATINGSGTVFLYDRS--------------KDGDEGLLSSLGFHEDNGYGLSFNPVDK- 166
           L AT++ +G V++YD +              K     + +        GYGL ++P+ K 
Sbjct: 226 LTATMSENGDVYIYDLAPQSKAFATPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKT 285

Query: 167 GKLLSGSDDSKIALWDITTNSTKPVSTWESCHQ-------DGVNDCKWHELNGNTFGSVS 219
           G LLSG    ++        + +  S W +  Q         + D +W       F +  
Sbjct: 286 GSLLSGDCSGQVYF------TQRHTSRWVTDKQPFTVSNNKSIEDIQWSRSESTVFATAG 339

Query: 220 EDCTLQLHDQRVKD---SVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRR-- 274
            D  +++ D R K    +++ K    T  N I++S     L A+   +    ++D R+  
Sbjct: 340 CDGYIRIWDTRSKKHKPAISVKASN-TDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFT 398

Query: 275 -----TGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL-MEIGAEQVPDDA 328
                +   +     H+  +T++ F    + IV    ED  V +WDL +E   E++    
Sbjct: 399 PSNADSVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQT 458

Query: 329 DDGS------PEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSS 375
            +        P+++ +H   +  V D   +  IP  + S   + +  VWK  S
Sbjct: 459 AETKELQEIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NVWKTIS 508

>NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.534
           YKL213C
          Length = 725

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 74/176 (42%), Gaps = 14/176 (7%)

Query: 142 DEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWE-SCHQD 200
           D+  L +L  H  N   LS+  +    ++SGS D+   +W            W    HQ 
Sbjct: 91  DKDPLYTLIGHHSNVCALSYKHM--SAIISGSWDTTAKVW------INGALQWSLEGHQA 142

Query: 201 GVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAA 260
            V D K   +  NTF + S D T++L  +         I +    N    S  S    A 
Sbjct: 143 SVWDAKIISVEENTFITASADRTVKLWKENKLLKTFSGIHSDVIRNIEVLS--SGKEIAT 200

Query: 261 AGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL 316
              D  I + D    GN+   +SGHES V N++     D +V S GEDR + +WD+
Sbjct: 201 CSNDGTIKISD--LDGNIKQVLSGHESFVYNVKLSKQGDKLV-SCGEDRSLRIWDI 253

>AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,
           334 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YMR116C (ASC1); 1-intron
          Length = 334

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 60/244 (24%), Positives = 109/244 (44%), Gaps = 29/244 (11%)

Query: 142 DEGLLSSLGFHEDNGY--GLSFNPVDKGKLLSGSDDSKIALWDITTNSTK---PVSTWES 196
           DE L+        NG+   LS +P     LLSGS D  +  W +T    +   PV +++ 
Sbjct: 20  DEILVLRGTLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKG 79

Query: 197 CHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTN 256
            H   V DC     +G    S S D TL+L D +    +   +   +   +++    +T 
Sbjct: 80  -HSHIVQDCTVTH-DGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQ 137

Query: 257 LFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAK---DGI-VMSSGEDRRVI 312
           + +A+  D  + ++++   G+ + T+ GH   V+N+    ++   D + V+S+G D+ V 
Sbjct: 138 IVSAS-RDKTVKVWNT--VGDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKVVK 194

Query: 313 MWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWK 372
           +WDL     E     AD           GH + V   + +P+   + ASA ++  + +W 
Sbjct: 195 VWDLQSFTIE-----AD---------FIGHNNYVTTVTPSPDGS-IFASAGKDGQIILWN 239

Query: 373 CSSK 376
            + K
Sbjct: 240 LNEK 243

>NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON} 
          Length = 859

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 81/212 (38%), Gaps = 47/212 (22%)

Query: 152 HEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNST--------KPVSTWE-------- 195
           H    Y  SF+P D   L+SGS+D  + LW + TN+T         PV  W+        
Sbjct: 585 HSGAVYSTSFSP-DNKYLISGSEDKTVRLWSLDTNTTLVSYKGHNHPV--WDVKFSPLGH 641

Query: 196 --------------SC-----------HQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQR 230
                         SC           H   V DC     NG    + S D T ++ D  
Sbjct: 642 YFATASHDQTARLWSCDHIYPLRIFAGHLSDV-DCVSFHPNGCYVFTGSSDKTCRMWDVS 700

Query: 231 VKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVT 290
             DSV   +       + A S     L +    D +I ++D   TG  L  M GH  N  
Sbjct: 701 TGDSVRLFLGHTAPVISTAVSPDGRWL-STGSEDGIINVWDIG-TGKRLKLMRGHGKNAI 758

Query: 291 NLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAE 322
               Y+ +  +++SSG D  V +WDL +  AE
Sbjct: 759 YSLSYSKEGNVLVSSGADHSVRVWDLKKATAE 790

>Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON}
           (69674..71074) [1401 nt, 467 aa]
          Length = 466

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 85/195 (43%), Gaps = 10/195 (5%)

Query: 152 HEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELN 211
           H      L F P      +SG +D+ I +WD      + +      H   +    +++ +
Sbjct: 172 HRHGTTSLEFFPKTGHLFVSGGNDNVIRIWDFY--HKRELLRDYIGHSKAIKTTNFND-D 228

Query: 212 GNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYD 271
           G  F S S D  +++ D      V  K++  +  N + F   + N +    ++S I  YD
Sbjct: 229 GKMFISSSFDKYVKIWDTET-GKVRSKLRLNSTPNDVKFRPLNPNEYIVGLSNSQIKHYD 287

Query: 272 SR--RTGNVLHTMSGHESNVTNLEFYAAKDGI-VMSSGEDRRVIMWD-LMEIGAEQVPDD 327
           +R      ++     H+S++ NL ++   DG   +SS ED+ V +W+  + I  +Q+ D 
Sbjct: 288 TRVSEKQGLIQVYDHHQSSILNLRYFP--DGTKFISSSEDKSVRIWENQINIPIKQISDT 345

Query: 328 ADDGSPEVVMIHAGH 342
           A    P + +   GH
Sbjct: 346 AQHSMPFINIHPQGH 360

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/111 (21%), Positives = 46/111 (41%), Gaps = 20/111 (18%)

Query: 279 LHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMI 338
           ++   GH    T+LEF+     + +S G D  + +WD                  E++  
Sbjct: 166 IYVYQGHRHGTTSLEFFPKTGHLFVSGGNDNVIRIWDFYH-------------KRELLRD 212

Query: 339 HAGHRSPVNDFSMNPNIPWLMASAEEENIVQVW-----KCSSKLPRVGGLP 384
           + GH   +   + N +    ++S+ ++  V++W     K  SKL R+   P
Sbjct: 213 YIGHSKAIKTTNFNDDGKMFISSSFDK-YVKIWDTETGKVRSKL-RLNSTP 261

>Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 85/181 (46%), Gaps = 14/181 (7%)

Query: 147 SSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCK 206
           S++  H       +F P    ++++G+ D+   +WD  T +  P+ T +  H + V    
Sbjct: 137 SAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQT--PMHTLKG-HYNWVLCVS 193

Query: 207 WHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIK------TVTAFNTIAFSK-HSTNLFA 259
           W   +G    + S D T++L D +  + + D ++      T  ++  I   K  S    A
Sbjct: 194 WSP-DGEVIATGSMDNTIRLWDPKTGECLGDALRGHSKWITSLSWEPIHLVKPGSKPRLA 252

Query: 260 AAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEI 319
           ++  D  I ++D+  +    +TMSGH ++V+ +++     G++ S   DR V +WD+   
Sbjct: 253 SSSKDGTIKIWDT-VSRVCQYTMSGHTNSVSCVKW--GGQGLLYSGSHDRTVRVWDINSQ 309

Query: 320 G 320
           G
Sbjct: 310 G 310

>ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408)
           [960 bp, 319 aa] {ON} highly similar to uniprot|P38011
           Saccharomyces cerevisiae YMR116C ASC1 WD repeat protein
           (G-beta like protein) involved in translation regulation
           required for repression of Gcn4p activity in the absence
           of amino-acid starvation core component of the ribosome
           ortholog of mammalian RACK1
          Length = 319

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/218 (24%), Positives = 96/218 (44%), Gaps = 28/218 (12%)

Query: 169 LLSGSDDSKIALWDITTNSTK---PVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQ 225
           LLS S D  +  W +T +  +   PV +++  H   V DC     +G    S S D TL+
Sbjct: 33  LLSASRDKTLISWKLTGDDKQYGVPVRSFQG-HNHIVQDCS-LTADGAYALSASWDKTLR 90

Query: 226 LHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGH 285
           L D     +    +   +   ++A  + ++ + + +  D  + ++  R  G  L TM GH
Sbjct: 91  LWDVATGQTYQRFVGHKSDVMSVAIDRKASMIISGS-RDRTVKVWTIR--GQCLATMLGH 147

Query: 286 ESNVTNLEFYAAKDG-----IVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHA 340
              V+ +     +D       V+S+G D+ V  W++      Q   +AD           
Sbjct: 148 NDWVSQVRIAPTEDANDDTVTVISAGMDKMVKAWNV-----NQFQIEAD---------FI 193

Query: 341 GHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSKLP 378
           GH + VN  + +P+   L+ASA ++  + +W  + K+P
Sbjct: 194 GHNNYVNTITASPDGS-LVASAGKDGEIMLWNLADKVP 230

 Score = 33.9 bits (76), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 44/95 (46%), Gaps = 10/95 (10%)

Query: 281 TMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHA 340
           T+ GH   VT+L   A +  +++S+  D+ +I W L         DD   G P  V    
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKL-------TGDDKQYGVP--VRSFQ 62

Query: 341 GHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSS 375
           GH   V D S+  +  + + SA  +  +++W  ++
Sbjct: 63  GHNHIVQDCSLTADGAYAL-SASWDKTLRLWDVAT 96

>Skud_11.7 Chr11 complement(15413..17566) [2154 bp, 717 aa] {ON}
           YKL213C (REAL)
          Length = 717

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 58/129 (44%), Gaps = 8/129 (6%)

Query: 197 CHQDGVNDCKWHELNGNTFGSVSEDCTLQL-HDQRVKDSVTDKIKTVTAFNTIAFSKHST 255
            H   V D K   L  N F + S D T++L  + +V  +       V     +  S H  
Sbjct: 135 AHTASVWDAKVVSLAENKFLTASADKTIKLWQNNKVIKTFDGIHNDVVRHLALVDSDH-- 192

Query: 256 NLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWD 315
             F +   D LI L D + TGNVL T  GHES V  ++     +G ++S  EDR V +W 
Sbjct: 193 --FISCSNDGLIKLIDIQ-TGNVLKTFEGHESFVYCVKLLP--NGDIVSCSEDRSVRIWS 247

Query: 316 LMEIGAEQV 324
           +     +QV
Sbjct: 248 MENASLKQV 256

>KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {ON}
           highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093W UTP15 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 507

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 44/92 (47%), Gaps = 2/92 (2%)

Query: 93  FTKSNIKIIKKFKHEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFH 152
           F+    ++IK F   ++V  +    QD  L+A  + +G V +YD      +  L S+   
Sbjct: 66  FSSRTRQVIKTFSRFKDVVYSASFRQDGKLLAMGDATGRVSIYDSYNPRTQ--LVSIAAS 123

Query: 153 EDNGYGLSFNPVDKGKLLSGSDDSKIALWDIT 184
               +   F+P D   L++ SDD  + +WDIT
Sbjct: 124 SHPTHVAKFHPADSRTLVTASDDRVVRVWDIT 155

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 39/181 (21%), Positives = 72/181 (39%), Gaps = 25/181 (13%)

Query: 200 DGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFS---KHSTN 256
           + V    ++  + N F +++    +QL   R +      IKT + F  + +S   +    
Sbjct: 40  NSVTSISFNPTHPNDF-AITSSTRVQLFSSRTRQV----IKTFSRFKDVVYSASFRQDGK 94

Query: 257 LFAAAGTDSLIYLYDSR--RTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMW 314
           L A       + +YDS   RT  V    S H ++V   +F+ A    ++++ +DR V +W
Sbjct: 95  LLAMGDATGRVSIYDSYNPRTQLVSIAASSHPTHVA--KFHPADSRTLVTASDDRVVRVW 152

Query: 315 DLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCS 374
           D+ +    QV                G    V    M P  P L+ +   +  V+++   
Sbjct: 153 DITQAQEPQVE-------------LTGAADYVRSVCMVPQAPHLVVTGSYDGFVRLFDTR 199

Query: 375 S 375
           S
Sbjct: 200 S 200

>KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1159

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 68/156 (43%), Gaps = 10/156 (6%)

Query: 166 KGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQ 225
           K   +  + + K  +W++   S+  +      H   + D  ++  + +   + S D  + 
Sbjct: 82  KPHWIVSTSNQKAIIWNLNKPSSNAIEYALHGHSRAITDINFNSQHPDILATCSIDTYVH 141

Query: 226 LHDQRVKDSVTDKIKTVTAFNTIAFS-----KHSTNLFAAAGTDSLIYLYDSRRTGNVLH 280
             D R   S      T +++ + A       K S  L ++ G D  ++++D R     LH
Sbjct: 142 AWDMR---SPHRPFYTTSSWRSSASQVKWNFKDSNILASSHGND--VFIWDLRHGSTPLH 196

Query: 281 TMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL 316
            ++GH S V +++F   ++  +MSS  D  V  WDL
Sbjct: 197 KLTGHNSGVNSIDFSRFEENKIMSSSNDGTVKFWDL 232

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 40/75 (53%), Gaps = 3/75 (4%)

Query: 110 VTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKL 169
            ++ ++  +DSN++A+ +G+  VF++D         L  L  H      + F+  ++ K+
Sbjct: 162 ASQVKWNFKDSNILASSHGND-VFIWDLRHGSTP--LHKLTGHNSGVNSIDFSRFEENKI 218

Query: 170 LSGSDDSKIALWDIT 184
           +S S+D  +  WD++
Sbjct: 219 MSSSNDGTVKFWDLS 233

>Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}
           YPL247C (REAL)
          Length = 522

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 76/183 (41%), Gaps = 26/183 (14%)

Query: 161 FNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSE 220
           +N VD   ++S S D+   +WD+   S+  V T    H   V D ++   +   F S   
Sbjct: 251 WNTVDTNLIISSSIDTTCIVWDL--QSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGG 308

Query: 221 DCTLQLHDQRV-------------------KDSVTDKIKTVTAFNTIAFSKHSTNLFAAA 261
           D ++++ D R                      + T  +K   A   +  S +  N+ A  
Sbjct: 309 DGSVRVFDLRSLAHSTIIYEPPSSPASGPNAGATTPSLKGSDALLRLEPSPYDPNVLATF 368

Query: 262 GTDS-LIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL---- 316
             DS  I + D R   + +  + GH  +V  ++++  K  +++S  +D + + WDL    
Sbjct: 369 AADSNKIIILDMRNPESPILNLEGHTCSVNEIKWHPTKRNVLLSCSDDCQALYWDLNNSF 428

Query: 317 MEI 319
           MEI
Sbjct: 429 MEI 431

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 41/94 (43%), Gaps = 3/94 (3%)

Query: 234 SVTDKIKTVTAFNTIA---FSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVT 290
           +  D +K +  F  I    ++   TNL  ++  D+   ++D + +  V   +  H+S V 
Sbjct: 232 ATADDMKVIGTFPPITSFDWNTVDTNLIISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVF 291

Query: 291 NLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQV 324
           ++ F      +  S G D  V ++DL  +    +
Sbjct: 292 DVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTI 325

>Kpol_1054.60 s1054 (148854..151013) [2160 bp, 719 aa] {ON}
           (148854..151013) [2160 nt, 720 aa]
          Length = 719

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 86/189 (45%), Gaps = 33/189 (17%)

Query: 138 SKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTN----STKPVST 193
           S+ G++ +L+ +G H  N   L      +G L+SGS D    +W              S 
Sbjct: 91  SEVGEDPILTLVG-HGGNVCSLRLQ---QGTLISGSWDKTSRVWSQGVERYVLKGHTASV 146

Query: 194 WESC---HQDGVNDCKWHELNGNTFGSVSEDCTLQL--HDQRVKDSV---TDKIKTVTAF 245
           W++C   H DG           + F + S D T++L   DQ+V+       D I+ V+  
Sbjct: 147 WDACPVPHFDGTLQ--------DVFITASADKTVRLWKKDQQVQCFTGIHEDVIRKVSVL 198

Query: 246 NTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSS 305
           +       +   F  A  D+ I + D   TG+VL T+SGHES V ++   + K   ++S 
Sbjct: 199 D-------NGRKFVTASNDTTIKICD-LETGSVLKTLSGHESFVYSV-IISPKSKELISC 249

Query: 306 GEDRRVIMW 314
           GEDR V +W
Sbjct: 250 GEDRSVRIW 258

>Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {ON}
           complement(56019..57566) [1548 nt, 516 aa]
          Length = 515

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/244 (20%), Positives = 99/244 (40%), Gaps = 34/244 (13%)

Query: 156 GYGLSFNP-VDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQ-------DGVNDCKW 207
           GY L ++P +  G LL+G    ++        + +  S W +  Q         + D +W
Sbjct: 281 GYALDWSPLIRSGALLTGDCSGQVYF------TQRHTSKWVTDKQPFTVSNNKSIEDIQW 334

Query: 208 HELNGNTFGSVSEDCTLQLHDQRVKD---SVTDKIKTVTAFNTIAFSKHSTNLFAAAGTD 264
                  F +   D  +++ D R K    +++ K    T  N I++++    L A+   +
Sbjct: 335 SRTEATVFATAGCDGYIRVWDTRSKKHKPAISTKASN-TDVNVISWNEKMGYLLASGDDN 393

Query: 265 SLIYLYDSRR------TGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL-M 317
               ++D R+          +     H+  +T++ F+   + IV  + ED  V +WDL +
Sbjct: 394 GTWGVWDLRQFSPSNENAQPVAQYDFHKGAITSISFHPTDESIVAVASEDNTVTLWDLSV 453

Query: 318 EIGAEQVPDDADDGS------PEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVW 371
           E   E++     +        P+++ +H   +  V D   +  IP  + S   + +  +W
Sbjct: 454 EADDEEIKQQTAETKELAQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NIW 510

Query: 372 KCSS 375
           K  S
Sbjct: 511 KTIS 514

>Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 85/181 (46%), Gaps = 14/181 (7%)

Query: 147 SSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCK 206
           S++  H       +F P    ++++G+ D+   +WD  T +  P+ T +  H + V    
Sbjct: 137 SAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQT--PMHTLKG-HFNWVLCVA 193

Query: 207 WHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIK------TVTAFNTIAFSK-HSTNLFA 259
           W   +G    + S D T++L D +  + + D ++      T  ++  I   K  S    A
Sbjct: 194 WSP-DGEVIATGSMDNTIRLWDPKTGECLGDALRGHSKWITSLSWEPIHLVKPGSKPRLA 252

Query: 260 AAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEI 319
           ++  D  I ++D+  +    +TMSGH ++V+ +++     G++ S   DR V +WD+   
Sbjct: 253 SSSKDGTIKIWDT-VSRVCQYTMSGHTNSVSCVKW--GGQGLLYSGSHDRTVRVWDMNSQ 309

Query: 320 G 320
           G
Sbjct: 310 G 310

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 64/299 (21%), Positives = 113/299 (37%), Gaps = 70/299 (23%)

Query: 119 DSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPV------DKGKLLSG 172
           D  +IAT +   T+ L+D  K G E L  +L  H      LS+ P+       K +L S 
Sbjct: 197 DGEVIATGSMDNTIRLWD-PKTG-ECLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASS 254

Query: 173 SDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVK 232
           S D  I +WD  +   +      S H + V+  KW         S S D T+++ D   +
Sbjct: 255 SKDGTIKIWDTVSRVCQYT---MSGHTNSVSCVKWG--GQGLLYSGSHDRTVRVWDMNSQ 309

Query: 233 DSVTDKIK------------TVTAFNTIAF---------------------------SKH 253
               + +K            T  A    AF                           + +
Sbjct: 310 GRCINILKSHAHWVNHLSLSTDYALRVGAFDHTGQKPTSPEDAQKKALANYEKICKKNGN 369

Query: 254 STNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDG-IVMSSGEDRRVI 312
           S  +   A  D  I+L++  ++   +  M+GH+  V ++ F  + DG  ++S+  D  + 
Sbjct: 370 SEEMMVTASDDFTIFLWNPLKSTKPIARMTGHQKLVNHVAF--SPDGRYIVSASFDNSIK 427

Query: 313 MWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVW 371
           +W            D  DG  + +    GH + V   + + +   L+ S  ++  ++VW
Sbjct: 428 LW------------DGRDG--KFISTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVW 471

>Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {ON}
           YMR093W (UTP15) - Protein required for cell viability
           [contig 55] FULL
          Length = 507

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 43/92 (46%), Gaps = 2/92 (2%)

Query: 93  FTKSNIKIIKKFKHEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFH 152
           F+    ++IK F   ++V  +    QD  L+A  + +G V +YD         L S+   
Sbjct: 66  FSSRTRQVIKTFSRFKDVVYSASFRQDGKLLAMGDATGRVSVYD--SYNPRAQLVSIAAS 123

Query: 153 EDNGYGLSFNPVDKGKLLSGSDDSKIALWDIT 184
               +   F+P D   L++ SDD  + +WDIT
Sbjct: 124 SHPTHVAKFHPADSRTLVTASDDRVVRVWDIT 155

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 50/113 (44%), Gaps = 11/113 (9%)

Query: 217 SVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFS---KHSTNLFAAAGTDSLIYLYDSR 273
           +++    +QL   R +      IKT + F  + +S   +    L A       + +YDS 
Sbjct: 56  AITSSTRVQLFSSRTRQV----IKTFSRFKDVVYSASFRQDGKLLAMGDATGRVSVYDSY 111

Query: 274 --RTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQV 324
             R   V    S H ++V   +F+ A    ++++ +DR V +WD+ +    QV
Sbjct: 112 NPRAQLVSIAASSHPTHVA--KFHPADSRTLVTASDDRVVRVWDITQAQEPQV 162

>KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25
           YNL317W
          Length = 452

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 63/137 (45%), Gaps = 8/137 (5%)

Query: 91  DGFTKSNIKIIKKFKHEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLG 150
           D  T + +  I KFKH   V + R+ P   NL+  I+   +  ++D  ++  E ++    
Sbjct: 236 DPRTGNCVSTILKFKHT--VLKTRFQPGGGNLLLGISKDKSCRVFDIRQNMTELMV---- 289

Query: 151 FHEDNGY-GLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHE 209
           F +D  Y  L ++P++      G+ D  I  +D+  + TKPV      H   V    ++ 
Sbjct: 290 FRDDVDYMTLLWHPINHSTFTVGNYDGSIKHFDVLQDITKPVHVIPFAHDKCVTSLSYNP 349

Query: 210 LNGNTFGSVSEDCTLQL 226
             GN   S S+D T++ 
Sbjct: 350 A-GNILASASKDRTIRF 365

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 86/224 (38%), Gaps = 22/224 (9%)

Query: 150 GFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHE 209
           G H +    ++F+  D  K +S SDD+ + +W+ T    + V T    H   V  C WH 
Sbjct: 163 GAHTECIRDVAFSAND-SKFVSCSDDNILKIWNFTNGQQERVLT---GHHWDVKSCDWHP 218

Query: 210 LNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYL 269
             G    S S+D  ++L D R  + V+  +K         F     NL      D    +
Sbjct: 219 TMG-LIASASKDNLVKLWDPRTGNCVSTILKFKHTVLKTRFQPGGGNLLLGISKDKSCRV 277

Query: 270 YDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDAD 329
           +D R+    L         +T L ++            D  +  +D+++           
Sbjct: 278 FDIRQNMTELMVFRDDVDYMT-LLWHPINHSTFTVGNYDGSIKHFDVLQ----------- 325

Query: 330 DGSPEVVMIHAGHRSPVNDFSMNP--NIPWLMASAEEENIVQVW 371
           D +  V +I   H   V   S NP  NI   +ASA ++  ++ W
Sbjct: 326 DITKPVHVIPFAHDKCVTSLSYNPAGNI---LASASKDRTIRFW 366

>NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363
          Length = 621

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 97/238 (40%), Gaps = 69/238 (28%)

Query: 149 LGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWH 208
           L  HE + Y L + P D  KL+SGS D  I +WD+ T                       
Sbjct: 379 LKGHEQDIYSLDYFP-DGQKLVSGSGDRSIRIWDLKTGQ--------------------- 416

Query: 209 ELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIY 268
                        C+L L    ++D VT          T+A S +   L AA   D  + 
Sbjct: 417 -------------CSLTL---SIEDGVT----------TVAVSPNEGKLIAAGSLDRSVR 450

Query: 269 LYDSRRTGNVLHTM-------SGHESNVTNLEFYAAKDGI-VMSSGEDRRVIMWDLMEIG 320
           ++DS  TG ++  +       +GH+ +V ++ F   KDG  V+S   DR V +W+L    
Sbjct: 451 IWDS-STGFLVERLDSDNESGNGHQDSVYSVAF--TKDGQHVVSGSLDRTVKLWNL---- 503

Query: 321 AEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSKLP 378
                 D   G+ +  + + GH+  V   + + +  ++ + +++  ++ +W   S  P
Sbjct: 504 -----GDTQSGTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVI-IWDKDSGNP 555

 Score = 37.7 bits (86), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 59/129 (45%), Gaps = 18/129 (13%)

Query: 247 TIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSG 306
           +I FS       A    D LI +++ +    ++  + GHE ++ +L+++     +V  SG
Sbjct: 346 SICFSPDG-EFLATGAEDKLIRIWNIKER-KIVMVLKGHEQDIYSLDYFPDGQKLVSGSG 403

Query: 307 EDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEEN 366
            DR + +WDL + G   +    +DG              V   +++PN   L+A+   + 
Sbjct: 404 -DRSIRIWDL-KTGQCSLTLSIEDG--------------VTTVAVSPNEGKLIAAGSLDR 447

Query: 367 IVQVWKCSS 375
            V++W  S+
Sbjct: 448 SVRIWDSST 456

>YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coronin,
           cortical actin cytoskeletal component that associates
           with the Arp2p/Arp3p complex to regulate its activity;
           plays a role in regulation of actin patch assembly
          Length = 651

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 74/178 (41%), Gaps = 24/178 (13%)

Query: 161 FNPVDKGKLLSGSDDSKIALWDITTN--------------STKPVSTWESCHQDGVNDCK 206
           F+P +  ++ SGSDDSKI +WDI  N                KPV  + + H   V    
Sbjct: 89  FDPFNDHRIASGSDDSKIGIWDIPENYKFHDHVDEDGEPIDIKPVK-FLTGHARKVGHVL 147

Query: 207 WHELNGNTFGSVSEDCTLQLHDQRV-KDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDS 265
           +H +  N   S S D T++L +    KD +T  +K      +++FS +  N  A    D 
Sbjct: 148 YHPVAENVLASSSGDYTVKLWNVETGKDMIT--LKHPDMVTSMSFS-YDGNYLATVARDK 204

Query: 266 LIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSG----EDRRVIMWDLMEI 319
            + +++ R    ++     H         +      + ++G     DR++ +WD   I
Sbjct: 205 KLRVWNIREE-KIVSEGPAHTGAKNQRVVWLGNSDRLATTGFSKLSDRQIGIWDAFNI 261

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 26/121 (21%), Positives = 53/121 (43%), Gaps = 6/121 (4%)

Query: 259 AAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLME 318
           +  G  ++I + +  +  + +    GH + V + +F    D  + S  +D ++ +WD+ E
Sbjct: 54  SGGGAFAVIPIEEVGKAPDQVPLFRGHTAQVLDTDFDPFNDHRIASGSDDSKIGIWDIPE 113

Query: 319 IGAEQVPDDAD-DGSP---EVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCS 374
               +  D  D DG P   + V    GH   V     +P    ++AS+  +  V++W   
Sbjct: 114 --NYKFHDHVDEDGEPIDIKPVKFLTGHARKVGHVLYHPVAENVLASSSGDYTVKLWNVE 171

Query: 375 S 375
           +
Sbjct: 172 T 172

>ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa]
           {ON} similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195W SEC31 involved in protein transport from
           endoplasmic reticulum to Golgi Component (p150) of COPII
           coat of secretory pathway vesicles
          Length = 1282

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 91/218 (41%), Gaps = 21/218 (9%)

Query: 119 DSNLIATINGSGTVFLYDRSKDGDEGLLSSLGF--HEDNGYGLSFNPVDKGKLLSGSDDS 176
           D+ +IA    +G+V L+  + D    L S   F  H+       FN      L +G    
Sbjct: 73  DNKIIAGALDNGSVELFSYNADS---LKSEAKFQRHKTTAKVARFNAKQFNVLATGGTKG 129

Query: 177 KIALWDIT-----TNSTKPVSTWESCHQ-DGVNDCKWHELNGNTFGSVSEDCTLQLHDQR 230
           +I +WD+       N   P++   S    + +    W++   + F S        + D +
Sbjct: 130 EIFIWDVNKCLENPNDYTPLTPGNSMTPVEEITSLAWNQSLAHVFASAGSTSYASIWDLK 189

Query: 231 VKDSV-----TDKIKTVTAFNTIA--FSKHSTNLFAAAGTDS--LIYLYDSRRTGNVLHT 281
            K  V     T     + A  ++     K+ST +  A G+D+   I ++D R     L  
Sbjct: 190 AKKEVIHLSYTSPNTGLKAPLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQV 249

Query: 282 MS-GHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLME 318
           +S GH   V +L++    + +++SSG D  V++W+  E
Sbjct: 250 LSQGHSKGVLSLDWCNQDENLLLSSGRDNTVVLWNPQE 287

>TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1333

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/201 (21%), Positives = 78/201 (38%), Gaps = 34/201 (16%)

Query: 121 NLIATINGSGTVFLYD--RSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKI 178
           N +A  + S  + +YD  RSK  +  L+SS   H  +     FN V    ++SG  D  I
Sbjct: 193 NYVAVSSNSTVISIYDINRSKSTNNPLVSSFQQHTRSINSFDFNMVHTNLIISGGQDGCI 252

Query: 179 ALWDITTNSTKPVSTWESCHQDGVNDCKW---HELNGNTFGSVSEDCTLQLHDQRVKDSV 235
            +WD+ +N+        S   D V D KW   H  +    G +                 
Sbjct: 253 KIWDLRSNNPNRCDVSISTSSDSVRDVKWMPYHNFSSTPTGGLE---------------- 296

Query: 236 TDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFY 295
                  ++ N++ +       FA+     L+  +D R+   V   ++ H      L ++
Sbjct: 297 ------ASSENSMGYK------FASIHDSGLLLKFDIRQPNQVEQKINAHTGPGLCLNWH 344

Query: 296 AAKDGIVMSSGEDRRVIMWDL 316
              + I  + G D ++ +W+L
Sbjct: 345 PNLNYIT-TGGRDGKLCVWNL 364

>TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa]
           {ON} Anc_6.325 YCR057C
          Length = 901

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/223 (24%), Positives = 97/223 (43%), Gaps = 18/223 (8%)

Query: 116 MPQDSNLIATINGSGTVFLYDRSKDG---------DEGLLSSLGFHEDNGYGLSFNPVDK 166
           M Q+     +IN SG    +  SK G         +  +L   G H D+   L+++P D 
Sbjct: 288 MGQNPVNTVSINSSGEWLAFGSSKLGQLLVYEWQSESYILKQQG-HFDSLNALTYSP-DG 345

Query: 167 GKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQL 226
            ++++ ++D KI +WD+ +     + T E  H   V   ++ +  G    S S D T++ 
Sbjct: 346 SRVVTAAEDGKIKVWDVISGFC--LVTLEG-HTSSVTAVQFAK-RGQVLFSASLDGTVRA 401

Query: 227 HDQ-RVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGH 285
            D  R ++           FN +A    S     A   DS      S +T  +L T+SGH
Sbjct: 402 WDLIRYRNFRVFTAAERIQFNCLAVDP-SGECVCAGSVDSFDIHVWSVQTSQLLDTLSGH 460

Query: 286 ESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDA 328
           E  V+ L F + ++ ++ S+  D+ + +W +     +  P D 
Sbjct: 461 EGPVSCLSF-SQENSVLASASWDKTIRIWSIFGRSQQVEPIDV 502

>Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa]
           {ON} similar to Ashbya gossypii AFR199C
          Length = 318

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 106/233 (45%), Gaps = 31/233 (13%)

Query: 155 NGY--GLSFNPVDKGKLLSGSDDSKIALWDITTNSTK---PVSTWESCHQDGVNDCKWHE 209
           NG+   L+ +P     LLS S D  +  W +T    +   PV +++  H   + DC    
Sbjct: 17  NGWVTSLATSPAQPNMLLSASRDKTLITWRLTGEDQQYGVPVKSFKG-HSHIIQDCTVTN 75

Query: 210 LNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYL 269
            +G    S S D TL+L D    +S+   +   +   +++    +T + +A+  D  + +
Sbjct: 76  -DGKYALSASWDKTLRLWDLASGESLIRFVGHKSDVMSVSIDAGATQIVSAS-RDKTVKV 133

Query: 270 YDSRRTGNVLHTMSGHESNVTNLEFYAAKDG-----IVMSSGEDRRVIMWDLMEIGAEQV 324
           +++   G  + T+ GH   V+++   A KD       V+S+G D+ V +WDL     E  
Sbjct: 134 WNT--VGECVVTLLGHNDWVSHVRI-APKDNADDPVTVISAGMDKVVKVWDLQSFTIE-- 188

Query: 325 PDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSKL 377
              AD           GH + VN  + +P+   + ASA ++  + +W  ++K+
Sbjct: 189 ---AD---------FIGHNNYVNTVTPSPDGS-IFASAGKDGQIMLWNLNAKI 228

>TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON}
           Anc_2.401 YMR131C
          Length = 526

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 59/292 (20%), Positives = 119/292 (40%), Gaps = 48/292 (16%)

Query: 122 LIATINGSGTVFLYD--------------RSKDGDEGLLSSLGFHEDNGYGLSFNPVDK- 166
           L AT++ +G V+++D               SK     + +        G+GL ++P+ K 
Sbjct: 244 LTATMSENGEVYIFDIINQVKSFQIPGYQVSKQSKRPIHTIRSHGNVEGFGLDWSPLIKS 303

Query: 167 GKLLSGSDDSKIALWDITTNSTKPVSTWESCHQD-------GVNDCKWHELNGNTFGSVS 219
           G LL+G    +I L      +++  S W +  Q         + D +W +     F +  
Sbjct: 304 GALLTGDCSGEIFL------TSRHTSKWITEKQSFSVGNNKSIEDIQWSKTEQTVFATAG 357

Query: 220 EDCTLQLHDQRVKD---SVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRR-- 274
            D  +++ D R K    +++ +   V   N I++++    L A+     +  ++D R+  
Sbjct: 358 CDGYIRIWDTRSKKHKPAISTRASNVDV-NVISWNEKMEYLLASGDDKGVWGVWDLRQFS 416

Query: 275 ----TGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL-MEIGAEQVPDDAD 329
                 + +     H+  +T++ F    +  V  + ED  V +WDL +E   E++     
Sbjct: 417 PSQENASPVAQYDFHKGAITSISFNPLDESTVAVASEDNTVTLWDLSVEADDEEIKQQTH 476

Query: 330 DGS------PEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSS 375
           +        P+++ +H   +  V D   +  IP  + S   + +  VWK  S
Sbjct: 477 ETKELEQIPPQLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDGL-NVWKTIS 525

>TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {ON}
           Anc_8.544 YBR198C
          Length = 1034

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/231 (22%), Positives = 92/231 (39%), Gaps = 64/231 (27%)

Query: 145 LLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVND 204
           +  +L  H D  Y ++F+P ++  LLSGS D    LW  +T++ K + +++         
Sbjct: 752 IFKTLVGHSDAVYSVNFSPCNRF-LLSGSGDKTARLW--STDTYKGLVSYKG-------- 800

Query: 205 CKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTD 264
                                 H++ + D              + FS    NLFA A +D
Sbjct: 801 ----------------------HEKPIWD--------------VNFSPTGNNLFATASSD 824

Query: 265 SLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQV 324
           +   ++   R   V   ++GH S+V  + F+      V +   D+   MWDL        
Sbjct: 825 NTARVWSCDRVYPV-RILAGHLSDVDCVSFHP-NGQYVFTGSSDKTSRMWDL-------- 874

Query: 325 PDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSS 375
                  S + V +  GH S V   +++P+  WL ++A E+  + VW   S
Sbjct: 875 ------SSGDSVRLFIGHSSAVTATAVSPDGRWL-STANEDGTITVWDIGS 918

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 87/211 (41%), Gaps = 10/211 (4%)

Query: 106 HEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVD 165
           H   V    + P +  L++   GSG       S D  +GL+S  G HE   + ++F+P  
Sbjct: 759 HSDAVYSVNFSPCNRFLLS---GSGDKTARLWSTDTYKGLVSYKG-HEKPIWDVNFSPTG 814

Query: 166 KGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQ 225
                + S D+   +W  + +   PV    + H   V DC     NG    + S D T +
Sbjct: 815 NNLFATASSDNTARVW--SCDRVYPVRIL-AGHLSDV-DCVSFHPNGQYVFTGSSDKTSR 870

Query: 226 LHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGH 285
           + D    DSV   I   +A    A S       + A  D  I ++D   +G  L +M GH
Sbjct: 871 MWDLSSGDSVRLFIGHSSAVTATAVSPDGR-WLSTANEDGTITVWDIG-SGKKLKSMRGH 928

Query: 286 ESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL 316
             N      Y     I++SSG D  V +WD+
Sbjct: 929 GKNSIYSLSYNKTGNILVSSGADNSVRVWDI 959

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 47/113 (41%), Gaps = 18/113 (15%)

Query: 278 VLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVM 337
           +  T+ GH   V ++ F      ++  SG D+   +W            D   G    ++
Sbjct: 752 IFKTLVGHSDAVYSVNFSPCNRFLLSGSG-DKTARLWST----------DTYKG----LV 796

Query: 338 IHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSKLP-RV--GGLPKVD 387
            + GH  P+ D + +P    L A+A  +N  +VW C    P R+  G L  VD
Sbjct: 797 SYKGHEKPIWDVNFSPTGNNLFATASSDNTARVWSCDRVYPVRILAGHLSDVD 849

>KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 826

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 61/242 (25%), Positives = 103/242 (42%), Gaps = 38/242 (15%)

Query: 138 SKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESC 197
           SK  D+   ++L  H    Y ++F+P D   LLS S+D  + LW + T       T   C
Sbjct: 538 SKAKDQSNSATLVGHSGPVYSVAFSP-DNRYLLSASEDKTVRLWSLDT------FTCLVC 590

Query: 198 HQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAF----NTIAFSK- 252
           ++ G N   W+      F  +        HDQ  +    D I  +  F    N +  S  
Sbjct: 591 YK-GHNHPVWYV----KFSPLGHYFITASHDQTARLWSCDHIYPLRIFSGHLNDVDCSTF 645

Query: 253 HSTNLFAAAG-TDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSG-EDRR 310
           H    +   G +D    ++D  +TG+ +    GH S VT LE   + DG  +++G ED  
Sbjct: 646 HPNGCYVFTGSSDKTCRMWDI-QTGDSVRLFLGHTSPVTALE--VSPDGRWLTTGSEDGT 702

Query: 311 VIMWDLMEIGAEQVPDDADDGSPEVVMIHAGH-RSPVNDFSMNPNIPWLMASAEEENIVQ 369
           +I+WD+              G+ + +    GH ++P+   + N     L+    +++ V+
Sbjct: 703 IIVWDI--------------GTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQS-VR 747

Query: 370 VW 371
           VW
Sbjct: 748 VW 749

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 48/96 (50%), Gaps = 7/96 (7%)

Query: 278 VLHTMSGHESNVTNLEFYAAKDGIVMSSG-EDRRVIMWDLMEIGAEQV-PDDADDGSPEV 335
            ++T      N+T +EF  + D  + ++G +D  + +W L     + + P  A D S   
Sbjct: 490 CMYTFHNTNGNMTCVEF--SDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSA 547

Query: 336 VMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVW 371
            ++  GH  PV   + +P+  +L+ SA E+  V++W
Sbjct: 548 TLV--GHSGPVYSVAFSPDNRYLL-SASEDKTVRLW 580

>YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}
           RSA4WD-repeat protein involved in ribosome biogenesis;
           may interact with ribosomes; required for maturation and
           efficient intra-nuclear transport or pre-60S ribosomal
           subunits, localizes to the nucleolus
          Length = 515

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 84/181 (46%), Gaps = 14/181 (7%)

Query: 147 SSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCK 206
           S++  H       +F P    ++++G+ D+   +WD  T +  P+ T +  H + V    
Sbjct: 137 SAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQT--PMHTLKG-HYNWVLCVS 193

Query: 207 WHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIK------TVTAFNTIAFSK-HSTNLFA 259
           W   +G    + S D T++L D +    + D ++      T  ++  I   K  S    A
Sbjct: 194 WSP-DGEVIATGSMDNTIRLWDPKSGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLA 252

Query: 260 AAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEI 319
           ++  D  I ++D+  +    +TMSGH ++V+ +++     G++ S   DR V +WD+   
Sbjct: 253 SSSKDGTIKIWDT-VSRVCQYTMSGHTNSVSCVKW--GGQGLLYSGSHDRTVRVWDINSQ 309

Query: 320 G 320
           G
Sbjct: 310 G 310

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 89/214 (41%), Gaps = 39/214 (18%)

Query: 166 KGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQ 225
           +G L SGS D  + +WDI +           C    +N  K H    N   S+S D  L+
Sbjct: 289 QGLLYSGSHDRTVRVWDINSQG--------RC----INILKSHAHWVNHL-SLSTDYALR 335

Query: 226 L----HDQRVKDSVTDKIKTVTAFNTIAFSKHSTN---LFAAAGTDSLIYLYDSRRTGNV 278
           +    H  + K S  ++ +     N     K + N   +   A  D  ++L++  ++   
Sbjct: 336 IGAFDHTGK-KPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKP 394

Query: 279 LHTMSGHESNVTNLEFYAAKDG-IVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVM 337
           +  M+GH+  V ++ F  + DG  ++S+  D  + +W            D  DG  + + 
Sbjct: 395 IARMTGHQKLVNHVAF--SPDGRYIVSASFDNSIKLW------------DGRDG--KFIS 438

Query: 338 IHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVW 371
              GH + V   + + +   L+ S  ++  ++VW
Sbjct: 439 TFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVW 471

>NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8.316
           YDR142C
          Length = 398

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 64/286 (22%), Positives = 112/286 (39%), Gaps = 64/286 (22%)

Query: 91  DGFTKSNIKIIKKFKHEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLG 150
           +GF+  NI+    F ++  V  A     +  L+    G+G + + D   DG     +S  
Sbjct: 7   NGFSGYNIQYSPFFDNKLAVASA----SNYGLV----GNGKLVILDILPDGTIKESNSF- 57

Query: 151 FHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHEL 210
             +D  + +++N   + + L    D  + L+DI      P++ ++  H+  V  C W+ +
Sbjct: 58  LTQDCLFDVAWNESHESQCLVAQGDGSLRLFDINLQK-YPIAIFKE-HKKEVLSCNWNLI 115

Query: 211 NGNTFGSVSEDCTLQLHDQRVKDSV-------TDKIKTVTAFNTI--------------- 248
           N N F S S D  +++     + S+       TD    V   + I               
Sbjct: 116 NKNLFLSSSWDGDVKVWSTARQASLITLSPIHTDPTAIVNTKSNINPSLNNVSQPILHPR 175

Query: 249 -------------------------AFSKHSTNLFAAAGTDSLIYLYDSRR-TGNV---L 279
                                     FS H  N+ A     S + L+D R+ T NV   +
Sbjct: 176 STAIRQPVTSASMQGNDNKNCIYQAQFSPHDPNIVACCSGTSYLTLFDLRQPTPNVQRGI 235

Query: 280 HTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVP 325
            T SG+E+    L+F   +  I+ +SG D+ + MWD+  I +   P
Sbjct: 236 LTQSGYET--LTLDFNKYRSHIIATSGVDKAIKMWDMRFIPSTFSP 279

 Score = 37.7 bits (86), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 46/231 (19%), Positives = 90/231 (38%), Gaps = 51/231 (22%)

Query: 110 VTRARYMPQDSNLIATINGSGTVFLYDRSK---DGDEGLLSSLGFHEDNGYGLSFNPVDK 166
           + +A++ P D N++A  +G+  + L+D  +   +   G+L+  G+       L FN    
Sbjct: 197 IYQAQFSPHDPNIVACCSGTSYLTLFDLRQPTPNVQRGILTQSGYET---LTLDFNKYRS 253

Query: 167 GKLLSGSDDSKIALWDI----------TTNST--------KPVSTWESCHQDGVNDCKWH 208
             + +   D  I +WD+          +T++T        +P++   + H   V   KW 
Sbjct: 254 HIIATSGVDKAIKMWDMRFIPSTFSPQSTSTTPILSRRQQEPINEIINAHDLAVKTIKWS 313

Query: 209 ELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIY 268
             + N   S S D T +                   +  I++   ++N      T+SL  
Sbjct: 314 PHHSNLMVSTSYDMTCK------------------TWMDISYQNGTSN----GRTNSL-- 349

Query: 269 LYDSRRTGNVLHTMSGHESNVTNLEF-YAAKDGIVMSSGEDRRVIMWDLME 318
             D +R    L  M  H      +++    + G + S+G D  V +W+ + 
Sbjct: 350 --DPQRRNGCLAIMDKHSEFAFGVDWSLWGQPGFIASTGWDGNVFIWNTLR 398

>YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}
           SEC31Component of the Sec13p-Sec31p complex of the COPII
           vesicle coat, required for vesicle formation in ER to
           Golgi transport; mutant has increased aneuploidy
           tolerance
          Length = 1273

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 77/172 (44%), Gaps = 11/172 (6%)

Query: 210 LNGNTFGSVSEDCTLQLHDQRVKDS--VTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLI 267
           ++G    + S D +L+L      DS      ++  + FN + +S H+  + A A  +  +
Sbjct: 28  VSGTVDANFSTDSSLELWSLLAADSEKPIASLQVDSKFNDLDWS-HNNKIIAGALDNGSL 86

Query: 268 YLYDSRRTGNVLHTM---SGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQV 324
            LY +    N +++M   S H S+V  ++F A +D ++ S G +  + +WD+ +    + 
Sbjct: 87  ELYSTNEANNAINSMARFSNHSSSVKTVKFNAKQDNVLASGGNNGEIFIWDMNK--CTES 144

Query: 325 PDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSK 376
           P +    +P   M        V   + N ++  + ASA   N   +W   +K
Sbjct: 145 PSNYTPLTPGQSMSSVDE---VISLAWNQSLAHVFASAGSSNFASIWDLKAK 193

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/215 (21%), Positives = 98/215 (45%), Gaps = 19/215 (8%)

Query: 119 DSNLIATINGSGTVFLYDRSKDGDEGLLSSLGF--HEDNGYGLSFNPVDKGKLLSGSDDS 176
           ++ +IA    +G++ LY  + + +  + S   F  H  +   + FN      L SG ++ 
Sbjct: 73  NNKIIAGALDNGSLELYS-TNEANNAINSMARFSNHSSSVKTVKFNAKQDNVLASGGNNG 131

Query: 177 KIALWDI-----TTNSTKPVSTWESCHQ-DGVNDCKWHELNGNTFGSVSEDCTLQLHDQR 230
           +I +WD+     + ++  P++  +S    D V    W++   + F S        + D +
Sbjct: 132 EIFIWDMNKCTESPSNYTPLTPGQSMSSVDEVISLAWNQSLAHVFASAGSSNFASIWDLK 191

Query: 231 VKDSVTDKIKTVT------AFNTIAF-SKHSTNLFAAAGTDS--LIYLYDSRRTGNVLHT 281
            K  V     T          + + +  K+ST +  A G+D+   I ++D R     L T
Sbjct: 192 AKKEVIHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILIWDLRNANTPLQT 251

Query: 282 MS-GHESNVTNLEFYAAKDGIVMSSGEDRRVIMWD 315
           ++ GH+  + +L++    + +++SSG D  V++W+
Sbjct: 252 LNQGHQKGILSLDWCHQDEHLLLSSGRDNTVLLWN 286

>AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR196W (PWP1)
          Length = 562

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 78/176 (44%), Gaps = 8/176 (4%)

Query: 152 HEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQ-DGVNDCKWHEL 210
           H D    L+ N   +  L S S D  + LWD+  N  +   + ++ H    V+  +WH  
Sbjct: 270 HTDAVLSLAHNRHFRAVLASTSADHTVKLWDL--NHGRAARSLDAVHSATAVSSSQWHPS 327

Query: 211 NGNTFGSVSEDCTLQLHDQRVK-DSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSL-IY 268
           +G+   +   D  + L D R+  D+   K   V     I  +   +     AGTDS  +Y
Sbjct: 328 DGSILLTAGYDSRVALSDVRIANDAGMSKYWKVMKGEEIESATFVSETVFLAGTDSGNVY 387

Query: 269 LYDSRRTGNV--LHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVI-MWDLMEIGA 321
            +D R   +   L T++ H+S +++L    +   ++++S    +VI +W     GA
Sbjct: 388 SFDLRNGEDSAPLWTLNAHDSGISSLSVSPSIPNMLVTSAMGEKVIKLWKTPAEGA 443

>KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa]
           {ON} Anc_7.310 YDL195W
          Length = 1240

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/213 (23%), Positives = 91/213 (42%), Gaps = 19/213 (8%)

Query: 119 DSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKI 178
           D+  IA    +G + L+  S D    + + L  H  +   L FN   +  L+SGS+  +I
Sbjct: 73  DNKTIAGALDNGIIELFYLSNDQLTSV-AKLTTHTSSVKTLKFNSKQENVLVSGSNKGEI 131

Query: 179 ALWDITTNSTK-----PVSTWESCHQ-DGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVK 232
            +WD  TN  K     P++   +    + +    W++   + F S        + D + K
Sbjct: 132 FVWD--TNKAKQTDYVPMTPGTAMTPLEEITSLSWNQSLAHVFASAGATVYASIWDLKAK 189

Query: 233 DSVTDKIKTVTA------FNTIAF-SKHSTNLFAAAGTDS--LIYLYDSRRTGNVLHTM- 282
             V     T  A       + + +   +ST +  A G D+   I ++D R     L  + 
Sbjct: 190 KEVIHLSYTSPATGLKSQLSVVEWHPNNSTRVATATGNDNDPSILVWDLRNANTPLQVLD 249

Query: 283 SGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWD 315
            GH   + +L++    + +++SSG D  V++W+
Sbjct: 250 QGHSKGIISLDWCHEDESLMLSSGRDNTVLLWN 282

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 49/108 (45%), Gaps = 6/108 (5%)

Query: 212 GNTFGSVSEDCTLQLHDQRVKDSV--TDKIKTVTAFNTIAFSKHSTNLFAAA--GTDSLI 267
           G    + S D  L+L      D+V     I T T FN + +S  +  +  A   G   L 
Sbjct: 30  GTIDANFSSDSVLELWSLLSTDTVKPVASISTDTKFNDLDWSYDNKTIAGALDNGIIELF 89

Query: 268 YLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWD 315
           YL + + T   +  ++ H S+V  L+F + ++ +++S      + +WD
Sbjct: 90  YLSNDQLTS--VAKLTTHTSSVKTLKFNSKQENVLVSGSNKGEIFVWD 135

>Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {ON}
           YKR036C (REAL)
          Length = 645

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 90/218 (41%), Gaps = 37/218 (16%)

Query: 146 LSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDC 205
           L +   H D    LSF   D   L+SGS D KI  WD+ T   K V   +       ND 
Sbjct: 419 LHNFELHSDEITALSF---DSEALISGSKDRKILHWDLVTG--KCVQQLDLIVTPTYNDT 473

Query: 206 KWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDS 265
           K    + N   S             V  S    I  +  +N+           A+   D 
Sbjct: 474 KVSARSANNSTS-------------VLGSEAPMIGALQCYNSA---------LASGTKDG 511

Query: 266 LIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL-----MEIG 320
           ++ L+D  R G  +  + GH   +T+L+F + K   +++   D  V +WDL     +++ 
Sbjct: 512 VVRLWD-LRIGKPVRALEGHTDGITSLKFDSEK---LVTGSMDNSVRIWDLRTSSIIDVI 567

Query: 321 AEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWL 358
           A  +P  + D   +++ + A + + VN F+M  +  W+
Sbjct: 568 AYDLPITSLDFDDKLITVGA-NETGVNVFNMERDEHWM 604

>KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.340
           YCR072C
          Length = 515

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 91/185 (49%), Gaps = 15/185 (8%)

Query: 147 SSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCK 206
           S++  H       +F P    ++++G+ D+   +WD  T +  P++T  + HQ+ V    
Sbjct: 137 SAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQT--PMTT-LTGHQNWVLCVS 193

Query: 207 WHELNGNTFGSVSEDCTLQLHD----QRVKDSVTDKIKTVTAFN--TIAFSKHSTN-LFA 259
           W   +G    + S D T++L +    + + + +   +K +T+ +   +   K       A
Sbjct: 194 WSP-DGEIIATGSMDNTIRLWESDRGKPLGEPLRGHLKWITSLSWEPLHLVKAGEKPRLA 252

Query: 260 AAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEI 319
           +A  D  I ++D+ R   V +T+SGH ++V+ +++     G++ S   D+ V +WD M +
Sbjct: 253 SASKDGTIKIWDTVRRVCV-YTLSGHTNSVSCVKW--GGQGVLYSGSHDKTVRVWD-MNL 308

Query: 320 GAEQV 324
           G + +
Sbjct: 309 GGKCI 313

>NDAI0H02250 Chr8 (546983..548821) [1839 bp, 612 aa] {ON} Anc_2.470
           YMR092C
          Length = 612

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 65/143 (45%), Gaps = 9/143 (6%)

Query: 103 KFKHEQE--VTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLS 160
           +  H+Q   +   ++ P +   + ++     +  YD  K G+       G H+ NG   +
Sbjct: 199 RMHHDQGKFIRDVKFSPDNGEFVVSVGSDRKIVCYD-GKTGEFIKYIEDGSHQINGGNFA 257

Query: 161 FNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHEL---NGNTFGS 217
            + +D  K ++ S DSKIA+WD+TT+  + V  W     D +   +   +     N   S
Sbjct: 258 LDWIDSNKFVTASADSKIAVWDVTTSKCEQV--WTVTGSDSLKTQQVGVVVATKNNQIVS 315

Query: 218 VSEDCTLQLHDQRVKDSVTDKIK 240
           +S D TL +  Q  +DS+   IK
Sbjct: 316 LSLDGTLNIF-QMGQDSILRSIK 337

>ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {ON}
           similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003C CDH1 CDC20 homolog 1 protein required for Clb2
           and Ase1 degradation
          Length = 560

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 63/145 (43%), Gaps = 9/145 (6%)

Query: 196 SCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHST 255
           S H D V    W   N     S S D  +   D R+ DS  ++I+  T            
Sbjct: 335 SGHMDRVACLSW---NNYVLTSGSRDRRILHRDVRIPDSYFERIEAHTQEVCGLKWNVDD 391

Query: 256 NLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSG--EDRRVIM 313
           N  A+ G D+++++YDS     VL T + H + V  + +   K G++ S G   DRR+ +
Sbjct: 392 NKLASGGNDNMLFVYDSTARNPVL-TFNEHTAAVKAMAWSPHKRGVLGSGGGTADRRLKV 450

Query: 314 WDLMEIGAEQVPDDADDGSPEVVMI 338
           W+   +   Q   D D GS    M+
Sbjct: 451 WN---VNTSQKISDVDTGSQVCNMV 472

>Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar to
           Ashbya gossypii ADR242C
          Length = 522

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 57/292 (19%), Positives = 116/292 (39%), Gaps = 47/292 (16%)

Query: 122 LIATINGSGTVFLYDRS--------------KDGDEGLLSSLGFHEDNGYGLSFNPVDK- 166
           L AT++ +G  ++YD                K   + L S        GYGL ++P+ K 
Sbjct: 239 LAATMSENGEAYIYDLGPQVKAFTSPGYQIPKTAQKPLHSIRNHGNVEGYGLDWSPLIKT 298

Query: 167 GKLLSGSDDSKIALWDITTNSTKPVSTWESCHQ-------DGVNDCKWHELNGNTFGSVS 219
           G +L+G    ++ L      + +  S W +  Q         + D +W       F +  
Sbjct: 299 GSILTGDCSGRVYL------TQRTASRWVTDKQPFTVGNNKSIEDIQWSRAEMTVFATCG 352

Query: 220 EDCTLQLHDQRVKD--SVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRR--- 274
            D  +++ D R K        + + T  N +++++    L A+        ++D R+   
Sbjct: 353 VDGHIRIWDTRSKKHKPALSVMVSDTDVNVMSWNEKIGYLLASGDDSGTWGVWDLRQFSA 412

Query: 275 ----TGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL-MEIGAEQVPDDAD 329
                   +   + H++ +T++ F    + I+  + ED  V +WDL +E   E++     
Sbjct: 413 QNTEKTTPVAQYNFHKAAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQTA 472

Query: 330 DGS------PEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSS 375
           + +      P+++ +H   +  V D   +  IP  + S   + +  +WK  S
Sbjct: 473 ETAELQQIPPQLLFVH--WQRDVKDVKWHRQIPGCLVSTGTDGL-NIWKTIS 521

>Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa]
           {ON} complement(112044..114575) [2532 nt, 844 aa]
          Length = 843

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 86/224 (38%), Gaps = 65/224 (29%)

Query: 152 HEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELN 211
           H    Y  SF+P D   L+SGS+D  + LW + T ST  + +++  H   V D  +  + 
Sbjct: 562 HSGAVYSTSFSP-DNKLLISGSEDKTVRLWAMDTQST--LVSYKG-HNHPVWDVAFSPM- 616

Query: 212 GNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYD 271
           G+ F + S       HDQ  +    D I             +S  +FA            
Sbjct: 617 GHYFATAS-------HDQTARLWSCDHI-------------YSLRIFA------------ 644

Query: 272 SRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDG 331
                       GH S+V  + F+      V +   D+   MWD+               
Sbjct: 645 ------------GHLSDVDCVTFHP-NGCYVFTGSSDKTCRMWDV--------------S 677

Query: 332 SPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSS 375
           + E V +  GH +PV    ++P+  WL AS  E+ ++ VW   S
Sbjct: 678 TGETVRLFLGHTAPVVSLGVSPDGRWL-ASGSEDGLINVWDIGS 720

>Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar to
           Ashbya gossypii AAR078W
          Length = 603

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 76/171 (44%), Gaps = 8/171 (4%)

Query: 152 HEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQ-DGVNDCKWHEL 210
           H D    LS N   +  L S S D  I LWD+  N    V +  S H    V+  +WH  
Sbjct: 309 HTDAVLSLSHNKQYRVVLASTSADQTIKLWDL--NQGTAVRSIASIHNGTTVSSSQWHPS 366

Query: 211 NGNTFGSVSEDCTLQLHDQRV-KDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDS-LIY 268
           +G+   + + D  + L D R+  DS   K  +V     +       +    AGTDS  IY
Sbjct: 367 DGSIILTGAYDSRVALSDVRISNDSEMSKYWSVMTGEEVECVSFVNDNEFLAGTDSGNIY 426

Query: 269 LYDSR--RTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVI-MWDL 316
            +D R     + L T+  H+S ++++   +    +++SS    +VI +W +
Sbjct: 427 SFDLRNGEKSSPLWTLKAHDSGISSMNVNSFIPNMMVSSAMGEKVIKLWKI 477

>YLR196W Chr12 (543968..545698) [1731 bp, 576 aa] {ON}  PWP1Protein
           with WD-40 repeats involved in rRNA processing;
           associates with trans-acting ribosome biogenesis
           factors; similar to beta-transducin superfamily
          Length = 576

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 64/146 (43%), Gaps = 7/146 (4%)

Query: 152 HEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQD-GVNDCKWHEL 210
           H D    ++ N   +  L S S D  + LWD+  NS     +  S H +  V+  +WH L
Sbjct: 285 HTDAVLSMAHNKYFRSVLASTSADHTVKLWDL--NSGNAARSLASIHSNKNVSSSEWHML 342

Query: 211 NGNTFGSVSEDCTLQLHDQRVKD-SVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSL-IY 268
           NG+   +   D  + L D R+ D S   K  +  A   I     ++      GTDS  +Y
Sbjct: 343 NGSILLTGGYDSRVALTDVRISDESQMSKYWSAMAGEEIETVTFASENIILCGTDSGNVY 402

Query: 269 LYDSRRTGNV--LHTMSGHESNVTNL 292
            +D R   N   + T+  H++ ++ L
Sbjct: 403 SFDIRNNENRKPVWTLKAHDAGISTL 428

>KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} similar
           to uniprot|P20484 Saccharomyces cerevisiae YKL021C MAK11
           Protein essential for cell growth and replication of M
           dsRNA virus contains four beta-transducin repeats
          Length = 390

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 61/127 (48%), Gaps = 25/127 (19%)

Query: 254 STNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDG---------IVMS 304
           S     +   D  I +YD ++    L T+ GH+ ++TNL F   KD           ++S
Sbjct: 50  SKRYLVSGSNDENIRIYDLQKRKE-LGTLLGHQGSITNLRFSRGKDADGQDIQLNKWLLS 108

Query: 305 SGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEE 364
           + ED ++I+W        +V D  + G+ +      GH + +NDF ++P+   +  S  E
Sbjct: 109 ASEDHKIIVW--------RVKDWENFGTLK------GHTARINDFDIHPS-NRVAVSVSE 153

Query: 365 ENIVQVW 371
           ++ +++W
Sbjct: 154 DHSIRLW 160

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 24/37 (64%), Gaps = 1/37 (2%)

Query: 281 TMSGHESNVTNLEFYAAKDG-IVMSSGEDRRVIMWDL 316
           ++ GH + V + +FY  K G  +++ G D R+++WD+
Sbjct: 272 SLLGHSNRVKDFQFYHNKFGHYLVTIGSDGRIVVWDM 308

>NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672
          Length = 431

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 55/226 (24%), Positives = 98/226 (43%), Gaps = 30/226 (13%)

Query: 159 LSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSV 218
           +  +PVD     +GS+D+ I +WD+     K      + H   V D    + +   F S 
Sbjct: 125 IEVDPVDNEWFATGSNDTTIKIWDLAKGKLKVT---LAGHIMTVRDIAISKRHPYLF-SA 180

Query: 219 SEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHST-NLFAAAGTDSLIYLYDSRRTGN 277
           SED  ++  D     ++ D    ++  +++    H T +L A AG DS++ L+D R    
Sbjct: 181 SEDKLVKCWDLEKNMAIRDYHGHLSGVHSVDI--HPTLDLIATAGRDSVVRLWDIRARVA 238

Query: 278 VLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVM 337
           V+ T+ GH++ +  +      D  ++S   D  + +WD++             G    V+
Sbjct: 239 VM-TLIGHKNPINKVHCLPV-DPQIVSCSTDATIRLWDIVA------------GKSMKVI 284

Query: 338 IHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSKLPRVGGL 383
            H  H+  V + + +P       S+   N ++ W    KLP  GGL
Sbjct: 285 TH--HKKSVRNIAFHPTE--FSMSSCSANDIRSW----KLPE-GGL 321

>CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa]
           {ON} similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198c Transcription initiation factor TFIID 90
          Length = 806

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 88/221 (39%), Gaps = 47/221 (21%)

Query: 147 SSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCK 206
           S+L  H    Y  SF+P D   L+SGS+D  + LW + T++   +  ++  H   V D K
Sbjct: 527 STLVGHSGTVYSTSFSP-DNMYLVSGSEDKTVKLWSMDTHTA--LVNYKG-HNHPVWDVK 582

Query: 207 WHELNGNTFGSVSEDCTLQL------HDQRVKDSVTDKIKTV------------------ 242
           +  L G+ F S S D T +L      +  R+    T+ + TV                  
Sbjct: 583 FSPL-GHYFASASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTC 641

Query: 243 ------TAFNTIAFSKHSTNLF-----------AAAGTDSLIYLYDSRRTGNVLHTMSGH 285
                 T  +   F  H+  +            A    D +I L+D   TG  +  M GH
Sbjct: 642 RMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLWDIG-TGKRIKQMRGH 700

Query: 286 ESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPD 326
             N  +   +  +  +++S G D  V +WD+     EQ P+
Sbjct: 701 GKNAVHSLSFNKEGNVLISGGADHSVRVWDVKHGTTEQGPE 741

>Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON}
           YBR198C (REAL)
          Length = 802

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 83/222 (37%), Gaps = 47/222 (21%)

Query: 142 DEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNST--------KPVST 193
           D+    +L  H    Y  SF+P D   LLSGS+D  + LW + T++          PV  
Sbjct: 518 DDPTCKTLVGHSGTVYSTSFSP-DNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPV-- 574

Query: 194 WE----------------------SC-----------HQDGVNDCKWHELNGNTFGSVSE 220
           W+                      SC           H + V DC     NG    + S 
Sbjct: 575 WDVNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDV-DCVSFHPNGCYVFTGSS 633

Query: 221 DCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLH 280
           D T ++ D    DSV   +        IA S     L +    D +I ++D   TG  L 
Sbjct: 634 DKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWL-STGSEDGIINIWDIG-TGKRLK 691

Query: 281 TMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAE 322
            M GH  N      Y+ +  +++S G D  V +WDL +   E
Sbjct: 692 QMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLKKATTE 733

>Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {ON}
           YKR036C (REAL)
          Length = 662

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 88/213 (41%), Gaps = 37/213 (17%)

Query: 151 FHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHEL 210
            H+D    LSF   D   L+SGS D KI  WD+ T   K +   +       ND +    
Sbjct: 441 IHDDEITALSF---DSEALISGSKDKKILHWDMATG--KCIQQLDLIFAPTHNDSRISAP 495

Query: 211 NGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLY 270
           + N             +  R+ D+    I  +  + +           A    D ++ L+
Sbjct: 496 SSN-------------YSTRLLDTDAPMIGALQCYKSA---------LATGTKDGIVRLW 533

Query: 271 DSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL-----MEIGAEQVP 325
           D  R G  +  + GH   +T+L+F + K   +++   D  V +WDL     +++ A  +P
Sbjct: 534 D-LRVGKPVRLLRGHTDGITSLKFDSEK---LVTGSMDNSVRIWDLRTSSVVDVIAYDLP 589

Query: 326 DDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWL 358
             + D   +++ + A  R  VN F+M  +  W+
Sbjct: 590 VTSLDFDDKLIAVGANERG-VNVFNMELDEHWM 621

>Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa]
           {ON} YCR084C (TUP1) - glucose repression regulatory
           protein, exhibits similarity to beta subunits of G
           proteins [contig 17] FULL
          Length = 750

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 54/241 (22%), Positives = 95/241 (39%), Gaps = 60/241 (24%)

Query: 145 LLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVND 204
           ++ +L  HE + Y L + P    KL+SGS D  + +WD+ T                   
Sbjct: 504 IVMTLQGHEQDIYSLDYFP-SGDKLVSGSGDRTVRIWDLRTG------------------ 544

Query: 205 CKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTD 264
                            C+L L    ++D VT          T+A S     L AA   D
Sbjct: 545 ----------------QCSLTLS---IEDGVT----------TVAVSPGDGKLIAAGSLD 575

Query: 265 SLIYLYDSRRTGNVLHTM-------SGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLM 317
             + ++DS  TG ++  +       +GH+ +V ++ F     G+V S   DR V +W+L 
Sbjct: 576 RTVRIWDS-ETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVV-SGSLDRSVKLWNLR 633

Query: 318 EIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSKL 377
                     A+  + EV   + GH+  V   +   N  ++++ +++  ++  W   S  
Sbjct: 634 SANGGTAEGKANTAASEVT--YTGHKDFVLSVATTQNDEFILSGSKDRGVL-FWDTPSGN 690

Query: 378 P 378
           P
Sbjct: 691 P 691

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 58/127 (45%), Gaps = 18/127 (14%)

Query: 245 FNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMS 304
             ++ FS       A    D LI ++D   T  ++ T+ GHE ++ +L+++ + D +V  
Sbjct: 473 IRSVCFSPDG-KFLATGAEDKLIRIWD-LATRRIVMTLQGHEQDIYSLDYFPSGDKLVSG 530

Query: 305 SGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEE 364
           SG DR V +WDL   G   +    +DG              V   +++P    L+A+   
Sbjct: 531 SG-DRTVRIWDL-RTGQCSLTLSIEDG--------------VTTVAVSPGDGKLIAAGSL 574

Query: 365 ENIVQVW 371
           +  V++W
Sbjct: 575 DRTVRIW 581

>TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.122
           YGL003C
          Length = 556

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 56/123 (45%), Gaps = 6/123 (4%)

Query: 196 SCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHST 255
           S H+D V    W   N +   S S D  +   D RV DS  ++I+T +           +
Sbjct: 331 SGHKDRVACLSW---NNHILTSGSRDRRILHRDVRVPDSFFERIETHSQEVCGLKWNPES 387

Query: 256 NLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSG--EDRRVIM 313
           N  A+ G D+++Y+YD      VL     H + V  L +   K GI+ S G   DR++  
Sbjct: 388 NKLASGGNDNMVYVYDGTSRSPVLK-FEEHTAAVKALAWSPHKRGILASGGGTADRKLKT 446

Query: 314 WDL 316
           W++
Sbjct: 447 WNV 449

>Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}
           similar to Ashbya gossypii AAL157C
          Length = 484

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 57/130 (43%), Gaps = 4/130 (3%)

Query: 176 SKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSV 235
           ++I LWDI  N  KP+S   S   D +   K+++   +   S   D ++ L+D R  +S 
Sbjct: 195 AQIELWDI--NRRKPLSNL-SWGIDNITAVKFNQNEADLLLSSGSDNSVVLYDLRT-NSP 250

Query: 236 TDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFY 295
           T KI      N++ ++      F  A  D   Y YD R     LH    H S + +++  
Sbjct: 251 TQKIVQTMKTNSMCWNPMEPFNFVTANEDQNAYYYDMRNMSRALHVFKDHVSAIMDVDIS 310

Query: 296 AAKDGIVMSS 305
              + IV  S
Sbjct: 311 PTGEEIVTGS 320

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 11/107 (10%)

Query: 126 INGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITT 185
           + G   + L+D ++      LS+L +  DN   + FN  +   LLS   D+ + L+D+ T
Sbjct: 191 VTGGAQIELWDINR---RKPLSNLSWGIDNITAVKFNQNEADLLLSSGSDNSVVLYDLRT 247

Query: 186 NS--TKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQR 230
           NS   K V T ++      N   W+ +    F + +ED     +D R
Sbjct: 248 NSPTQKIVQTMKT------NSMCWNPMEPFNFVTANEDQNAYYYDMR 288

>KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa]
           {ON} Anc_4.309 YLR429W
          Length = 620

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 77/177 (43%), Gaps = 22/177 (12%)

Query: 161 FNPVDKGKLLSGSDDSKIALWDITTNST--------------KPVSTWESCHQDGVNDCK 206
           F+P +  ++ S SDDSKIA+W+I  + +              KPV  W + H   V    
Sbjct: 89  FDPFNDRRIASCSDDSKIAIWEIPEDYSFHKYVDADNEPKDVKPVK-WLAGHGRKVGHVL 147

Query: 207 WHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSL 266
           +H +  N   S S D T+++ +    + V   +K      +++FS +  +L A  G D  
Sbjct: 148 FHPVAENILASSSLDYTVKIWNVETGE-VVYTLKHPDMVTSMSFSYNGAHL-ATVGRDKK 205

Query: 267 IYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSG----EDRRVIMWDLMEI 319
           + ++D  R   ++   + H    T    +      + ++G     DR++ +WD   +
Sbjct: 206 LRVWDI-RAEKIVSEGAAHAGAKTQRVIWLGNSDRLATTGFSRLSDRQIGIWDAFNL 261

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 69/156 (44%), Gaps = 10/156 (6%)

Query: 224 LQLHDQRVKDSVTDK--IKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHT 281
           LQ  + +V ++  D   IKT   F ++ ++      FA      +I + +  +  + +  
Sbjct: 23  LQYENVKVTNNAWDSNIIKTNGKFLSVNWNASGGGAFA------VIPVEEVGKAPDQVPL 76

Query: 282 MSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIH-- 339
             GH + V + +F    D  + S  +D ++ +W++ E  +     DAD+   +V  +   
Sbjct: 77  FRGHTAQVLDTDFDPFNDRRIASCSDDSKIAIWEIPEDYSFHKYVDADNEPKDVKPVKWL 136

Query: 340 AGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSS 375
           AGH   V     +P    ++AS+  +  V++W   +
Sbjct: 137 AGHGRKVGHVLFHPVAENILASSSLDYTVKIWNVET 172

>KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247C Hypothetical ORF
          Length = 420

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 46/215 (21%), Positives = 83/215 (38%), Gaps = 47/215 (21%)

Query: 139 KDGDEGLLSSLG-------FHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPV 191
           K G +G +++LG       FH        +N VD   ++S S D+   +WD+   +T  V
Sbjct: 152 KSGGQGTVAALGQLPPVSSFH--------WNAVDPNLIISSSIDTTCTVWDL--QATNYV 201

Query: 192 STWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVT--------------- 236
            T    H   V D K+   +   F S   D ++++ D R     T               
Sbjct: 202 KTQLIAHDSEVFDVKFLTQSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPSSQPTAGSSG 261

Query: 237 --------------DKIKTVTAFNTIAFSKHSTNLFAAAGTDS-LIYLYDSRRTGNVLHT 281
                                A   +  S    N+ A    DS  + + D R  G  + T
Sbjct: 262 DSSAASGGSGSGSNSASSGSNALLRLEPSPFDPNVVATFAHDSNSVLILDMRYPGAAILT 321

Query: 282 MSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL 316
           + GH   V  ++++ ++  ++++ G+D + ++WDL
Sbjct: 322 LEGHVGAVNQIQWHPSRHNVLLTCGDDCQALLWDL 356

 Score = 33.5 bits (75), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 57/137 (41%), Gaps = 29/137 (21%)

Query: 117 PQDSNLIATI-NGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDD 175
           P D N++AT  + S +V + D    G   L  +L  H      + ++P     LL+  DD
Sbjct: 291 PFDPNVVATFAHDSNSVLILDMRYPGAAIL--TLEGHVGAVNQIQWHPSRHNVLLTCGDD 348

Query: 176 SKIALWDITTNSTKPVST-----WESCH--------QDGVNDCKWHELN-------GNTF 215
            +  LWD+ T+ + P S      W S          Q+  +D   +E+N       GN F
Sbjct: 349 CQALLWDLNTHLSTPASNTVSSKWNSSKVARCIDTPQEAYSDAN-YEINNIVWRPQGNWF 407

Query: 216 GSVSEDCTLQLHDQRVK 232
           G     C L  H Q V+
Sbjct: 408 G-----CNLGRHFQSVR 419

>TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.399
           YNL006W
          Length = 304

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 63/127 (49%), Gaps = 24/127 (18%)

Query: 257 LFAAAGTDSLIYLYD-SRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWD 315
           L AAAG+++ I LYD +    N + +  GH++NVT++ F      +V SS ED  + +WD
Sbjct: 46  LLAAAGSNN-IKLYDVNTSNSNPIASFDGHKNNVTSINFQVENKWMVTSS-EDNTIKLWD 103

Query: 316 LMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVW---- 371
           +               SP        H  PVN+  ++PN   L++  ++ NI ++W    
Sbjct: 104 IRS-----------PSSPRTY----KHNCPVNEVIIHPNQGELISCDKDGNI-RIWDLGE 147

Query: 372 -KCSSKL 377
            +C+ +L
Sbjct: 148 NQCTHQL 154

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 48/92 (52%), Gaps = 5/92 (5%)

Query: 96  SNIKIIKKFK-HEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHED 154
           SN+K I KFK H+  +T+   +  D   +AT +   T  ++  S + +  L  +L  H+ 
Sbjct: 196 SNLKPITKFKAHDSYITKI-LLSSDVKYMATCSADHTARIW--SVEDNFTLDKTLTGHQR 252

Query: 155 NGYGLSFNPVDKGKLLSGSDDSKIALWDITTN 186
             +  +F+  D   L++ S D  + LWD++TN
Sbjct: 253 WVWDCAFS-ADSAYLVTASSDHYVRLWDLSTN 283

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 39/205 (19%), Positives = 91/205 (44%), Gaps = 15/205 (7%)

Query: 168 KLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLH 227
           KLL+ +  + I L+D+ T+++ P+++++  H++ V    +   N     S SED T++L 
Sbjct: 45  KLLAAAGSNNIKLYDVNTSNSNPIASFDG-HKNNVTSINFQVENKWMVTS-SEDNTIKLW 102

Query: 228 DQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHES 287
           D R   S     K     N +    +   L  +   D  I ++D        H ++  ++
Sbjct: 103 DIRSPSS-PRTYKHNCPVNEVIIHPNQGELI-SCDKDGNIRIWDLGE-NQCTHQLTPEDN 159

Query: 288 NVTNLEFYAAKDGIVMSSGEDR-RVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPV 346
           +++      A DG ++ +  ++    +WD+        P+  D  + + +     H S +
Sbjct: 160 DISIQSISLANDGSMLVAANNKGNCYVWDM--------PNKIDASNLKPITKFKAHDSYI 211

Query: 347 NDFSMNPNIPWLMASAEEENIVQVW 371
               ++ ++ + MA+   ++  ++W
Sbjct: 212 TKILLSSDVKY-MATCSADHTARIW 235

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 43/87 (49%), Gaps = 3/87 (3%)

Query: 102 KKFKHEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSF 161
           +  +H         +  D  L+A   GS  + LYD +   +   ++S   H++N   ++F
Sbjct: 26  RTIQHPDSQVNKLEITNDKKLLAAA-GSNNIKLYDVNT-SNSNPIASFDGHKNNVTSINF 83

Query: 162 NPVDKGKLLSGSDDSKIALWDITTNST 188
             V+   +++ S+D+ I LWDI + S+
Sbjct: 84  Q-VENKWMVTSSEDNTIKLWDIRSPSS 109

>Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 84/181 (46%), Gaps = 14/181 (7%)

Query: 147 SSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCK 206
           S++  H       +F P    ++++G+ D+   +WD  T +  P+ T +  H + V    
Sbjct: 137 SAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQT--PMHTLKG-HFNWVLCVS 193

Query: 207 WHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIK------TVTAFNTIAFSK-HSTNLFA 259
           W   +G    + S D T++L + +  + + D ++      T  ++  I   K  S    A
Sbjct: 194 WSP-DGEVIATGSMDNTIRLWNPKTGECLGDALRGHSKWITCLSWEPIHLVKPGSKPRLA 252

Query: 260 AAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEI 319
           ++  D  I ++DS       +T+SGH ++V+ +++     G++ S   DR V +WD+   
Sbjct: 253 SSSKDGTIKIWDSVNR-VCQYTLSGHTNSVSCVKW--GGQGLLYSGSHDRTVRVWDMNSQ 309

Query: 320 G 320
           G
Sbjct: 310 G 310

>TPHA0F03650 Chr6 (793481..795703) [2223 bp, 740 aa] {ON} Anc_1.534
           YKL213C
          Length = 740

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 258 FAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLM 317
           F  A  DS I + ++  TG VL+T SGHES V ++      D  ++S GEDR V +W L 
Sbjct: 204 FITASNDSFIKVVETE-TGKVLNTFSGHESFVYSIARNKHNDDELISCGEDRSVRIWSLS 262

Query: 318 EIGAEQV 324
               +QV
Sbjct: 263 TGLVQQV 269

>CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072c
          Length = 517

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 76/168 (45%), Gaps = 14/168 (8%)

Query: 160 SFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVS 219
           +F P    ++++G  D+   +WD  T + K      + H++ V    W   +G    + S
Sbjct: 152 AFAPHTSSRVVTGGGDNTARIWDCDTQTPKVT---LNGHRNWVLCVSW-SADGEVIATGS 207

Query: 220 EDCTLQLHDQRVKDSVTDKIK------TVTAFNTIAFSK-HSTNLFAAAGTDSLIYLYDS 272
            D T++L D      + D ++      T   +  I   +  S    A+A  D  I ++DS
Sbjct: 208 MDNTIRLWDAESGKPLGDALRGHSKWITSLTWEPIHLVEPGSKPRLASASKDGTIRIWDS 267

Query: 273 RRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIG 320
            R    L T+ GH ++V+ +++    +GI+ S   D+ V  WD+ + G
Sbjct: 268 SRR-VCLMTLGGHTNSVSCVKW--GGEGILYSGSHDKTVRAWDMKQNG 312

>NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25
          Length = 510

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 57/129 (44%), Gaps = 6/129 (4%)

Query: 98  IKIIKKFKHEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGY 157
           +  I KFKH   V + ++ P   N+IA I+   +  ++D      E L       E +  
Sbjct: 240 VSTILKFKHT--VLKVKFQPTGGNMIAAISKDKSCRVFDIRHSMKELLCVR---DEVDYM 294

Query: 158 GLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGS 217
            L +NP+++     G+ D  I  +D+  + TKP       H   V    ++ + GN   S
Sbjct: 295 TLLWNPINESMFTVGNYDGSIKHFDLLQDLTKPTHVIPYAHDKCVTSLSYNPM-GNILAS 353

Query: 218 VSEDCTLQL 226
            S+D T++ 
Sbjct: 354 ASKDRTVRF 362

>NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {ON}
           Anc_4.309 YLR429W
          Length = 629

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 39/179 (21%), Positives = 78/179 (43%), Gaps = 24/179 (13%)

Query: 161 FNPVDKGKLLSGSDDSKIALWDITTNST----------------KPVSTWESCHQDGVND 204
           F+P +  +++S SDDSKI +W+I  + +                KPV  + + H   V  
Sbjct: 89  FDPFNDHRIVSSSDDSKIGIWEIPQDYSFHNYKDVDESGSPIDIKPVK-FLTGHSRKVGH 147

Query: 205 CKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTD 264
             +H +  N   S S D T++L +    ++V   +K      +++FS   ++L A    D
Sbjct: 148 VLFHPVAANVLASSSLDYTVKLWNLETGEAVI-TLKHPDMVTSMSFSYDGSHL-ATVSRD 205

Query: 265 SLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSG----EDRRVIMWDLMEI 319
             + ++D R  G ++   + H         +      + ++G     DR++ +WD  ++
Sbjct: 206 KKLRVWDIRE-GKIVSEGAAHAGAKNQRVVWLGNSDRLATTGFSKLSDRQIGIWDAFDL 263

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/117 (22%), Positives = 54/117 (46%), Gaps = 4/117 (3%)

Query: 259 AAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLME 318
           +  G  ++I + +  +  + +    GH S V +  F    D  ++SS +D ++ +W++ +
Sbjct: 54  SGGGAFAVIPVEEVGKAPDQVPLFRGHTSQVLDTNFDPFNDHRIVSSSDDSKIGIWEIPQ 113

Query: 319 IGAEQVPDDADD-GSP---EVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVW 371
             +     D D+ GSP   + V    GH   V     +P    ++AS+  +  V++W
Sbjct: 114 DYSFHNYKDVDESGSPIDIKPVKFLTGHSRKVGHVLFHPVAANVLASSSLDYTVKLW 170

>KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 367

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 69/168 (41%), Gaps = 13/168 (7%)

Query: 105 KHEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPV 164
           K++  + ++++ P D N++ +  G+  V ++D  +  +    S +  +        FN  
Sbjct: 173 KNKNCIYQSQFSPHDPNIVMSCAGNSYVTMFDLRQPANANQYSFMAHNGMETLTCDFNKY 232

Query: 165 DKGKLLSGSDDSKIALWDI------TTNSTKPVSTWESCHQD-GVNDCKWHELNGNTFGS 217
               + +G  D+ + +WD+        NS +P+S  E C  D  +    W   + N   S
Sbjct: 233 RSHIIATGGVDNMVKVWDLRMVRKMAANSRQPMSVNEICGHDLAIRKVSWSPHHSNMLLS 292

Query: 218 VSEDCTLQLH-----DQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAA 260
            S D T ++      D R     T+ I        I FS H+  +F A
Sbjct: 293 TSYDMTCRVWQDLSDDGRRPTGKTNSIDPTHGCRFI-FSHHTEFVFGA 339

 Score = 37.7 bits (86), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 59/255 (23%), Positives = 107/255 (41%), Gaps = 53/255 (20%)

Query: 155 NGYGLSFNPV--DKGKLLSGSD-----DSKIALWDITTNSTKPVSTWESCHQDGVNDCKW 207
           +GYG+ ++P   +K  + +GS+     + K+ + DI  N  + + T     QDG+ D  W
Sbjct: 10  SGYGVQYSPFFDNKVAVATGSNFGLVGNGKLFIIDID-NQGRMLETKSFVTQDGLFDVAW 68

Query: 208 HELNGNTFGSVSEDCTLQLHDQRVKDS----VTDKIKTVTAFNTIAFSKHSTNLFAAAGT 263
           +EL+ N       D +L+L D ++ D       +  K V + N    +K    LF ++  
Sbjct: 69  NELHENHVLVAQGDGSLRLFDIQLNDYPVAIFQEHEKEVFSCNWNLINKQ---LFVSSSW 125

Query: 264 DSLIYLYDSRRTGNVL--------------------------HT-MSGHESNVTNLEFYA 296
           D  + ++   R  ++                           HT +S +++ +   +F  
Sbjct: 126 DGTVKVWTPMRQSSLTTLTPKPMTAHNSALSSKDIPMSNQKRHTSLSKNKNCIYQSQFSP 185

Query: 297 AKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIP 356
               IVMS   +  V M+DL +      P +A+  S    M H G  +   DF  N    
Sbjct: 186 HDPNIVMSCAGNSYVTMFDLRQ------PANANQYS---FMAHNGMETLTCDF--NKYRS 234

Query: 357 WLMASAEEENIVQVW 371
            ++A+   +N+V+VW
Sbjct: 235 HIIATGGVDNMVKVW 249

>Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {ON}
           complement(43719..47660) [3942 nt, 1314 aa]
          Length = 1313

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 94/238 (39%), Gaps = 39/238 (16%)

Query: 121 NLIATINGSGTVFLYDRSKDG--DEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKI 178
           N IA  N S  + +YD +K+   D  L++S   H        FN      L+SG  D +I
Sbjct: 197 NYIAVCNNSTIISIYDINKNDNIDNPLVTSFSEHSRAVNSFDFNMTQTSLLISGGQDGQI 256

Query: 179 ALWDITTN----STKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDS 234
            +WD+ +N    S KP     +   D + D KW  + G  F S +     Q +D +    
Sbjct: 257 KIWDLRSNSLSGSNKPDLNINAA-SDSIRDVKW--MPGYNFSSFN-----QSYDGKQ--- 305

Query: 235 VTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEF 294
                           + +S   FA+     L+  +D R+   V   ++ H      L +
Sbjct: 306 ----------------TGNSEYKFASIHDSGLLLKFDIRQPNQVEKKINAHTGPGLCLNW 349

Query: 295 YAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMN 352
           +  +D I  + G D +  +W    IG   V +DA   S   +  +  H S VN +  N
Sbjct: 350 HPNQDYIA-TGGRDGKCCIW---YIG--DVVNDAPVTSLGSMTPNTLHTSNVNYYQSN 401

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 37/72 (51%), Gaps = 5/72 (6%)

Query: 249 AFSKHSTNLFAAAGTDSLIYLYDSRRTGNV----LHTMSGHESNVTNLEFYAAKDGIVMS 304
            F K++ N  A     ++I +YD  +  N+    + + S H   V + +F   +  +++S
Sbjct: 191 GFQKYN-NYIAVCNNSTIISIYDINKNDNIDNPLVTSFSEHSRAVNSFDFNMTQTSLLIS 249

Query: 305 SGEDRRVIMWDL 316
            G+D ++ +WDL
Sbjct: 250 GGQDGQIKIWDL 261

>KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} similar
           to uniprot|P38968 Saccharomyces cerevisiae YDL195W SEC31
           involved in protein transport from endoplasmic reticulum
           to Golgi Component (p150) of COPII coat of secretory
           pathway vesicles
          Length = 1231

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 88/218 (40%), Gaps = 25/218 (11%)

Query: 119 DSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNG--YGLSFNPVDKGKLLSGSDDS 176
           D  +IA    +G V  +D      + L S    H+  G    L FN      L+SG    
Sbjct: 73  DDKIIAGALENGVVEFFD-----PKALKSVAKIHKHQGPVKTLKFNAKQNNVLVSGGTQG 127

Query: 177 KIALWD---ITTNSTKPVSTWES-CHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVK 232
           +I +WD   I ++   P S   S    D V+   W++   + F S S      + D + K
Sbjct: 128 EIFVWDSNKIGSSDYSPFSAGISNTPIDEVSSLSWNQSLAHVFASASSSGYASVWDLKAK 187

Query: 233 DSV--------TDKIKTVTAFNTIAFSKHSTNLFAAAG---TDSLIYLYDSRRTGNVLHT 281
             V        T  IK       + +   S+ + A A    T+ L+  +D R     L  
Sbjct: 188 KQVLHLNHSSSTTGIKV--PLTVVDWHPTSSTIIATASSSDTEPLVLTWDLRNAHVPLKV 245

Query: 282 MS-GHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLME 318
           +S GH   V +L++    + +++SSG D   ++W+  E
Sbjct: 246 LSQGHSKGVLSLDWCKQDENLLLSSGRDNTSVLWNPQE 283

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/65 (23%), Positives = 34/65 (52%), Gaps = 1/65 (1%)

Query: 257 LFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL 316
           + A A  + ++  +D +   +V   +  H+  V  L+F A ++ +++S G    + +WD 
Sbjct: 76  IIAGALENGVVEFFDPKALKSVAK-IHKHQGPVKTLKFNAKQNNVLVSGGTQGEIFVWDS 134

Query: 317 MEIGA 321
            +IG+
Sbjct: 135 NKIGS 139

>KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {ON}
           highly similar to uniprot|P25382 Saccharomyces
           cerevisiae YCR072C Protein required for cell viability
          Length = 514

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 81/177 (45%), Gaps = 14/177 (7%)

Query: 147 SSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCK 206
           S++  H       +F P    ++++G+ D+   +WD  TN+  P+ T +  H + V    
Sbjct: 136 SAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCNTNT--PMQTLKG-HFNWVLCVA 192

Query: 207 WHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIK------TVTAFNTIAFSKHSTN-LFA 259
           W   +G    + S D T++L      ++  D ++      T  ++  I   K       A
Sbjct: 193 WSP-DGELIATGSMDNTIRLWQSEKGENFGDALRGHSKWITSLSWEPIHLVKPGDKPRLA 251

Query: 260 AAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL 316
           +A  D  I ++D+ R    L T+SGH ++V+ +++     G++ S   D+ +  WD+
Sbjct: 252 SASKDGTIKIWDTARR-VCLFTLSGHTNSVSCVKW--GGRGVLYSGSHDKTIRAWDM 305

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 59/267 (22%), Positives = 110/267 (41%), Gaps = 42/267 (15%)

Query: 117 PQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDS 176
           P D   +A+ +  GT+ ++D ++      L +L  H ++   + +    +G L SGS D 
Sbjct: 244 PGDKPRLASASKDGTIKIWDTAR---RVCLFTLSGHTNSVSCVKWG--GRGVLYSGSHDK 298

Query: 177 KIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQL----HDQRVK 232
            I  WD+             C    +N  K H    N   S+S D  L++    H  +  
Sbjct: 299 TIRAWDMNAGG--------KC----INILKSHAHWINHL-SLSTDYALRVGAFDHTGKKP 345

Query: 233 DSVTD-KIKTVTAFNTIAFSKHSTN-LFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVT 290
            S  + + K +  +  IA        L   A  D  +YL+D  ++   +  M+GH+  V 
Sbjct: 346 SSPEEARAKALENYEKIAKKNGKLEELMVTASDDFTMYLWDPIKSTKPITRMTGHQKLVN 405

Query: 291 NLEFYAAKDG-IVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDF 349
           ++ F  + DG  ++S+  D  + +W            D  DG+   +    GH + V   
Sbjct: 406 HVAF--SPDGRYIVSASFDNSIKLW------------DGRDGT--FIATFRGHVASVYQV 449

Query: 350 SMNPNIPWLMASAEEENIVQVWKCSSK 376
           + + +   L+ S  ++  ++VW   +K
Sbjct: 450 AWSSDCR-LLVSCSKDTTLKVWDVRTK 475

>Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {ON}
           complement(63130..64962) [1833 nt, 611 aa]
          Length = 610

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 78/178 (43%), Gaps = 24/178 (13%)

Query: 161 FNPVDKGKLLSGSDDSKIALWDITTNST--------------KPVSTWESCHQDGVNDCK 206
           F+P ++ +++S +DDSKIA+WDI  N +               PV    + H+  V    
Sbjct: 89  FDPFNERRIVSCADDSKIAVWDIPENYSFHHYLDEDNQPKDISPVKIL-TGHKKKVGHVL 147

Query: 207 WHELNGNTFGSVSEDCTLQLHDQRV-KDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDS 265
           +  +  N   S S D T+++ +    KD +T  +K      +++FS +  N  A    D 
Sbjct: 148 YSPVAQNILASSSLDYTVKIWNVETGKDEIT--LKHPDMVTSMSFS-YDGNHLATVSRDK 204

Query: 266 LIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSG----EDRRVIMWDLMEI 319
            + ++D R+ G V+   + H         +      + ++G     DR++ +WD   +
Sbjct: 205 KLRVWDVRK-GTVVSEGAAHTGAKNQRVVWLGNCNRLATTGFSRLSDRQIGIWDAFNL 261

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 24/115 (20%), Positives = 54/115 (46%), Gaps = 2/115 (1%)

Query: 259 AAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLME 318
           +  G  ++I + +  +  + +    GH + V + EF    +  ++S  +D ++ +WD+ E
Sbjct: 54  SGGGAFAVIPVEEVGKNPDQVPLFRGHTAQVLDTEFDPFNERRIVSCADDSKIAVWDIPE 113

Query: 319 IGAEQVPDDADDGSPEV--VMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVW 371
             +     D D+   ++  V I  GH+  V     +P    ++AS+  +  V++W
Sbjct: 114 NYSFHHYLDEDNQPKDISPVKILTGHKKKVGHVLYSPVAQNILASSSLDYTVKIW 168

>Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON}
           YOL138C (REAL)
          Length = 1336

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 52/105 (49%), Gaps = 7/105 (6%)

Query: 121 NLIATINGSGTVFLYDRSKDG--DEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKI 178
           N IA  N S  + +YD +K    D  L++SL  H  +     FN V+   ++SG  DS +
Sbjct: 227 NCIAVCNNSTAISIYDLNKSSSLDNPLVTSLCEHTRSINSFDFNMVESNLIISGGQDSCV 286

Query: 179 ALWDITTNSTKPVSTWE---SCHQDGVNDCKWHELNGNTFGSVSE 220
            +WD+ +++ K  +  +   +   D + D KW  + G  F S +E
Sbjct: 287 KIWDLRSSNFKSSNRSDISINTASDSIRDVKW--MPGYNFASRNE 329

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 40/80 (50%), Gaps = 8/80 (10%)

Query: 245 FNTIAFSK----HSTNLFAAAGTDSLIYLYDSRRTGNV----LHTMSGHESNVTNLEFYA 296
           F+TIA  K    +  N  A     + I +YD  ++ ++    + ++  H  ++ + +F  
Sbjct: 212 FSTIADVKTGFNNYKNCIAVCNNSTAISIYDLNKSSSLDNPLVTSLCEHTRSINSFDFNM 271

Query: 297 AKDGIVMSSGEDRRVIMWDL 316
            +  +++S G+D  V +WDL
Sbjct: 272 VESNLIISGGQDSCVKIWDL 291

>KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.544
           YBR198C
          Length = 814

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 92/223 (41%), Gaps = 48/223 (21%)

Query: 141 GDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQD 200
           GDE     +G H    Y  SF+P D   LLSGS+D  + LW + T++T  + +++  H  
Sbjct: 530 GDETSSLLIG-HSGAVYSTSFSP-DNKFLLSGSEDKTVRLWSMDTHTT--LVSYKG-HNH 584

Query: 201 GVNDCKWHELNGNTFGSVSEDCTLQL------HDQRVKDSVTDKIKTVT-------AFNT 247
            V D K+  + G+ F + S D T +L      +  R+     + ++TV+        F  
Sbjct: 585 PVWDVKFSPM-GHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVETVSFHPNGCYVFTG 643

Query: 248 IA-----------------FSKHSTNLFAAA-----------GTDSLIYLYDSRRTGNVL 279
            A                 F  H+  +   A           G D +I ++D   TG  L
Sbjct: 644 SADKTCRMWDISTGDSVRLFLGHTAPVLTTAVTPDGRWLCTGGEDGVINVWDIG-TGKRL 702

Query: 280 HTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAE 322
             M GH  N  +   +  +  I++S G D  V +WDL +   E
Sbjct: 703 KQMRGHGKNAIHSFSFNKEGNILISGGADHSVRVWDLKKATPE 745

>NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 94/215 (43%), Gaps = 27/215 (12%)

Query: 169 LLSGSDDSKIALWDITTNSTK---PVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQ 225
           LLSGS D  +  W +T +  K   PV +++  H   V DC   + +G    S S D TL+
Sbjct: 33  LLSGSRDKTLISWKLTGDDQKFGVPVRSFKG-HSHIVQDCTLTQ-DGAYALSASWDKTLR 90

Query: 226 LHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGH 285
           L D    ++    +   +   ++A  + ++ + + +  D  I ++  +  G  L T+ GH
Sbjct: 91  LWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGS-RDKTIKVWTIK--GQCLATLLGH 147

Query: 286 ESNVTNLEFYAAKDG----IVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAG 341
              V+ +             V+S+G D+ V  W+L      Q   +AD           G
Sbjct: 148 NDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNL-----NQFQIEAD---------FVG 193

Query: 342 HRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSK 376
           H   VN  + +P+   L+ASA ++  + +W  + K
Sbjct: 194 HNGNVNTVTASPDGT-LIASAGKDGEIMLWNLAEK 227

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 10/95 (10%)

Query: 281 TMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHA 340
           T+ GH   VT+L   A +  +++S   D+ +I W L         DD   G P  V    
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKL-------TGDDQKFGVP--VRSFK 62

Query: 341 GHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSS 375
           GH   V D ++  +  + + SA  +  +++W  ++
Sbjct: 63  GHSHIVQDCTLTQDGAYAL-SASWDKTLRLWDVAT 96

>Skud_12.261 Chr12 (490588..492330) [1743 bp, 580 aa] {ON} YLR196W
           (REAL)
          Length = 580

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 64/146 (43%), Gaps = 7/146 (4%)

Query: 152 HEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQD-GVNDCKWHEL 210
           H D    ++ N   +  L S S D  + LWD+  NS     +  S H +  V+  +WH L
Sbjct: 289 HTDAVLSMAHNKHFRSVLASTSADHTVKLWDL--NSGNAARSLASIHSNKNVSSSEWHML 346

Query: 211 NGNTFGSVSEDCTLQLHDQRVKD-SVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDS-LIY 268
           NG+   +   D  + L D R+ D S   K  +V +   I     +       GTDS  +Y
Sbjct: 347 NGSVLLTGGYDSRVALTDVRISDESQMSKYWSVMSGEEIETVTFANENIILCGTDSGNVY 406

Query: 269 LYDSRRTGN--VLHTMSGHESNVTNL 292
            +D R   N   + T+  H++ ++ L
Sbjct: 407 SFDIRNNENRKPVWTLKAHDAGISTL 432

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 41/75 (54%), Gaps = 3/75 (4%)

Query: 244 AFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHES--NVTNLEFYAAKDGI 301
           A  ++A +KH  ++ A+   D  + L+D   +GN   +++   S  NV++ E++     +
Sbjct: 292 AVLSMAHNKHFRSVLASTSADHTVKLWD-LNSGNAARSLASIHSNKNVSSSEWHMLNGSV 350

Query: 302 VMSSGEDRRVIMWDL 316
           +++ G D RV + D+
Sbjct: 351 LLTGGYDSRVALTDV 365

>KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {ON}
           Anc_6.276 YPL247C
          Length = 553

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 76/170 (44%), Gaps = 16/170 (9%)

Query: 161 FNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSE 220
           +N  D   L+S S D+   +WD+   S+  V T    H   V D ++   +   F S   
Sbjct: 288 WNQTDTNLLISSSIDTTCIVWDL--QSSNYVKTQLIAHDSEVYDVRFLTKSTQLFASCGG 345

Query: 221 DCTLQLHDQR-------VKDSVTDKIKTV------TAFNTIAFSKHSTNLFAAAGTDS-L 266
           D ++++ D R       + +  T+ +          A   +  S    N+ A   ++S  
Sbjct: 346 DGSVRVFDLRSLAHSTIIYEPPTNPVSNADLSQQQNALLRLEPSPTDANVIATFVSESNK 405

Query: 267 IYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL 316
           I + D R + + +  + GH+S +  ++++  K  I++S  +D +V+ WDL
Sbjct: 406 ILILDMRNSESPVLVLEGHKSAINQIKWHPTKRYILLSCSDDCQVLYWDL 455

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 37/200 (18%), Positives = 72/200 (36%), Gaps = 47/200 (23%)

Query: 225 QLHDQRVKDSVTDKIKTVTAFNTIA---FSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHT 281
           +LH+     SVT   + +  F  +    +++  TNL  ++  D+   ++D + +  V   
Sbjct: 260 KLHNITNGTSVTSTSQILGEFPPVTSFDWNQTDTNLLISSSIDTTCIVWDLQSSNYVKTQ 319

Query: 282 MSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIG--------------------- 320
           +  H+S V ++ F      +  S G D  V ++DL  +                      
Sbjct: 320 LIAHDSEVYDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPTNPVSNADLSQQ 379

Query: 321 ------AEQVPDDAD-----------------DGSPEVVMIHAGHRSPVNDFSMNPNIPW 357
                  E  P DA+                   S   V++  GH+S +N    +P   +
Sbjct: 380 QNALLRLEPSPTDANVIATFVSESNKILILDMRNSESPVLVLEGHKSAINQIKWHPTKRY 439

Query: 358 LMASAEEENIVQVWKCSSKL 377
           ++ S  ++  V  W  +S  
Sbjct: 440 ILLSCSDDCQVLYWDLNSTF 459

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 40/82 (48%), Gaps = 3/82 (3%)

Query: 105 KHEQEVTRARYMPQDSNLIAT-INGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNP 163
           + +  + R    P D+N+IAT ++ S  + + D        L+  L  H+     + ++P
Sbjct: 378 QQQNALLRLEPSPTDANVIATFVSESNKILILDMRNSESPVLV--LEGHKSAINQIKWHP 435

Query: 164 VDKGKLLSGSDDSKIALWDITT 185
             +  LLS SDD ++  WD+ +
Sbjct: 436 TKRYILLSCSDDCQVLYWDLNS 457

>Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR178W
           (PRP4) - associated with the U4/U6 snRNP [contig 8] FULL
          Length = 474

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 56/218 (25%), Positives = 95/218 (43%), Gaps = 25/218 (11%)

Query: 106 HEQEVTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVD 165
           HE  V++ ++ P D   +A+ +   T  L+D  ++ +  L      H    Y L F   D
Sbjct: 270 HEARVSKVKFHPSD-RFVASASFDMTWRLWDVERETELQLQEG---HAKEVYCLDFQ-CD 324

Query: 166 KGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQ 225
              L S   DS   +WD+ T  +  V      H   +    W   NG+   + S D T+Q
Sbjct: 325 GSLLCSAGLDSVGHVWDMRTGRSLMVL---EGHAKPIYGVSWSP-NGHHVATGSGDGTVQ 380

Query: 226 LHDQRVKDSVTDKIKTVTAFNTIA----FSKHSTNLFAAAGTDSLIYLYDSRRTGN--VL 279
           + D R      +K  ++ A N+I     F K + N   ++  D  I ++    TG+   L
Sbjct: 381 VWDIR----KANKPSSILAHNSIVSEVNFEKENGNFLVSSSYDRTIGVFA---TGSWIKL 433

Query: 280 HTMSGHESNVTNLEFYAAKDGI-VMSSGEDRRVIMWDL 316
            ++ GH   + +++   ++ G  + SSG DR V +W L
Sbjct: 434 ASLQGHTDKILSVDI--SRGGANLWSSGWDRSVKIWAL 469

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 63/155 (40%), Gaps = 34/155 (21%)

Query: 248 IAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHT---MSGHESNVTNLEFYAAKDGIVMS 304
           +A+S  S  L A  G D+L+ +++ +   +   +   + GHE+ V+ ++F+ + D  V S
Sbjct: 231 VAWSSDS-QLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVSKVKFHPS-DRFVAS 288

Query: 305 SGEDRRVIMWD----------------------------LMEIGAEQVPDDADDGSPEVV 336
           +  D    +WD                            L   G + V    D  +   +
Sbjct: 289 ASFDMTWRLWDVERETELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSVGHVWDMRTGRSL 348

Query: 337 MIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVW 371
           M+  GH  P+   S +PN    +A+   +  VQVW
Sbjct: 349 MVLEGHAKPIYGVSWSPN-GHHVATGSGDGTVQVW 382

>NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 bp,
           318 aa] {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 96/215 (44%), Gaps = 27/215 (12%)

Query: 169 LLSGSDDSKIALWDITTNSTK---PVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQ 225
           LLSGS D  +  W +T +  K   PV +++  H   V DC   + +G    S S D TL+
Sbjct: 33  LLSGSRDKTLISWKLTGDDQKFGVPVRSFKG-HSHIVQDCTLTQ-DGAYALSASWDKTLR 90

Query: 226 LHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGH 285
           L D    ++    +   +   ++A  + ++ + + +  D  I ++  +  G  L T+ GH
Sbjct: 91  LWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGS-RDKTIKVWTIK--GQCLATLLGH 147

Query: 286 ESNVTNLEFYAA---KDGI-VMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAG 341
              V+ +         D + V+S+G D+ V  W+L      Q   +AD           G
Sbjct: 148 NDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNL-----NQFQIEAD---------FVG 193

Query: 342 HRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSK 376
           H   VN  + +P+   L+ASA ++  + +W  + K
Sbjct: 194 HNGNVNAVTASPDGT-LIASAGKDGEIMLWNLAEK 227

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 10/95 (10%)

Query: 281 TMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHA 340
           T+ GH   VT+L   A +  +++S   D+ +I W L         DD   G P  V    
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKL-------TGDDQKFGVP--VRSFK 62

Query: 341 GHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSS 375
           GH   V D ++  +  + + SA  +  +++W  ++
Sbjct: 63  GHSHIVQDCTLTQDGAYAL-SASWDKTLRLWDVAT 96

>TDEL0C01920 Chr3 (337685..339376) [1692 bp, 563 aa] {ON} Anc_7.356
           YLR196W
          Length = 563

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 76/173 (43%), Gaps = 16/173 (9%)

Query: 152 HEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQ-DGVNDCKWHEL 210
           H D    L+ N   +  L S S D  + LWD+  NS     +  S H    V+  +WH  
Sbjct: 271 HTDAVLSLTHNKQFRSVLASTSADHTVKLWDL--NSATAARSMASIHSGKNVSSSEWHTT 328

Query: 211 NGNTFGSVSEDCTLQLHDQRVKDSV-TDKIKTVTA---FNTIAFSKHSTNLFAAAGTDS- 265
           NG+   +   D  + L D R+ D     K  +V       T+ F+  +  L    GTDS 
Sbjct: 329 NGSVLLTGGYDSRIALSDVRIPDETKMSKYWSVVPGEDVETVTFADENIML---CGTDSG 385

Query: 266 LIYLYDSRRTGNV--LHTMSGHESNVTNLEFYAAKDGIVMSSGE--DRRVIMW 314
            IY +D R   N   + T+  H++ +++L       G+ MS+G   ++ V +W
Sbjct: 386 NIYSFDIRNNENSKPVWTLKAHDAGISSLCANRYIPGL-MSTGAMGEKTVKLW 437

>KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON}
           uniprot|P56094 Kluyveromyces lactis KLLA0F10263g TUP1
           Transcriptional repressor TUP1
          Length = 682

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 52/241 (21%), Positives = 95/241 (39%), Gaps = 65/241 (26%)

Query: 145 LLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPVSTWESCHQDGVND 204
           ++ +L  HE + Y L + P    KL+SGS D  + +WD+TT +                 
Sbjct: 440 IVMTLKGHEQDIYSLDYFP-SGNKLVSGSGDRTVRIWDLTTGT----------------- 481

Query: 205 CKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTD 264
                            C+L L    ++D VT          T+A S       AA   D
Sbjct: 482 -----------------CSLTL---SIEDGVT----------TVAVSPGEGKFIAAGSLD 511

Query: 265 SLIYLYDSRRTGNVLHTM-------SGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLM 317
             + ++DS  TG ++  +       +GH  +V ++ F     G+V S   DR V +W+L 
Sbjct: 512 RTVRVWDS-DTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVV-SGSLDRSVKLWNLN 569

Query: 318 EIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVWKCSSKL 377
            +  ++          E  + + GH+  V   +   N  ++++ +++  ++  W   S  
Sbjct: 570 GLSGQK-------SHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVL-FWDTKSGN 621

Query: 378 P 378
           P
Sbjct: 622 P 622

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 53/115 (46%), Gaps = 17/115 (14%)

Query: 257 LFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDL 316
             A    D LI ++D   T  ++ T+ GHE ++ +L+++ + + +V  SG DR V +WDL
Sbjct: 420 FLATGAEDKLIRIWD-LETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSG-DRTVRIWDL 477

Query: 317 MEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIVQVW 371
              G   +    +DG              V   +++P     +A+   +  V+VW
Sbjct: 478 T-TGTCSLTLSIEDG--------------VTTVAVSPGEGKFIAAGSLDRTVRVW 517

>Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 91/240 (37%), Gaps = 47/240 (19%)

Query: 124 ATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDI 183
           +++N    V   + +   D+    +L  H    Y  SF+P D   LLSGS+D  + LW +
Sbjct: 498 SSLNNPNIVLNNETNYKDDDPTCKTLVGHSGTVYSTSFSP-DNKYLLSGSEDKTVRLWSM 556

Query: 184 TTNST--------KPVSTWE----------------------SC-----------HQDGV 202
            T++          PV  W+                      SC           H + V
Sbjct: 557 DTHTALVSYKGHNHPV--WDVNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDV 614

Query: 203 NDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAG 262
            DC     NG    + S D T ++ +    DSV   +       +IA S     L +   
Sbjct: 615 -DCVSFHPNGCYLFTGSSDKTCRMWNVSTGDSVRLFLGHTAPVISIAVSPDGRWL-STGS 672

Query: 263 TDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAE 322
            D +I ++D   TG  L  M GH  N      Y+ +  +++S G D  V +WDL +   E
Sbjct: 673 EDGIINVWDIG-TGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLKKATTE 731

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.132    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,667,196
Number of extensions: 2028298
Number of successful extensions: 7998
Number of sequences better than 10.0: 871
Number of HSP's gapped: 6865
Number of HSP's successfully gapped: 1409
Length of query: 392
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 280
Effective length of database: 40,638,807
Effective search space: 11378865960
Effective search space used: 11378865960
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)