Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G046106.10ON63359026270.0
TPHA0M002006.10ON63458320640.0
ZYRO0F00484g6.10ON64359120460.0
Kpol_1045.776.10ON65060020360.0
TBLA0G011106.10ON63859820260.0
SAKL0E00880g6.10ON63658619930.0
ACR016W6.10ON64059319660.0
KLLA0D00836g6.10ON64059019280.0
Kwal_56.223506.10ON65858519060.0
KLTH0C11528g6.10ON64257418530.0
NCAS0D021906.10ON64559518510.0
CAGL0A01067g6.10ON64159318270.0
KAFR0B065006.10ON63659717520.0
NDAI0I027506.10ON66358216810.0
KNAG0E027806.10ON65055814860.0
YPL263C (KEL3)6.10ON65161214060.0
Skud_16.146.10ON65261313970.0
Suva_16.426.10ON65456513720.0
Smik_6.4716.10ON65158513720.0
Kpol_1050.695.88ON10842501682e-11
Skud_8.2225.88ON11692501521e-09
Smik_8.2425.88ON11682501503e-09
NCAS0F005205.88ON10862541484e-09
YHR158C (KEL1)5.88ON11642501484e-09
Suva_15.3575.88ON11722521477e-09
CAGL0I02090g5.88ON11362641468e-09
KAFR0B043205.88ON9862561422e-08
Smik_16.685.88ON8941831422e-08
Skud_7.5725.88ON8831951404e-08
SAKL0H02618g5.88ON10852611404e-08
KLLA0E15511g5.88ON9052531361e-07
TDEL0G011205.88ON10092521342e-07
Suva_7.5305.88ON8941981315e-07
ZYRO0B08228g5.88ON12932581272e-06
NDAI0D026005.88ON11671901234e-06
KLTH0C01474g5.88ON10562471226e-06
KNAG0K005605.88ON11042811218e-06
YGR238C (KEL2)5.88ON8822531191e-05
TPHA0H010805.88ON8282581182e-05
CAGL0F07997g5.88ON9362521182e-05
Kwal_14.10195.88ON9782471172e-05
TPHA0A051705.88ON10162541111e-04
Kpol_1010.625.88ON9732441048e-04
TBLA0C065305.88ON11721741000.002
Ecym_20615.88ON1362253910.027
Kpol_538.457.9ON848309830.20
KAFR0I029103.15ON691191790.69
ZYRO0C00550g7.9ON848156780.84
TBLA0A043207.9ON838100761.4
KAFR0C049107.9ON87876751.9
NCAS0B054408.157ON1550232752.4
YDL074C (BRE1)4.268ON70072733.5
ZYRO0C03344g3.15ON65894733.6
Suva_15.193.15ON708150724.2
NCAS0B044608.157ON1552115724.3
CAGL0K02101g8.157ON163396724.8
NCAS0A076407.9ON91386715.3
KNAG0D021008.157ON1687208716.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G04610
         (633 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.1...  1016   0.0  
TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON...   799   0.0  
ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON...   792   0.0  
Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON} (1807...   788   0.0  
TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {O...   785   0.0  
SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON...   772   0.0  
ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic ho...   761   0.0  
KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON...   747   0.0  
Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON...   738   0.0  
KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} simila...   718   0.0  
NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {O...   717   0.0  
CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} simila...   708   0.0  
KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6...   679   0.0  
NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {O...   652   0.0  
KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {O...   577   0.0  
YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}  K...   546   0.0  
Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}...   542   0.0  
Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}...   533   0.0  
Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C ...   533   0.0  
Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]...    69   2e-11
Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {O...    63   1e-09
Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {O...    62   3e-09
NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5....    62   4e-09
YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON} ...    62   4e-09
Suva_15.357 Chr15 complement(617637..618952,619001..621203) [351...    61   7e-09
CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa] ...    61   8e-09
KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {O...    59   2e-08
Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C...    59   2e-08
Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON...    59   4e-08
SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} simil...    59   4e-08
KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} simi...    57   1e-07
TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5....    56   2e-07
Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON...    55   5e-07
ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} simil...    54   2e-06
NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {...    52   4e-06
KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} simil...    52   6e-06
KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {O...    51   8e-06
YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}  ...    50   1e-05
TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {O...    50   2e-05
CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {...    50   2e-05
Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C...    50   2e-05
TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]...    47   1e-04
Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa] ...    45   8e-04
TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]...    43   0.002
Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar t...    40   0.027
Kpol_538.45 s538 complement(101351..103897) [2547 bp, 848 aa] {O...    37   0.20 
KAFR0I02910 Chr9 complement(582726..584801) [2076 bp, 691 aa] {O...    35   0.69 
ZYRO0C00550g Chr3 (39312..41858) [2547 bp, 848 aa] {ON} similar ...    35   0.84 
TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7...    34   1.4  
KAFR0C04910 Chr3 (975629..978265) [2637 bp, 878 aa] {ON} Anc_7.9...    33   1.9  
NCAS0B05440 Chr2 (1017388..1022040) [4653 bp, 1550 aa] {ON}            33   2.4  
YDL074C Chr4 complement(324047..326149) [2103 bp, 700 aa] {ON}  ...    33   3.5  
ZYRO0C03344g Chr3 complement(259809..261785) [1977 bp, 658 aa] {...    33   3.6  
Suva_15.19 Chr15 (34295..36421) [2127 bp, 708 aa] {ON} YOL141W (...    32   4.2  
NCAS0B04460 Chr2 (806663..811321) [4659 bp, 1552 aa] {ON} Anc_8....    32   4.3  
CAGL0K02101g Chr11 (182946..187847) [4902 bp, 1633 aa] {ON} simi...    32   4.8  
NCAS0A07640 Chr1 complement(1521774..1524515) [2742 bp, 913 aa] ...    32   5.3  
KNAG0D02100 Chr4 (351677..356740) [5064 bp, 1687 aa] {ON} Anc_8....    32   6.2  

>TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.10
           YPL263C
          Length = 633

 Score = 1016 bits (2627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/590 (84%), Positives = 498/590 (84%)

Query: 44  DDDLDIEQVLANXXXXXXXXXXXXXXNIERPSRRINPSMIANPIHGKSELIMFGGEHTIQ 103
           DDDLDIEQVLAN              NIERPSRRINPSMIANPIHGKSELIMFGGEHTIQ
Sbjct: 44  DDDLDIEQVLANFKKEQEQFEKVVVENIERPSRRINPSMIANPIHGKSELIMFGGEHTIQ 103

Query: 104 STSTTHFFNDLVVFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNT 163
           STSTTHFFNDLVVFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNT
Sbjct: 104 STSTTHFFNDLVVFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNT 163

Query: 164 FYHYSDTWLLDCATKEWTKIEQKNGPSARSGHRMAVWKNFIILHGGFRDLGTSTTYLNDC 223
           FYHYSDTWLLDCATKEWTKIEQKNGPSARSGHRMAVWKNFIILHGGFRDLGTSTTYLNDC
Sbjct: 164 FYHYSDTWLLDCATKEWTKIEQKNGPSARSGHRMAVWKNFIILHGGFRDLGTSTTYLNDC 223

Query: 224 WLFDITTYKWKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTD 283
           WLFDITTYKWKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTD
Sbjct: 224 WLFDITTYKWKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTD 283

Query: 284 CWYLKMSSNTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNF 343
           CWYLKMSSNTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNF
Sbjct: 284 CWYLKMSSNTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNF 343

Query: 344 YNDVFTYQINMNRWYSLSLRPQRKKQVKLNNRSTKDQEKELEDLLNKILRNAQLDDQGXX 403
           YNDVFTYQINMNRWYSLSLRPQRKKQVKLNNRSTKDQEKELEDLLNKILRNAQLDDQG  
Sbjct: 344 YNDVFTYQINMNRWYSLSLRPQRKKQVKLNNRSTKDQEKELEDLLNKILRNAQLDDQGEE 403

Query: 404 XXXXXXXXXXXXXXXXXXXXXXXXXHVIMNELPHPRFNAATAVVDDTLFIFGGVWEFGEK 463
                                    HVIMNELPHPRFNAATAVVDDTLFIFGGVWEFGEK
Sbjct: 404 EEIDAAEESTAVEEDSDESESLDKEHVIMNELPHPRFNAATAVVDDTLFIFGGVWEFGEK 463

Query: 464 DYSIDSFYGIDLNKADGVTVYWEDLTALENAKXXXXXXXXXXXXXXXXXXXXXXXQVDQK 523
           DYSIDSFYGIDLNKADGVTVYWEDLTALENAK                       QVDQK
Sbjct: 464 DYSIDSFYGIDLNKADGVTVYWEDLTALENAKDEDDSDEDEGEEDDDDEEDSEEEQVDQK 523

Query: 524 LVAXXXXXXXXXXXXXXXXIPDPRPWLPHPKAFESLRSFYVRTGATFLEWAISNNRHVKG 583
           LVA                IPDPRPWLPHPKAFESLRSFYVRTGATFLEWAISNNRHVKG
Sbjct: 524 LVAEDEDEEEEEFEEEEMEIPDPRPWLPHPKAFESLRSFYVRTGATFLEWAISNNRHVKG 583

Query: 584 KHLKTKSFEICESRWWERRDQVRLEEDKXXXXXXXXXXXXRDTTKTKKRR 633
           KHLKTKSFEICESRWWERRDQVRLEEDK            RDTTKTKKRR
Sbjct: 584 KHLKTKSFEICESRWWERRDQVRLEEDKLEELGGVGEIIERDTTKTKKRR 633

>TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON}
           Anc_6.10 YPL263C
          Length = 634

 Score =  799 bits (2064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/583 (64%), Positives = 438/583 (75%), Gaps = 1/583 (0%)

Query: 52  VLANXXXXXXXXXXXXXXNIERPSRRINPSMIANPIHGKSELIMFGGEHTIQSTSTTHFF 111
           VLAN              ++++P+RRIN  MIANP HGK EL++FGGE+T Q    THF+
Sbjct: 52  VLANFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFY 111

Query: 112 NDLVVFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTW 171
           NDL  F+PDN+ WK+I+SQNSPMPRSSAAM  HPSG+ALLHGGEFSSPKQNTFYHYSDTW
Sbjct: 112 NDLYTFTPDNDLWKKITSQNSPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTW 171

Query: 172 LLDCATKEWTKIEQKNGPSARSGHRMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDITTY 231
           LLDC T+EWTK+EQKNGPSARSGHR+ VWKN+ ILHGGFRDLG++T+YLND WLFDIT+Y
Sbjct: 172 LLDCTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFDITSY 231

Query: 232 KWKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMSS 291
           KW+Q+EFP NHPVPDARSGHSLI  QEGA+LWGGYCKVKAGKGLQKGKIL DCWYLKM +
Sbjct: 232 KWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGLQKGKILGDCWYLKMKA 291

Query: 292 NTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYNDVFTYQ 351
           + SA+RW+R+K+QGFQPSPRVGCSMV HKGRG+LFGGVYDFEETEESL+S FYND+F+YQ
Sbjct: 292 DPSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLFSYQ 351

Query: 352 INMNRWYSLSLRPQRKKQVKLNNRSTKDQEKELEDLLNKILRNAQLDDQGXXXXXXXXXX 411
           I  NRWY+L LR QRKK V+LNN+S+K++E EL+++LN+IL  A L D            
Sbjct: 352 IESNRWYALQLRSQRKKVVRLNNKSSKEKELELQNILNEILEKANLKDDDEDANELSNGL 411

Query: 412 XXXXXXXXXXXXXXXXXHVIMNELPHPRFNAATAVVDDTLFIFGGVWEFGEKDYSIDSFY 471
                            +++ N+LPH RFNA+T VVDDTLFI+GGVWE GEKDYSIDS Y
Sbjct: 412 GSDSDSDDESEKVSKKEYIVRNQLPHHRFNASTTVVDDTLFIYGGVWELGEKDYSIDSMY 471

Query: 472 GIDLNKADGVTVYWEDLTALENAKXX-XXXXXXXXXXXXXXXXXXXXXQVDQKLVAXXXX 530
            IDLNK DGVTVYWE+L  +E AK                         VDQKLVA    
Sbjct: 472 SIDLNKLDGVTVYWENLHDIEKAKELGAINSDEEDEEDEDDEDDDEEETVDQKLVAEEEE 531

Query: 531 XXXXXXXXXXXXIPDPRPWLPHPKAFESLRSFYVRTGATFLEWAISNNRHVKGKHLKTKS 590
                       IPDPRPWLPHPKAFESLR+FYVRTGA+FLEWAISNN+H +GKHLKTKS
Sbjct: 532 EEEEIEDADDMEIPDPRPWLPHPKAFESLRNFYVRTGASFLEWAISNNKHTRGKHLKTKS 591

Query: 591 FEICESRWWERRDQVRLEEDKXXXXXXXXXXXXRDTTKTKKRR 633
           FE+C+ RWWERRDQVR+EEDK            +DTTK+ KRR
Sbjct: 592 FELCQDRWWERRDQVRIEEDKLEELGGVGEVIEKDTTKSTKRR 634

>ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 643

 Score =  792 bits (2046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/591 (64%), Positives = 438/591 (74%), Gaps = 9/591 (1%)

Query: 52  VLANXXXXXXXXXXXXXXNIERPSRRINPSMIANPIHGKSELIMFGGEHTIQSTSTTHFF 111
           VLA+              ++++PS RINP +++NP HGK ELI+FGGE+T QS STTHF+
Sbjct: 53  VLASFKKEQEQFEKVVVESVDKPSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFY 112

Query: 112 NDLVVFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTW 171
           N+L  F+PDN+QW++ISSQN+PMPRSSAAM  HPSG+ALLHGGEFSSPKQNTFYHYSDTW
Sbjct: 113 NELFTFTPDNDQWRKISSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTW 172

Query: 172 LLDCATKEWTKIEQKNGPSARSGHRMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDITTY 231
           LLDC TKEWTK++QKNGP++RSGHRM VWKNF I++GGFRDLGTSTTYLNDCWLFDITT+
Sbjct: 173 LLDCTTKEWTKLDQKNGPASRSGHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTH 232

Query: 232 KWKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMSS 291
           KW QVEFP+NH +PDARSGHS I DQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKM+S
Sbjct: 233 KWTQVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMNS 292

Query: 292 NTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYNDVFTYQ 351
             SAIRW+R+K+QGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESL+SNFYND+FT+Q
Sbjct: 293 TPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQ 352

Query: 352 INMNRWYSLSLRPQRKKQVKLNNRSTKDQEKELEDLLNKILRNAQL----DDQGXXXXXX 407
           I  NRWYSLSLRPQRKKQVK++  STKDQEKEL+D LN+IL+ AQL    +D+       
Sbjct: 353 IKTNRWYSLSLRPQRKKQVKISKSSTKDQEKELQDHLNRILQQAQLYDQDEDKEDDKAIR 412

Query: 408 XXXXXXXXXXXXXXXXXXXXXHVIMNELPHPRFNAATAVVDDTLFIFGGVWEFGEKDYSI 467
                                H I  +LPHPRFN + AVV+DTLFI+GG+WE G+KDY+I
Sbjct: 413 EQFEDENQSGDEDEEESTKKQHTISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDKDYNI 472

Query: 468 DSFYGIDLNKADGVTVYWEDLTALENAKXXXXXXXXXXXXXXXXXXXXXXXQV----DQK 523
           DSFYGIDLNK DGVTVYWE+L  +E AK                             DQ 
Sbjct: 473 DSFYGIDLNKVDGVTVYWENLAEIEKAKKLAEQGSDEDEDDEDEEDEDEDDDEEEVRDQV 532

Query: 524 L-VAXXXXXXXXXXXXXXXXIPDPRPWLPHPKAFESLRSFYVRTGATFLEWAISNNRHVK 582
           L                   IPDPRPWLPHPKAFESLR+FYVR G  FLEWAISNNR  +
Sbjct: 533 LVAEEEDAEEDEEVEEEEMEIPDPRPWLPHPKAFESLRAFYVRAGPQFLEWAISNNRDAR 592

Query: 583 GKHLKTKSFEICESRWWERRDQVRLEEDKXXXXXXXXXXXXRDTTKTKKRR 633
           GKHLK KSF++C+ RWWERRDQVR+EEDK            R+  +  KRR
Sbjct: 593 GKHLKQKSFDLCQDRWWERRDQVRIEEDKMEELGGVGDIVERNPAQKTKRR 643

>Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON}
           (180710..182662) [1953 nt, 651 aa]
          Length = 650

 Score =  788 bits (2036), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/600 (63%), Positives = 442/600 (73%), Gaps = 18/600 (3%)

Query: 52  VLANXXXXXXXXXXXXXXNIERPSRRINPSMIANPIHGKSELIMFGGEHTIQSTSTTHFF 111
           VLAN              ++ERPSRRINP MI NP HGKSELI+FGGE T + TSTT FF
Sbjct: 51  VLANFKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGGESTNKDTSTTQFF 110

Query: 112 NDLVVFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTW 171
           NDL  ++P+N+QW+R +S+NSPMPRSSAAM  HPSGVAL+HGGEFSSPKQNTFYHYSDTW
Sbjct: 111 NDLYSYTPENDQWRRYTSKNSPMPRSSAAMAAHPSGVALIHGGEFSSPKQNTFYHYSDTW 170

Query: 172 LLDCATKEWTKIEQKNGPSARSGHRMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDITTY 231
           LLDC+TKEWTK+EQKNGPSARSGHR+++WKN+ +LHGGFRDLGTSTTYLNDCWLFDIT Y
Sbjct: 171 LLDCSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTSTTYLNDCWLFDITNY 230

Query: 232 KWKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMSS 291
           KWKQ+EFP NHP+PDARSGHS I  QEGA+LWGGYCKVKAGKGLQKGKILTDCWYLKM +
Sbjct: 231 KWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKA 290

Query: 292 NTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYNDVFTYQ 351
           + +AIRW+R+K+QGFQPSPRVGCSMV HKGRG+LFGGVYDFEETEESL+S FYND+F+YQ
Sbjct: 291 DPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSMFYNDLFSYQ 350

Query: 352 INMNRWYSLSLRPQRKKQVKLNNRSTKDQEKELEDLLNKILRNAQLDDQGXXXXXXXXXX 411
           I +NRW++L LRPQRKK V+LNN+S+KD+EKEL+DLLN+IL  A L+D+           
Sbjct: 351 IEINRWFALQLRPQRKKVVRLNNKSSKDKEKELQDLLNQILEKANLNDKDDKDQEDEDAK 410

Query: 412 XXXXXXXXX------------XXXXXXXXHVIMNELPHPRFNAATAVVDDTLFIFGGVWE 459
                                        + ++ +LPHPRFNA   VV+DTLFI+GGVWE
Sbjct: 411 AIETELDRADHDTSDSDADDVEDAKEKKEYKVLTQLPHPRFNATMTVVNDTLFIYGGVWE 470

Query: 460 FGEKDYSIDSFYGIDLNKADGVTVYWEDLTALENAKXXXXXXXXXXXXXXXXXXXXXXXQ 519
            GEKDY+IDSFY IDLN+ DGVTV WEDL+ +E AK                       +
Sbjct: 471 LGEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIVDSDEEDDEFGDSDDEDDGE 530

Query: 520 ---VDQKLVA---XXXXXXXXXXXXXXXXIPDPRPWLPHPKAFESLRSFYVRTGATFLEW 573
              +DQKLVA                   IPDP PWLPHPK FESLR FYVRTGATFLEW
Sbjct: 531 EEIMDQKLVAEEEEEEEEEEEEEQVDEMEIPDPCPWLPHPKPFESLRVFYVRTGATFLEW 590

Query: 574 AISNNRHVKGKHLKTKSFEICESRWWERRDQVRLEEDKXXXXXXXXXXXXRDTTKTKKRR 633
           AISNNR  +GKHLK KSF++C+ RWW+RRDQVR+EEDK            +DT+K+ KRR
Sbjct: 591 AISNNRDARGKHLKKKSFDLCQDRWWQRRDQVRIEEDKMEELGGIGEVIEKDTSKSTKRR 650

>TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {ON}
           Anc_6.10 YPL263C
          Length = 638

 Score =  785 bits (2026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/598 (63%), Positives = 438/598 (73%), Gaps = 11/598 (1%)

Query: 44  DDDLDIEQVLANXXXXXXXXXXXXXXNIERPSRRINPSMIANPIHGKSELIMFGGEHTIQ 103
           DDD+ IE +L N               + +P++RIN  MI+NPIHGK+ELI+FGGE+T  
Sbjct: 44  DDDMAIEDILENFKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNELILFGGENT-- 101

Query: 104 STSTTHFFNDLVVFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNT 163
            ++TT F+NDL  ++P+N+QWK+ +SQNSPMPRSS+AM+ HP+G+ALLHGGEFSSPKQNT
Sbjct: 102 -STTTTFYNDLFTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNT 160

Query: 164 FYHYSDTWLLDCATKEWTKIEQKNGPSARSGHRMAVWKNFIILHGGFRDLGTSTTYLNDC 223
           FYHYSDTWLLDCATKEW+K+E KNGPSARSGHRM VWKNFIILHGGFRDLGTSTTYL D 
Sbjct: 161 FYHYSDTWLLDCATKEWSKVENKNGPSARSGHRMTVWKNFIILHGGFRDLGTSTTYLKDL 220

Query: 224 WLFDITTYKWKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTD 283
           WLFD+T YKW QVEFP NH +PDARSGHSLI  Q+GA+LWGGYCKVKAGKGLQKGKIL+D
Sbjct: 221 WLFDVTKYKWTQVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGKGLQKGKILSD 280

Query: 284 CWYLKMSSNTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNF 343
           CWYLKM S+ S IRW+R+K+QGFQPSPRVGCSMV HKGRG+LFGGV+DFEETEESL+S F
Sbjct: 281 CWYLKMKSDVSGIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLF 340

Query: 344 YNDVFTYQINMNRWYSLSLRPQRKKQVKLNNRSTKDQEKELEDLLNKILRNAQLDDQGXX 403
           YND+FTYQI +NRW+SLS+R QRKK +K+  ++TKD+EKEL+D+LN IL+   L D    
Sbjct: 341 YNDLFTYQIEINRWFSLSMRSQRKKTIKIGPKTTKDKEKELQDILNSILKKNNLTDDDSE 400

Query: 404 XXXXXXXXXXXXXXXXXXXXXXXXXHV-----IMNELPHPRFNAATAVVDDTLFIFGGVW 458
                                     V     +MN+LPH RFNA TAVV+DTL+IFGG W
Sbjct: 401 DPNAIEEELKINDDESNSEDESKDGQVTKQYEVMNQLPHVRFNATTAVVNDTLYIFGGSW 460

Query: 459 EFGEKDYSIDSFYGIDLNKADGVTVYWEDLTALENAKXXXXXXXXXXXXXXXXXXXXXXX 518
           E GEKDYSIDSFY IDLNK DGVTVYWED+  +E AK                       
Sbjct: 461 ELGEKDYSIDSFYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFSDEEDEDDEEEDEDDGE 520

Query: 519 Q--VDQKLVAXXXXXXXXXXXXXXXX-IPDPRPWLPHPKAFESLRSFYVRTGATFLEWAI 575
           +  VDQKLVA                 IPDPRPWLPHPK FE+LR+FYVRTGATFLEWAI
Sbjct: 521 EEIVDQKLVAEEDEEEEEIEADEDEMEIPDPRPWLPHPKPFETLRAFYVRTGATFLEWAI 580

Query: 576 SNNRHVKGKHLKTKSFEICESRWWERRDQVRLEEDKXXXXXXXXXXXXRDTTKTKKRR 633
           SNNR  KGKHLK KSFE+ E RWWERRDQVR+EEDK            RDTT+  KRR
Sbjct: 581 SNNRDSKGKHLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERDTTQVNKRR 638

>SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 636

 Score =  772 bits (1993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/586 (62%), Positives = 431/586 (73%), Gaps = 6/586 (1%)

Query: 53  LANXXXXXXXXXXXXXXNIERPSRRINPSMIANPIHGKSELIMFGGEHTIQSTSTTHFFN 112
           LAN               ++RP+RRIN SM+ANP+HGK EL++FGGE+T  + STT F+N
Sbjct: 52  LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGENTNSTNSTTAFYN 111

Query: 113 DLVVFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWL 172
           DL  +S D +QW++ISSQNSPMPRSSAA+  HPSGV L+HGGEFSSPKQNTFYHYSDTWL
Sbjct: 112 DLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL 171

Query: 173 LDCATKEWTKIEQKNGPSARSGHRMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDITTYK 232
           LDC TKEWTKIEQKNGP+ARSGHR+ VWKN+ ILHGGFRDLGT TTYL+DCWLFDITTYK
Sbjct: 172 LDCNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITTYK 231

Query: 233 WKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMSSN 292
           WKQV+FP NHP+PDARSGHSL+   +GA+LWGGYCKVKAGKGLQKGKILTDCWYLKM S+
Sbjct: 232 WKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKSD 291

Query: 293 TSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYNDVFTYQI 352
             AIRW+R+K+QGFQPSPRVGCSMV HKGRG+LFGGV+DFEETEESLES FYND+FT+QI
Sbjct: 292 IGAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFYNDLFTFQI 351

Query: 353 NMNRWYSLSLRPQRKKQVKLNNRSTKDQEKELEDLLNKILRNAQLDD---QGXXXXXXXX 409
             NRWYS SLRPQRK   K  +++ ++++KELED+LN+IL  A L+D   +         
Sbjct: 352 ETNRWYSASLRPQRK-AAKATSKNNRNKDKELEDILNQILEKANLNDDENEKETIGDVLK 410

Query: 410 XXXXXXXXXXXXXXXXXXXHVIMNELPHPRFNAATAVVDDTLFIFGGVWEFGEKDYSIDS 469
                              + I  +LPHPRFNA+TAVVDDTLFIFGGVWE GEKDYSIDS
Sbjct: 411 ELDEEDSDSAEELNSEKKEYPIRIQLPHPRFNASTAVVDDTLFIFGGVWEIGEKDYSIDS 470

Query: 470 FYGIDLNKADGVTVYWEDLTALENAKXXXXXXXXXXXXXXXXXXXXXXXQ--VDQKLVAX 527
           FY IDLN+ DG+ +YWEDL  +E AK                       +   DQKLVA 
Sbjct: 471 FYAIDLNRLDGIKIYWEDLRDIEMAKELGDEEEDFEDNEEDDEEDDDDEEEITDQKLVAE 530

Query: 528 XXXXXXXXXXXXXXXIPDPRPWLPHPKAFESLRSFYVRTGATFLEWAISNNRHVKGKHLK 587
                          IPDPRPWLPHPK FE+LR FYVRTGA FLEWAIS+NR  +GKHLK
Sbjct: 531 DDDEEEEEEDEYEPEIPDPRPWLPHPKPFETLRGFYVRTGADFLEWAISSNRDARGKHLK 590

Query: 588 TKSFEICESRWWERRDQVRLEEDKXXXXXXXXXXXXRDTTKTKKRR 633
            KSF++C+ RWWERRDQVR+EEDK            +DT+K+KKRR
Sbjct: 591 KKSFDLCQDRWWERRDQVRIEEDKLEELGGIGEVVEKDTSKSKKRR 636

>ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL263C (KEL3)
          Length = 640

 Score =  761 bits (1966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/593 (62%), Positives = 428/593 (72%), Gaps = 8/593 (1%)

Query: 49  IEQVLANXXXXXXXXXXXXXXNIERPSRRINPSMIANPIHGKSELIMFGGEHTIQSTSTT 108
           IE+VLAN               +ERP +R + S++ANP+H K ELI+FGGE+T QST  T
Sbjct: 48  IEEVLANFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMT 107

Query: 109 HFFNDLVVFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYS 168
           HF+NDL ++S D +QWK+ +SQNSPMPRSSAA+  HPSGV L+HGGEFSSPKQNTFYHYS
Sbjct: 108 HFYNDLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYS 167

Query: 169 DTWLLDCATKEWTKIEQKNGPSARSGHRMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDI 228
           DTWL DCAT EWTKIEQKNGPS+RSGHRM VWKN+IILHGGFRDLGTSTTYLNDCWLFDI
Sbjct: 168 DTWLFDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDI 227

Query: 229 TTYKWKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTDCWYLK 288
           TTYKW+Q++FP NHP+PDARSGHSL+   EGAILWGGYCKVKAGKGLQKGKILTDCWYLK
Sbjct: 228 TTYKWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLK 287

Query: 289 MSSNTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYNDVF 348
           M S+ +AIRW+R+K+QGFQPS R GCSMV HKGRG+LFGGVYD+EETEE L+S FYND+F
Sbjct: 288 MKSDVTAIRWERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDLF 347

Query: 349 TYQINMNRWYSLSLRPQRKKQVKLNNRSTKDQEKELEDLLNKILRNAQLDDQGXXXXXXX 408
           TY I  NRWYS+SLR QR  +VK   +S +D++KELED+LN IL+ A LDD         
Sbjct: 348 TYHIETNRWYSVSLRAQRHSKVKSAPKSNRDKDKELEDMLNAILKKANLDDDDGDEDGKT 407

Query: 409 XXXXXXXXXX--XXXXXXXXXXHVIMNELPHPRFNAATAVVDDTLFIFGGVWEFGEKDYS 466
                                 + I+ +LPHPRFNA+TA+VDDTLFIFGGVWE GEKDY 
Sbjct: 408 IEEELNKLENDGITETEETKKSYPIVMKLPHPRFNASTAIVDDTLFIFGGVWEQGEKDYM 467

Query: 467 IDSFYGIDLNKADGVTVYWEDLTALENAKX--XXXXXXXXXXXXXXXXXXXXXXQVDQKL 524
           IDSFY ID+NK DGV VYWED+ A+E AK                           D+KL
Sbjct: 468 IDSFYSIDMNKVDGVKVYWEDMAAVERAKELGEEDEDDAEDDEDDDSEDDDEEEHSDRKL 527

Query: 525 VAXXXXXXXXXXXXXXXXIPDPRPWLPHPKAFESLRSFYVRTGATFLEWAISNNRH---- 580
           VA                IPDPRPWLPHPKAFESLR+FYVRTGA+FLEWAI+N  +    
Sbjct: 528 VAEEEEEEEEEDNEILPEIPDPRPWLPHPKAFESLRAFYVRTGASFLEWAITNKHNTRSD 587

Query: 581 VKGKHLKTKSFEICESRWWERRDQVRLEEDKXXXXXXXXXXXXRDTTKTKKRR 633
            KGKHLK  SF++C+ RWWERR+QVR+EEDK            +D TK  KRR
Sbjct: 588 AKGKHLKKHSFDLCQERWWERREQVRIEEDKLEELGGVGEVIEKDFTKPTKRR 640

>KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 640

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/590 (61%), Positives = 426/590 (72%), Gaps = 9/590 (1%)

Query: 53  LANXXXXXXXXXXXXXXNIERPSRRINPSMIANPIHGKSELIMFGGEHTIQSTSTTHFFN 112
           LAN              N++RP +RINP M  NP HGK EL+MFGGE T Q T TTHF+N
Sbjct: 51  LANFKREQENFEKINVENVDRPDQRINPCMFVNPAHGKRELMMFGGESTTQETGTTHFYN 110

Query: 113 DLVVFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWL 172
           DL V+S D + WKR +SQNSPMPRSSAA+  HP+GVAL+HGGEFSSPKQNTFYHYSD+WL
Sbjct: 111 DLFVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWL 170

Query: 173 LDCATKEWTKIEQKNGPSARSGHRMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDITTYK 232
            DC++KEWTK+EQKNGPSARSGHRMA+WKNFIILHGGFRDLGTSTTYLND W+FDIT YK
Sbjct: 171 FDCSSKEWTKVEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITNYK 230

Query: 233 WKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMSSN 292
           WKQVE P NHP+PDARSGHSLI+  EGA+L+GGY KVKAGKGLQKGKIL+DCWYLKM S+
Sbjct: 231 WKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSD 290

Query: 293 TSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYNDVFTYQI 352
             +IRW+R+K+QG QPSPRVGCSMV HKGRGVLFGGVYDFEETEESL S FYN+++TYQI
Sbjct: 291 LGSIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYTYQI 350

Query: 353 NMNRWYSLSLRPQRKKQVKLNNRSTKDQEKELEDLLNKIL-----RNAQLDDQGXX-XXX 406
             NRWY++SLRPQRKK+  + ++S ++++KELED+LN+IL     R+A+ DD+       
Sbjct: 351 ENNRWYAMSLRPQRKKKNFVQSKSNRNKDKELEDILNQILDKANLRDAEDDDESKVIEEQ 410

Query: 407 XXXXXXXXXXXXXXXXXXXXXXHVIMNELPHPRFNAATAVVDDTLFIFGGVWEFGEKDYS 466
                                 +  M+ LPH RFNAATAVVDDTLFIFGG  E GEKDY 
Sbjct: 411 LNQLDLIDFDDDDESDKKSAKSYETMSTLPHARFNAATAVVDDTLFIFGGTVEIGEKDYP 470

Query: 467 IDSFYGIDLNKADGVTVYWEDLTALENAKXXXXXXXXXXXXXXXXXXXXXXXQ--VDQKL 524
           IDSFY ID+NK DGV VYWE+L  +E A+                       +  VD KL
Sbjct: 471 IDSFYSIDMNKLDGVKVYWEELKEVERAEKLGEQDSDDEFGDEDDDDEDDGEEEIVDSKL 530

Query: 525 -VAXXXXXXXXXXXXXXXXIPDPRPWLPHPKAFESLRSFYVRTGATFLEWAISNNRHVKG 583
                              IPD RPWLPHPKAFE+LR+FYVRTG TFLE AIS+NR  KG
Sbjct: 531 EAEDEEEEEEEEEVEEEYEIPDLRPWLPHPKAFETLRAFYVRTGPTFLELAISSNRDSKG 590

Query: 584 KHLKTKSFEICESRWWERRDQVRLEEDKXXXXXXXXXXXXRDTTKTKKRR 633
           KHLKTKSFE+C+ RWWERR+QVR+EEDK            +DT+KT++RR
Sbjct: 591 KHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIEKDTSKTQRRR 640

>Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON}
           YPL263C (KEL3) - Kelch-repeat protein, similar to Kel1
           and Kel2 [contig 186] FULL
          Length = 658

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/585 (61%), Positives = 426/585 (72%), Gaps = 4/585 (0%)

Query: 51  QVLANXXXXXXXXXXXXXXNIERPSRRINPSMIANPIHGKSELIMFGGEHTIQSTSTTHF 110
           +VLAN               +ERPS+RIN  M+ANPIHGK EL++FGGEHT  + S T F
Sbjct: 76  EVLANFKKEQELFQEVLVTPVERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAF 135

Query: 111 FNDLVVFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDT 170
           +N+L  +S D++QW++I+S+NSPMPRSSAA   H SGVAL+HGGEFSSPKQNTFYHYSDT
Sbjct: 136 YNELFTYSLDSDQWRKITSRNSPMPRSSAAAAAHSSGVALIHGGEFSSPKQNTFYHYSDT 195

Query: 171 WLLDCATKEWTKIEQKNGPSARSGHRMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDITT 230
           WLLDC TKEWTK+EQKNGPSARSGHRM +WKNF ILHGGFRDLGTSTTYLND W+FDITT
Sbjct: 196 WLLDCTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDITT 255

Query: 231 YKWKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMS 290
           YKWKQVEFP NHP+PDARSGHS+I  Q+GA+LWGGYCKVKAGKGLQKGK LTDCWYLKM 
Sbjct: 256 YKWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKGKTLTDCWYLKMK 315

Query: 291 SNTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYNDVFTY 350
           S+ SAIRW+R+K+QGFQPSPRVGCSMV HKGRG+LFGGVYDFEETEE L S F+ND+F+Y
Sbjct: 316 SDVSAIRWERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASEFFNDLFSY 375

Query: 351 QINMNRWYSLSLRPQRKKQVKLNNRSTKDQEKELEDLLNKILRNAQLDDQGXXXXXXXXX 410
           Q+  NRWYS+ +RPQ+KK V + +R+ +++++ELE++LN IL+ A L D           
Sbjct: 376 QVEANRWYSVKMRPQKKKTVAI-SRNNRNKDEELENILNDILQQANLADDTDDDDNEIKR 434

Query: 411 XXXXXXXXXXXXXXXXXXHVIMNELPHPRFNAATAVVDDTLFIFGGVWEFGEKDYSIDSF 470
                              V+  +LPHPRFNA TAVVDD LFIFGGVWEFGE+D+SIDSF
Sbjct: 435 ELQRIDEEEALENSRKQYEVV-GQLPHPRFNATTAVVDDFLFIFGGVWEFGERDFSIDSF 493

Query: 471 YGIDLNKADGVTVYWEDLTALENAKXX-XXXXXXXXXXXXXXXXXXXXXQVDQKLVA-XX 528
           Y IDLNK DGV VYWE+L+ LE AK                          DQKLVA   
Sbjct: 494 YSIDLNKLDGVKVYWENLSELEKAKALGEDDEEEFDDDEDDDDDDEEEETADQKLVAEDE 553

Query: 529 XXXXXXXXXXXXXXIPDPRPWLPHPKAFESLRSFYVRTGATFLEWAISNNRHVKGKHLKT 588
                         IPD RPWLPHPK FE+LR+FY+RTGA FL+WAISNNR  KGKHLK 
Sbjct: 554 EEEEEEEEEEDEPEIPDLRPWLPHPKPFETLRAFYIRTGAEFLKWAISNNRDAKGKHLKK 613

Query: 589 KSFEICESRWWERRDQVRLEEDKXXXXXXXXXXXXRDTTKTKKRR 633
           +SF++C+ RWWERR+Q+R+EEDK            RD  +T KRR
Sbjct: 614 QSFDLCQDRWWERREQIRIEEDKLEELGGVENVVERDPAQTMKRR 658

>KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263C KEL3
           Cytoplasmic protein of unknown function
          Length = 642

 Score =  718 bits (1853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/574 (59%), Positives = 413/574 (71%), Gaps = 12/574 (2%)

Query: 71  IERPSRRINPSMIANPIHGKSELIMFGGEHTIQSTSTTHFFNDLVVFSPDNEQWKRISSQ 130
           ++RPS R N  M+ NP HGK EL++FGGE+T Q++STT F+N+L  +S D +QWK+I+S+
Sbjct: 70  VKRPSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNELFTYSLDTDQWKKITSR 129

Query: 131 NSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIEQKNGPS 190
           N+PMPRSSAA  GHPSGV L+HGGEFSSPKQNTFYHYSD+WLLDC++KEWTKI+QKNGPS
Sbjct: 130 NAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKIDQKNGPS 189

Query: 191 ARSGHRMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPQNHPVPDARSG 250
           ARSGHRM VWKNF ++HGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFP NHPVPDARSG
Sbjct: 190 ARSGHRMTVWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPPNHPVPDARSG 249

Query: 251 HSLIADQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMSSNTSAIRWDRKKRQGFQPSP 310
           HSLI  QEGAI+WGGYCK+KA KGLQKGKILTDCWYL+M S+ + IRW+R+K+QGFQPSP
Sbjct: 250 HSLIPTQEGAIVWGGYCKIKAKKGLQKGKILTDCWYLRMKSDITGIRWERRKKQGFQPSP 309

Query: 311 RVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYNDVFTYQINMNRWYSLSLRPQRKKQV 370
           RVGCSM  HKGRG+LFGGVYD+EETEE L S F+ND+ +YQ+  NRWYS+ +RPQ+KK V
Sbjct: 310 RVGCSMAHHKGRGILFGGVYDYEETEEGLSSEFFNDLLSYQVEANRWYSIKMRPQKKKIV 369

Query: 371 KLNNRSTKDQEKELEDLLNKILRNAQL--DDQGXXXXXXXXXXXXXXXXXXXXXXXXXXX 428
             + +S K ++ EL  +LN IL+ A L  ++                             
Sbjct: 370 AAS-KSAKSKDDELVGILNDILQKANLADEENEENESDSEIEKELHRLDEEELLGHQQKQ 428

Query: 429 HVIMNELPHPRFNAATAVVDDTLFIFGGVWEFGEKDYSIDSFYGIDLNKADGVTVYWEDL 488
           + ++ +LPH RFNAAT VVDDTLFIFGG WE+GE+D+SIDSFY IDLN+ DGV V+WEDL
Sbjct: 429 YPVVAQLPHSRFNAATTVVDDTLFIFGGSWEYGERDFSIDSFYSIDLNRTDGVRVFWEDL 488

Query: 489 TALENAKXX---------XXXXXXXXXXXXXXXXXXXXXQVDQKLVAXXXXXXXXXXXXX 539
             +E AK                                +++                  
Sbjct: 489 EEIEKAKDQGLEEDEEEEEEEDDDDEDDEEETLDEELIAEMEDDKQEEEEQEEEEEEEEA 548

Query: 540 XXXIPDPRPWLPHPKAFESLRSFYVRTGATFLEWAISNNRHVKGKHLKTKSFEICESRWW 599
              IPDPRPWLPHPKAFE+LR+FY+RTGA FL+WAISNNR  KGKHLK +SF++ + RWW
Sbjct: 549 GPEIPDPRPWLPHPKAFETLRAFYIRTGAEFLQWAISNNRSAKGKHLKKQSFDLSQDRWW 608

Query: 600 ERRDQVRLEEDKXXXXXXXXXXXXRDTTKTKKRR 633
           ERR+QVR+EEDK            RD++ + KRR
Sbjct: 609 ERREQVRIEEDKLEEMGGVENIIERDSSHSTKRR 642

>NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {ON}
           Anc_6.10
          Length = 645

 Score =  717 bits (1851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/595 (59%), Positives = 414/595 (69%), Gaps = 12/595 (2%)

Query: 51  QVLANXXXXXXXXXXXXXXNIERPSRRINPSMIANPIHGKSELIMFGGEHTIQSTSTTHF 110
           QVLAN              +I +P++R+N  MI  P H K EL++FGGE T   TS THF
Sbjct: 51  QVLANFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHF 110

Query: 111 FNDLVVFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDT 170
           +N+L+ +SPDN QW++I+SQNSPMPRSSAAM  HPSG+ALLHGGEFSSPKQNTFYHYSDT
Sbjct: 111 YNELITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDT 170

Query: 171 WLLDCATKEWTKIEQKNGPSARSGHRMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDITT 230
           WLLD  TKEWTK++   GP  RSGHR+ +WKN+ IL GGF+DLG ST+Y NDCW FDITT
Sbjct: 171 WLLDTHTKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITT 230

Query: 231 YKWKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMS 290
           YKWKQ+EFP NHP+PDARSGHS I  +EG ILWGGYCKVKAGKGLQKGKIL DCWYLKM 
Sbjct: 231 YKWKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMK 290

Query: 291 SNTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYNDVFTY 350
           S+ S +RW+R+K+QGFQPSPRVGCSM  HKGRG+LFGGVYDFEETEESLES FYND+F+Y
Sbjct: 291 SDLSQVRWERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSY 350

Query: 351 QINMNRWYSLSLR-PQRKKQV--KLNNRSTKDQEKELEDLLNKILRNAQLDDQGXXXXXX 407
            +  NRW+SLSLR  Q+ K+V    NN+S+K++EKEL+DLLN+IL    L D        
Sbjct: 351 NVESNRWFSLSLRKAQKFKKVAKSSNNKSSKEKEKELQDLLNQILEKNNLKDDDDDDEIS 410

Query: 408 XXXXXXXXXXXXX-----XXXXXXXXHVIMNELPHPRFNAATAVVDDTLFIFGGVWEFGE 462
                                       +M++LPHPRFNAAT VVDD+LFI+GG+WE GE
Sbjct: 411 TGTETETETAANSDDEDNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIYGGIWEMGE 470

Query: 463 KDYSIDSFYGIDLNKADGVTVYWEDLTALENAKXX-XXXXXXXXXXXXXXXXXXXXXQVD 521
           KDY+IDS Y IDLNK DGV+ YWEDL  +E AK                          D
Sbjct: 471 KDYAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGEQDSDEDEEEEDDEEDDDEEEIED 530

Query: 522 QKLVAXXXXXXXXXXXXXXXX--IPDPRPWLPHPKAFESLRSFYVRTGATFLEWAISNNR 579
           +KLVA                  IPD RPWLPHPK FESLR+FY+R GA FLEWAISNN+
Sbjct: 531 KKLVAEEDDEEEEEEEEEFEEMEIPDLRPWLPHPKPFESLRAFYIREGAAFLEWAISNNK 590

Query: 580 HVKGKHLKTKSFEICESRWWERRDQVRLEEDKXXXXXXXXXXXXRDTT-KTKKRR 633
           HV+GKHLK KSF++CE RWWERRDQVR+EEDK            +DT+  T KRR
Sbjct: 591 HVRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDTSVPTSKRR 645

>CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263c KEL3
          Length = 641

 Score =  708 bits (1827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/593 (57%), Positives = 406/593 (68%), Gaps = 11/593 (1%)

Query: 52  VLANXXXXXXXXXXXXXXNIERPSRRINPSMIANPI--HGKSELIMFGGEHTIQSTSTTH 109
           VLAN              ++++ ++R+NP M+ NP     K ELI+FGGE T   TSTT 
Sbjct: 49  VLANFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTT 108

Query: 110 FFNDLVVFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSD 169
           F+NDL  F+P+N QWKR +SQN+PMPRSSAAM  HPSG+ALLHGGEFSSPKQNTFYHYSD
Sbjct: 109 FYNDLHTFTPENNQWKRYTSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSD 168

Query: 170 TWLLDCATKEWTKIEQKNGPSARSGHRMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDIT 229
           TW+LDC TKEW K++ K GPSARSGHR+ VWKNF ILHGGFRDLGTSTTYL+DCWLFDIT
Sbjct: 169 TWILDCNTKEWAKVDAKVGPSARSGHRITVWKNFFILHGGFRDLGTSTTYLSDCWLFDIT 228

Query: 230 TYKWKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGK-GLQKGKILTDCWYLK 288
           TYKWKQVEFP NH VPDARSGHS I   EGAILWGGYCKVKA K G QKGKIL+DCWYLK
Sbjct: 229 TYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGKILSDCWYLK 288

Query: 289 MSSNTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYNDVF 348
           M S+ S IRW+R+++QGFQPSPRVGCSM  HKGRG+LFGGVYDFEETEESLESNF+ND+F
Sbjct: 289 MKSDISGIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESNFFNDLF 348

Query: 349 TYQINMNRWYSLSLRPQRKKQ---VKLNNRSTKDQEKELEDLLNKILRNAQLDDQGXXXX 405
           +Y I  NRWYSLS+R ++       K + +++K+QEKEL+ LL+ IL  A L D+     
Sbjct: 349 SYHIESNRWYSLSIRSRKSNNNAVAKKSGKNSKEQEKELKMLLDSILEKANLQDKSDDDE 408

Query: 406 XXXXXXXXXXXX--XXXXXXXXXXXHVIMNELPHPRFNAATAVVDDTLFIFGGVWEFGEK 463
                                    H I+ +LPHPRFNA T V+DDTLFIFGG+WE G+K
Sbjct: 409 DDEEINTALAKVDLEDEEEEQLAVQHTILTQLPHPRFNATTTVIDDTLFIFGGIWELGDK 468

Query: 464 DYSIDSFYGIDLNKADGVTVYWEDLTALENAKX---XXXXXXXXXXXXXXXXXXXXXXQV 520
           ++ IDS Y IDLNK DGVT+YWEDL  +E AK                            
Sbjct: 469 EFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELGVEDSDFEDDDEDDDDEDDDEEDDNE 528

Query: 521 DQKLVAXXXXXXXXXXXXXXXXIPDPRPWLPHPKAFESLRSFYVRTGATFLEWAISNNRH 580
             +                    PDPRPWLPHPK FE+LR+FY+R GA FLEWAISNN++
Sbjct: 529 KDEGDDEESEEEEEEEIEEELEYPDPRPWLPHPKPFETLRAFYIREGAAFLEWAISNNKN 588

Query: 581 VKGKHLKTKSFEICESRWWERRDQVRLEEDKXXXXXXXXXXXXRDTTKTKKRR 633
            KGKHLK  SF++C+ RWWERRDQ+R+EEDK            RD + + KRR
Sbjct: 589 AKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERDKSASSKRR 641

>KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6.10
           YPL263C
          Length = 636

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/597 (56%), Positives = 403/597 (67%), Gaps = 11/597 (1%)

Query: 44  DDDLDIEQVLANXXXXXXXXXXXXXXNIERPSRRINPSMIANPIHGKSELIMFGGEHTIQ 103
           +DD +IE++L N              ++E+PS R N S+I++    K EL++FGGEHT +
Sbjct: 43  EDDGNIEEILENFKKEQENYEKINIESVEKPSIRNNGSIISSTT--KKELLLFGGEHTSK 100

Query: 104 STSTTHFFNDLVVFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNT 163
              TT F+NDL  FSPDN QWKRI+SQNSPMPRSSAAM  HPSG+ALL+GGEFSSPKQ+T
Sbjct: 101 ELQTTKFYNDLYTFSPDNNQWKRITSQNSPMPRSSAAMAAHPSGIALLNGGEFSSPKQST 160

Query: 164 FYHYSDTWLLDCATKEWTKIEQKNGPSARSGHRMAVWKNFIILHGGFRDLGTSTTYLNDC 223
           FYHYSDTW+LD  TKEWTKIE K  P  RSGHR+  WKN+ IL GGF+DLG STTY ND 
Sbjct: 161 FYHYSDTWILDLTTKEWTKIEGKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDV 220

Query: 224 WLFDITTYKWKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTD 283
           WLFDITTYKWKQVEFP+NH +PDARSGHSLI   EG I++GGYCK+KA KGLQKGK+L+ 
Sbjct: 221 WLFDITTYKWKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCKIKAKKGLQKGKLLSG 280

Query: 284 CWYLKMSSNTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNF 343
           CW LKM ++  AIRW+R+++QGFQPSPRVGCSM  HKGRG+LFGGVYDF+ETEESLES F
Sbjct: 281 CWNLKMKADVEAIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESIF 340

Query: 344 YNDVFTYQINMNRWYSLSLRPQRKKQVKLN---NRSTKDQEKELEDLLNKILRNAQLDDQ 400
           YND+FTY I  NRW++++L+ +      ++   N+S+K++E+EL+DLLN+IL    L   
Sbjct: 341 YNDLFTYNIESNRWFNVTLKKRSNATKTISSTKNKSSKEKERELQDLLNQILEKNNLKPD 400

Query: 401 GXXXXXXXXXXXXXXXXXXXXXXXXXXXHVIMNELPHPRFNAATAVVDDTLFIFGGVWEF 460
                                        V   +LPHPRFNA T V+DD L+I+GG WEF
Sbjct: 401 DEEEEESSDIFGSDDEDDEEQKNKIDIKTV--TQLPHPRFNATTTVIDDMLYIYGGAWEF 458

Query: 461 GEKDYSIDSFYGIDLNKADGVTVYWEDLTALENAKX--XXXXXXXXXXXXXXXXXXXXXX 518
           GE DYSIDSFY IDLNK DGV VYWEDL  +E AK                         
Sbjct: 459 GEIDYSIDSFYSIDLNKLDGVNVYWEDLNEIETAKELGEQGSEDEDEDDFEEDEEDGEEE 518

Query: 519 QVDQKLVA--XXXXXXXXXXXXXXXXIPDPRPWLPHPKAFESLRSFYVRTGATFLEWAIS 576
             D KL+A                  IPDPRPWLPHPKAFESLR+FY+R G  FLEWAIS
Sbjct: 519 VEDTKLIAEDVEDEKEEEEEEYPEMEIPDPRPWLPHPKAFESLRAFYLREGPAFLEWAIS 578

Query: 577 NNRHVKGKHLKTKSFEICESRWWERRDQVRLEEDKXXXXXXXXXXXXRDTTKTKKRR 633
           NNRH +GK LK KSFE+C+ RWWERRDQ+ +EEDK            RDT+K   +R
Sbjct: 579 NNRHTRGKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGDVVERDTSKAVSKR 635

>NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {ON}
           Anc_6.10 YPL263C
          Length = 663

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/582 (55%), Positives = 389/582 (66%), Gaps = 23/582 (3%)

Query: 75  SRRINPSMI-ANPIHGKS--ELIMFGGEHTIQSTSTTHFFNDLVVFSPDNEQWKRISSQN 131
           S R N SMI A   H K   EL+MFGGE+T   T  THF+NDL+ ++PD +QW++I+SQN
Sbjct: 81  SPRSNSSMITAASAHNKKGKELLMFGGEYTSPETGMTHFYNDLLSYTPDTQQWRKITSQN 140

Query: 132 SPMPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIEQKNGPSA 191
           SPMPRSSAAM  HPSG+A+LHGGEFSSPKQNTFYHYSDTW+LD +TKEWTK++ K  P A
Sbjct: 141 SPMPRSSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDTSTKEWTKVDIKKSPVA 200

Query: 192 RSGHRMAVWKNFIILHGGFRDLGTS-TTYLNDCWLFDITTYKWKQVEFPQNHPVPDARSG 250
           RSGHR+  WKN+ +L GGF+D+G + T Y ND W FDI  YKW QVEFP+NHP+PD RSG
Sbjct: 201 RSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWTQVEFPKNHPLPDPRSG 260

Query: 251 HSLIADQEGAILWGGYCKVKA--GKGLQKGKILTDCWYLKMSSNTSAIRWDRKKRQGFQP 308
           HS I  +EG ILWGGY KVK+    G QKGKIL DCWYLKM S+ S+IRW+R+K+ GFQP
Sbjct: 261 HSWIPVEEGCILWGGYTKVKSKLKSGQQKGKILNDCWYLKMKSDLSSIRWERRKKLGFQP 320

Query: 309 SPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYNDVFTYQINMNRWYSLSLRPQRKK 368
           SPRVGCSM  HKGRG+LFGGVYDF+ETEESLES FYND+F+Y +  NRW++L+LR  +K 
Sbjct: 321 SPRVGCSMAYHKGRGILFGGVYDFDETEESLESLFYNDLFSYNVETNRWFALNLRKNQKG 380

Query: 369 QVKL---NNRSTKDQEKELEDLLNKILRNAQLDDQGXXXXXXXXXXXXXXX--------- 416
              L   NN+++K++EKEL+DLLN+IL    L D+                         
Sbjct: 381 NKSLKRSNNKNSKEKEKELQDLLNQILEKNNLKDEDDEDDEEVNENEDGSTTASTAATSD 440

Query: 417 -XXXXXXXXXXXXHVIMNELPHPRFNAATAVVDDTLFIFGGVWEFGEKDYSIDSFYGIDL 475
                          IMN+LPHPR+N A  VVDD LFI+GG WE GEKDY I+SFY IDL
Sbjct: 441 DEDTERTTQEAEGVTIMNQLPHPRYNVAMTVVDDLLFIYGGSWELGEKDYFINSFYSIDL 500

Query: 476 NKADGVTVYWEDLTALENAKXXXXXXXXXXXXXXXXXXXXXXXQV----DQKLVAXXXXX 531
           N+ DGVT YWEDL  +E AK                             DQKLVA     
Sbjct: 501 NRIDGVTCYWEDLKEIEKAKELGEQDSDEEDDEDDEEDDDEDDDEEEIKDQKLVADDEDE 560

Query: 532 XXXXXXXXXXXIPDPRPWLPHPKAFESLRSFYVRTGATFLEWAISNNRHVKGKHLKTKSF 591
                      IPD RPWLPHPK FESLR+FY+R G  FLEWAISNN+HV+GKHLK KSF
Sbjct: 561 EEEEEDVQEMEIPDLRPWLPHPKPFESLRAFYIREGPAFLEWAISNNKHVRGKHLKKKSF 620

Query: 592 EICESRWWERRDQVRLEEDKXXXXXXXXXXXXRDTTKTKKRR 633
           E+CE RWWERRDQ+R+EEDK            +DT+K   +R
Sbjct: 621 ELCEDRWWERRDQIRIEEDKLEELGVVGDVIEKDTSKGASKR 662

>KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {ON}
           Anc_6.10 YPL263C
          Length = 650

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/558 (51%), Positives = 353/558 (63%), Gaps = 20/558 (3%)

Query: 71  IERPSRRINPSMIANPIHGKSELIMFGGEHTIQSTSTTHFFNDLVVFSPDNEQWKRISSQ 130
           +  P+ R N  ++ N    K EL++FGGE T   T+ T F+NDL V++P N QWK+ +SQ
Sbjct: 72  VPHPTPRNNACLVTNA--SKPELLLFGGERTNNETNMTKFYNDLHVYNPQNNQWKKFTSQ 129

Query: 131 NSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIEQKNGPS 190
           NSPMPRSSAAM  H SGV +L GGEFSSPKQNTFYHY+DTWLLD  T+EW+K++ KNGPS
Sbjct: 130 NSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSKLDFKNGPS 189

Query: 191 ARSGHRMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPQNHPVPDARSG 250
           ARSGHR+  WKN+ IL GGF+DL   T+Y ND WLF++  +KW + E   N   PD RSG
Sbjct: 190 ARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKWE-TTNKNQPDPRSG 248

Query: 251 HSLIADQEGAILWGGYCKVKA--GKGLQKGKILTDCWYLKMSSNTSAIRWDRKKRQGFQP 308
           HS I   EG I++GGYCKVKA   K L KGK LTDCW LKMS N + I+W+R+ ++G QP
Sbjct: 249 HSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQNVNEIKWERRAKKGQQP 308

Query: 309 SPRVGCSMVPHK-GRGVLFGGVYDFEETEESLESNFYNDVFTYQINMNRWYSLSLR---- 363
           SPRVGCSM  H+  RG+LFGGVYD EETEE L S +YND+++Y I  NRWY L LR    
Sbjct: 309 SPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSYNIESNRWYPLKLRKVTQ 368

Query: 364 -PQRKKQVKLNNRSTKDQEKELEDLLNKILRNAQLDDQGXXXXXXXXXXXXXXXXXXXXX 422
                +    NN  +K+QEKEL+DLLNKIL    L D+                      
Sbjct: 369 NSNANRNKSSNNTVSKEQEKELQDLLNKILEQNDLKDEETNSYSGSNTPHEETTTDREQD 428

Query: 423 XXXXXXHV-----IMNELPHPRFNAATAVVDDTLFIFGGVWEFGEKDYSIDSFYGIDLNK 477
                  +      +N+LPH RFNA T V++DT +I+GG+WEF + DY+IDSFY IDLNK
Sbjct: 429 DNEEEEKMRTNLPKLNQLPHERFNACTTVLNDTFYIYGGMWEFKDNDYTIDSFYSIDLNK 488

Query: 478 ADGVTVYWEDLTALENAKX----XXXXXXXXXXXXXXXXXXXXXXQVDQKLVAXXXXXXX 533
            DG+T Y+E+L  +E  K                               +          
Sbjct: 489 LDGITQYYENLQEIEEVKRLGDVQSEDDFEYEDDDDEDDGEAEPTNERLEAEDDDEEENE 548

Query: 534 XXXXXXXXXIPDPRPWLPHPKAFESLRSFYVRTGATFLEWAISNNRHVKGKHLKTKSFEI 593
                    IPDPRPWLPHPKAFESLR FY+R G  FLEWAISNN+H KGKHLK KSFE+
Sbjct: 549 EDEGIDEMEIPDPRPWLPHPKAFESLREFYIREGPKFLEWAISNNKHAKGKHLKQKSFEL 608

Query: 594 CESRWWERRDQVRLEEDK 611
           C+ RWWERRDQ+++EEDK
Sbjct: 609 CQDRWWERRDQIQIEEDK 626

>YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}
           KEL3Cytoplasmic protein of unknown function
          Length = 651

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/612 (48%), Positives = 370/612 (60%), Gaps = 28/612 (4%)

Query: 44  DDDLDIEQVLANXXXXXXXXXXXXXXNIERPSRRINPSMIANPIHGKSELIMFGGEHTIQ 103
           + D D++++L++              ++E+PS R +P M ANP H K EL +FGGE T  
Sbjct: 46  ESDQDLDEILSSFSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDP 105

Query: 104 STSTTHFFNDLVVFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNT 163
            T  THF+NDL  +S  N  WK+  SQN+P+PRSSAA+  HPSG+ALLHGGEFSSPKQ+ 
Sbjct: 106 ETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSK 165

Query: 164 FYHYSDTWLLDCATKEWTKIE---QKNGPSARSGHRMAVWKNFIILHGGFRDLGTS-TTY 219
           FYHYSDTWL DC  +++TK+E   + + PSARSGHR+  WKN+ IL GGFRDLG   T+Y
Sbjct: 166 FYHYSDTWLFDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSY 225

Query: 220 LNDCWLFDITTYKWKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKV--KAGKGLQK 277
           LND W FDI+TYKW ++E    +  PDARSGH  I     AIL GGYCK+  K  K L K
Sbjct: 226 LNDLWCFDISTYKWTKLE---TNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMK 282

Query: 278 GKILTDCWYLKMSSNTSAIRWDRKKRQGFQPSPRVGCSM-VPHKGRGVLFGGVYDFEETE 336
           GKIL D W L ++ +    +W++ K    QPSPRVG S  +  + + V FGGVYD +ETE
Sbjct: 283 GKILNDAWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETE 342

Query: 337 ESLESNFYNDVFTYQINMNRWYSLSLRPQRKKQVK-----LNNRSTKDQEKELEDLLNKI 391
           ESLES FYND++ + + +N+W  L ++PQR+   K        +S KDQEKEL+DLLN I
Sbjct: 343 ESLESVFYNDLYMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSI 402

Query: 392 LRNAQLDDQGXXXXXXXXXXXXXXXXXXXXXXXXXXXH----VIMNELPHPRFNAATAVV 447
           L  + L+D                             +     I N+LPHPRFNAAT VV
Sbjct: 403 LAKSNLNDDDDDNDDNSTTGPNSIDDDEDNEDDSDLDNQEDITISNQLPHPRFNAATCVV 462

Query: 448 DDTLFIFGGVWEFGEKDYSIDSFYGIDLNKADGVTVYWEDLTALENAKXXXXXXXXXXXX 507
            D+LFI+ GVWE GEKDY I+SFY IDLNK DGV VYWEDL+A+E AK            
Sbjct: 463 GDSLFIYSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGDRDSDEDEF 522

Query: 508 XXXXXXXXXXXQVDQKLVA-----XXXXXXXXXXXXXXXXIPDPRPWLPHPKAFESLRSF 562
                        +++                        IPD R WLPHPK FE+LR+F
Sbjct: 523 EYEDDEEDEDDGEEEQDAGPLEGDEDEESESDDDKQAQMEIPDERSWLPHPKPFETLRAF 582

Query: 563 YVRTGATFLEWAISNNRHVKGKHLKTKSFEICESRWWERRDQVRLEEDKXXXXXXXXXXX 622
           Y+R GA FL W+ISNNR++KGK LKTKSFE+CE RWWERRDQV LEE++           
Sbjct: 583 YLREGANFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEER---LEDTGGII 639

Query: 623 XRD-TTKTKKRR 633
            RD TTK  KRR
Sbjct: 640 ERDTTTKPSKRR 651

>Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}
           YPL263C (REAL)
          Length = 652

 Score =  542 bits (1397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/613 (47%), Positives = 365/613 (59%), Gaps = 29/613 (4%)

Query: 44  DDDLDIEQVLANXXXXXXXXXXXXXXNIERPSRRINPSMIANPIHGKSELIMFGGEHTIQ 103
           + D D++++L++               +ER S R +P M ANP H K EL +FGGE T  
Sbjct: 46  ESDQDLDEILSSFTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIFGGEFTDP 105

Query: 104 STSTTHFFNDLVVFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNT 163
            T  THF+NDL  +S  N  WK+  S+N+P+PRSSAA+  HPSG+ALLHGGEFSSPKQ+ 
Sbjct: 106 ETKLTHFYNDLYSYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSK 165

Query: 164 FYHYSDTWLLDCATKEWTKIE---QKNGPSARSGHRMAVWKNFIILHGGFRDLGTS-TTY 219
           FYHYSDTWL DCA +++TK+E   + + PSARSGHR+  WKN+ IL GGFRDLG   T+Y
Sbjct: 166 FYHYSDTWLFDCAERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSY 225

Query: 220 LNDCWLFDITTYKWKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKV--KAGKGLQK 277
           LND W FDI+ YKW ++E    +  P+ARSGH  I     AIL GGYCK+  K  K L K
Sbjct: 226 LNDLWCFDISNYKWTKLE---TNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMK 282

Query: 278 GKILTDCWYLKMSSNTSAIRWDRKKRQGFQPSPRVGCSM-VPHKGRGVLFGGVYDFEETE 336
           GKIL D W L ++ +    +W++ K    QPSPRVG S  +  + + V FGGVYD +ETE
Sbjct: 283 GKILNDAWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETE 342

Query: 337 ESLESNFYNDVFTYQINMNRWYSLSLRPQRKKQVK-----LNNRSTKDQEKELEDLLNKI 391
           ESLES FYND++ + + +N+W  L ++PQR+   K        +S KDQEKEL+DLLN I
Sbjct: 343 ESLESVFYNDLYMFHLELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSI 402

Query: 392 LRNAQLDDQGXXXXXXXXXXXXXXXXXXXXXXXXXXXH---VIMNELPHPRFNAATAVVD 448
           L  + L+D                                  I N+LPHPRFNAAT VVD
Sbjct: 403 LAKSNLNDDDDDDNTTTGSNSIDGDDEGEDDDSDLDNPENITISNQLPHPRFNAATCVVD 462

Query: 449 DTLFIFGGVWEFGEKDYSIDSFYGIDLNKADGVTVYWEDLTALENAK-------XXXXXX 501
           D+LFI+ GVWE GEKDY I+SFY IDLNK DGV VYWEDL+ +E AK             
Sbjct: 463 DSLFIYSGVWELGEKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGDRDSDEDDFE 522

Query: 502 XXXXXXXXXXXXXXXXXQVDQKLVAXXXXXXXXXXXXXXXXIPDPRPWLPHPKAFESLRS 561
                             V                      IPD R WLPHPK FE+LR+
Sbjct: 523 YEDDDDDDGEDNDEEEQDVALLEGDEDEEGENEDNGQAQMEIPDERSWLPHPKPFETLRA 582

Query: 562 FYVRTGATFLEWAISNNRHVKGKHLKTKSFEICESRWWERRDQVRLEEDKXXXXXXXXXX 621
           FY+R GA FL W+ISNN+ +KGKHLKTKSFEICE RWWERRDQV LEE++          
Sbjct: 583 FYLREGANFLTWSISNNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEER---LEDTGGI 639

Query: 622 XXRD-TTKTKKRR 633
             RD TTK  KRR
Sbjct: 640 IERDTTTKISKRR 652

>Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}
           YPL263C (REAL)
          Length = 654

 Score =  533 bits (1372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/565 (49%), Positives = 346/565 (61%), Gaps = 27/565 (4%)

Query: 71  IERPSRRINPSMIANPIHGKSELIMFGGEHTIQSTSTTHFFNDLVVFSPDNEQWKRISSQ 130
           +ERPS R++P M ANP H K EL +FGGE T   T  THF+NDL  +S  N  WK+  SQ
Sbjct: 73  VERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSQ 132

Query: 131 NSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIE---QKN 187
           N+P+PRSS A+  H SG+ALLHGGEFSSPKQ+ FYHYSDTWL DC  K++TK+E   + +
Sbjct: 133 NAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEKKFTKLEFGGRDS 192

Query: 188 GPSARSGHRMAVWKNFIILHGGFRDLGTS-TTYLNDCWLFDITTYKWKQVEFPQNHPVPD 246
            PSARSGHR+  WKN+ IL GGFRDLG+  T+YLND W FDI+ YKW ++E    +  PD
Sbjct: 193 SPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLE---TNTKPD 249

Query: 247 ARSGHSLIADQEGAILWGGYCK--VKAGKGLQKGKILTDCWYLKMSSNTSAIRWDRKKRQ 304
           ARSGH  +     AIL GGYCK   K  K L KGKIL D W L ++ +    +W++ K  
Sbjct: 250 ARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLTPDPKKWQWEKLKNF 309

Query: 305 GFQPSPRVGCSM-VPHKGRGVLFGGVYDFEETEESLESNFYNDVFTYQINMNRWYSLSLR 363
             QPSPRVG S  +  + + V FGGVYD +ETEESL+S FYND++ + + +N+W  L ++
Sbjct: 310 KNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLYMFHLELNKWSKLRIK 369

Query: 364 PQRKKQ-----VKLNNRSTKDQEKELEDLLNKILRNAQLDDQGXXXXXXXXXXXXXXXXX 418
           PQR             +S KDQEKEL+DLLN IL  + L+D+                  
Sbjct: 370 PQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKSNLNDEEDDNDDSTATTTGANSSN 429

Query: 419 XXXXXXXXXXH------VIMNELPHPRFNAATAVVDDTLFIFGGVWEFGEKDYSIDSFYG 472
                             I N+LPHPRFNAAT VVDD+LFI+ GVWE GEKDY I+SFY 
Sbjct: 430 DEGDDEDDSDFENQENITISNQLPHPRFNAATCVVDDSLFIYSGVWELGEKDYPINSFYS 489

Query: 473 IDLNKADGVTVYWEDLTALENAKXXXXXXXXXXXXXXXXXXXXXXXQVDQKLVAXXXXXX 532
           IDLNK DGV VYWEDL+ +E AK                         ++          
Sbjct: 490 IDLNKLDGVKVYWEDLSTVEEAKRLGDRDSDEEEFEYEDEDDDEDDDEEEPQDTRLLEDD 549

Query: 533 XXXXX------XXXXXIPDPRPWLPHPKAFESLRSFYVRTGATFLEWAISNNRHVKGKHL 586
                           IPD R WLPHPK FE+LR+FY+R GA FL W+ISNNR++KGK L
Sbjct: 550 DDEESEEEDDGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWSISNNRNLKGKQL 609

Query: 587 KTKSFEICESRWWERRDQVRLEEDK 611
           KTKSFE+CE RWWERRDQV LEE++
Sbjct: 610 KTKSFELCEDRWWERRDQVTLEEER 634

>Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C
           (REAL)
          Length = 651

 Score =  533 bits (1372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/585 (49%), Positives = 354/585 (60%), Gaps = 28/585 (4%)

Query: 71  IERPSRRINPSMIANPIHGKSELIMFGGEHTIQSTSTTHFFNDLVVFSPDNEQWKRISSQ 130
           +ERPS R +P M ANP H K EL +FGGE T   T  THF+NDL  +S  N  WK+  SQ
Sbjct: 73  VERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLYSYSIKNNSWKKYVSQ 132

Query: 131 NSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIE---QKN 187
           N+P+PRSSAA+  HPSG+ALLHGGEFSSPKQ+ FYHYSDTWL DC  +++ K+E   + +
Sbjct: 133 NAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFNKLEFGGRDS 192

Query: 188 GPSARSGHRMAVWKNFIILHGGFRDLGTS-TTYLNDCWLFDITTYKWKQVEFPQNHPVPD 246
            PSARSGHR+  WKN+ IL GGFRDLG   T+YLND W FDI+ YKW ++E    +  PD
Sbjct: 193 SPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIE---TNSKPD 249

Query: 247 ARSGHSLIADQEGAILWGGYCK--VKAGKGLQKGKILTDCWYLKMSSNTSAIRWDRKKRQ 304
           ARSGH  I     AIL GGYCK   K  K L KGKIL D W L ++ +    +W++ K  
Sbjct: 250 ARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNF 309

Query: 305 GFQPSPRVGCSM-VPHKGRGVLFGGVYDFEETEESLESNFYNDVFTYQINMNRWYSLSLR 363
             QPSPRVG S  +  + + V FGGVYD +ETEESLES FYND++ + + +N+W  L ++
Sbjct: 310 KNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFHLELNKWSKLRIK 369

Query: 364 PQRKKQ-----VKLNNRSTKDQEKELEDLLNKILRNAQLDDQGXXXXXXXXXXXXXXXXX 418
            QR+            +S KDQEKEL+DLLN IL  + L+D                   
Sbjct: 370 SQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSNLNDDDDENDDYTATGSNSIDGD 429

Query: 419 XXXXXXXXXXH----VIMNELPHPRFNAATAVVDDTLFIFGGVWEFGEKDYSIDSFYGID 474
                     +     I N+LPHPRFNAAT VV D+LFI+ GVWE GEKDY I+SFY ID
Sbjct: 430 EDEEDDSDLDNQEDITISNQLPHPRFNAATCVVGDSLFIYSGVWELGEKDYPINSFYSID 489

Query: 475 LNKADGVTVYWEDLTALENAKXXXXXXXXXXXXXXXXXXXXXXXQVDQKLVAXXXXXXXX 534
           LNK DGV VYWE+L+A+E AK                         +++           
Sbjct: 490 LNKLDGVKVYWEELSAIEEAKRLGDRDSDEEEFEYEDEEDDEDQSEEEQDAGLLESDEDE 549

Query: 535 XXX-----XXXXXIPDPRPWLPHPKAFESLRSFYVRTGATFLEWAISNNRHVKGKHLKTK 589
                        IPD R WLPHPK FE+LR+FY+R GA FL W+ISNNR++KGK LKTK
Sbjct: 550 ESDDEDDGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWSISNNRNLKGKQLKTK 609

Query: 590 SFEICESRWWERRDQVRLEEDKXXXXXXXXXXXXRD-TTKTKKRR 633
           SFE+CE RWWERRDQV LEE++            RD TTK  KRR
Sbjct: 610 SFELCEDRWWERRDQVTLEEER---LEDTGGIIERDVTTKPSKRR 651

>Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]
           {ON} complement(150301..153555) [3255 nt, 1085 aa]
          Length = 1084

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 69/250 (27%), Positives = 103/250 (41%), Gaps = 44/250 (17%)

Query: 124 WKRISSQNSPMPR---SSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEW 180
           W RI  QNSP PR    S+A     + + +L G    S        Y DTW++ C   + 
Sbjct: 139 WNRIKLQNSPFPRYRHVSSAYATASNNIYILGGLHDQSV-------YGDTWIISC-NPDA 190

Query: 181 TKIEQK------NGPSARSGHRMAVWKN-FIILHGGFRDLGTSTTYLNDCWLFDITTYKW 233
           T+   K      N P  R GH   +  N FI+  G    +       +D +LF+I +YKW
Sbjct: 191 TQFSSKSVDIGENTPPPRVGHAATLCGNAFIVFGGDTHKVNKEGLMDDDIYLFNINSYKW 250

Query: 234 KQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMSS-N 292
             +  P   P P  R GH +       IL     K K       G    D ++  ++  +
Sbjct: 251 -TIPNPIG-PRPLGRYGHKI------CILATSTVKTKL---YLFGGQFDDTYFNDLAVFD 299

Query: 293 TSAIR-----WDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYNDV 347
            S+ R     W+  K +GF P P    +MV +     ++GG     +T++ L     ND+
Sbjct: 300 LSSFRRQDSHWEFIKSKGFMPPPLTNHTMVTYGSDLWIYGG-----DTQQGL----INDI 350

Query: 348 FTYQINMNRW 357
           F +  N N W
Sbjct: 351 FKFSPNTNTW 360

 Score = 54.7 bits (130), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 84/185 (45%), Gaps = 27/185 (14%)

Query: 90  KSELIMFGGEHTIQSTSTTHFFNDLVVFS-----PDNEQWKRISSQN-SPMPRSSAAMVG 143
           K++L +FGG+          +FNDL VF        +  W+ I S+   P P ++  MV 
Sbjct: 277 KTKLYLFGGQFD------DTYFNDLAVFDLSSFRRQDSHWEFIKSKGFMPPPLTNHTMVT 330

Query: 144 HPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIEQK-NGPSARSGHRMAVWKN 202
           + S +  ++GG+      N  + +S        T  WTK+E     P     H   V+KN
Sbjct: 331 YGSDL-WIYGGDTQQGLINDIFKFSPN------TNTWTKVETTGTKPPPMQEHAAVVYKN 383

Query: 203 FIILHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPQ-NHPVPDARSGHSL-IADQEGA 260
            + + GG  +   +  YLN  +LF+  + KW    FP     +   RSGHS+ + + +  
Sbjct: 384 IMCVVGGKDE---NDMYLNSVYLFNFDSSKW--YTFPDFKSGIIQGRSGHSVTLLNNDKL 438

Query: 261 ILWGG 265
           ++ GG
Sbjct: 439 LIMGG 443

>Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {ON}
           YHR158C (REAL)
          Length = 1169

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/250 (27%), Positives = 106/250 (42%), Gaps = 42/250 (16%)

Query: 124 WKRISSQNSPMPR---SSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWL---LDCAT 177
           W RI  QNSP PR    ++A V   + + ++ G    S        Y DTW+   LD AT
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYVTDKNQIYVIGGLHDQSV-------YGDTWILTALDNAT 165

Query: 178 K-EWTKIE-QKNGPSARSGHRMAVWKN-FIILHGGFRDLGTSTTYLNDCWLFDITTYKWK 234
           K   T I+  +  P  R GH   +  N F++  G    +       +D +L +I +YKW 
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKW- 224

Query: 235 QVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMSS-NT 293
            V  P   P P  R GH +      +I+     K K       G    D ++  ++  + 
Sbjct: 225 TVPAPVG-PRPLGRYGHKI------SIIATTQMKTKL---YVFGGQFDDTYFNDLAVYDL 274

Query: 294 SAIR-----WDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYNDVF 348
           S+ R     W+  K + F P P    +M+ +  +  +FGG        ++L+    NDVF
Sbjct: 275 SSFRRPDSHWEFLKPKAFTPPPITNFTMISYDSKLWVFGG--------DTLQG-LINDVF 325

Query: 349 TYQINMNRWY 358
            Y   +N W+
Sbjct: 326 MYDPAINDWF 335

 Score = 48.1 bits (113), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 95/221 (42%), Gaps = 40/221 (18%)

Query: 81  SMIANPIHGKSELIMFGGEHTIQSTSTTHFFNDLVVFS------PDNEQWKRISSQN-SP 133
           S+IA     K++L +FGG+          +FNDL V+       PD+  W+ +  +  +P
Sbjct: 243 SIIAT-TQMKTKLYVFGGQFD------DTYFNDLAVYDLSSFRRPDS-HWEFLKPKAFTP 294

Query: 134 MPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIEQK-NGPSAR 192
            P ++  M+ + S + +  G              +D ++ D A  +W  IE     P   
Sbjct: 295 PPITNFTMISYDSKLWVFGGDTLQG-------LINDVFMYDPAINDWFIIETTGEKPPPV 347

Query: 193 SGHRMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPQ-NHPVPDARSGH 251
             H   V+ + + + GG  +      YLN  +  ++ ++KW   + P     +P  RSGH
Sbjct: 348 QEHASVVYNDLMCVVGGKDE---HDAYLNSVYFLNLKSHKW--FKLPVFTAGIPQGRSGH 402

Query: 252 SLIADQEGAILWGG-----YCKVK------AGKGLQKGKIL 281
           SL   ++  IL  G     Y +V+      +   LQ+G I+
Sbjct: 403 SLTLLKDDKILIMGGDKFDYARVEEFDLHTSDIDLQRGTIV 443

>Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {ON}
           YHR158C (REAL)
          Length = 1168

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 68/250 (27%), Positives = 106/250 (42%), Gaps = 42/250 (16%)

Query: 124 WKRISSQNSPMPR---SSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLL---DCAT 177
           W RI  Q+SP PR    S+A V   + + ++ G    S        Y DTW+L   D AT
Sbjct: 113 WNRIKLQDSPFPRYRHVSSAYVTDKNQIYVIGGLHDQSV-------YGDTWILTAFDNAT 165

Query: 178 K-EWTKIE-QKNGPSARSGHRMAVWKN-FIILHGGFRDLGTSTTYLNDCWLFDITTYKWK 234
           K   T I+  +  P  R GH   +  N F++  G    +       +D +L +I +YKW 
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKWT 225

Query: 235 QVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMSS-NT 293
            V  P   P P  R GH +      +I+     K K       G    D ++  ++  + 
Sbjct: 226 -VPAPVG-PRPLGRYGHKI------SIIATNQMKTKL---YVFGGQFDDTYFNDLAVYDL 274

Query: 294 SAIR-----WDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYNDVF 348
           S+ R     W+  K + F P P    +M+ +  +  +FGG        ++L+    NDVF
Sbjct: 275 SSFRRPDSHWEFLKPKTFSPPPITNFTMISYDSKLWVFGG--------DTLQG-LVNDVF 325

Query: 349 TYQINMNRWY 358
            Y   +N W+
Sbjct: 326 MYDPALNDWF 335

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 52/212 (24%), Positives = 88/212 (41%), Gaps = 39/212 (18%)

Query: 90  KSELIMFGGEHTIQSTSTTHFFNDLVVFS------PDNEQWKRISSQN-SPMPRSSAAMV 142
           K++L +FGG+          +FNDL V+       PD+  W+ +  +  SP P ++  M+
Sbjct: 251 KTKLYVFGGQFD------DTYFNDLAVYDLSSFRRPDS-HWEFLKPKTFSPPPITNFTMI 303

Query: 143 GHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIEQK-NGPSARSGHRMAVWK 201
            + S + +  G              +D ++ D A  +W  IE     P     H   V+ 
Sbjct: 304 SYDSKLWVFGGDTLQG-------LVNDVFMYDPALNDWFIIETTGEKPPPVQEHATVVYN 356

Query: 202 NFIILHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPQ-NHPVPDARSGHSLIADQEGA 260
           + + + GG  +      YLN  +  ++ + KW   + P     +P  RSGHSL   +   
Sbjct: 357 DLMCVVGGKDE---HDAYLNSVYFLNLKSNKW--FKLPVFTAGIPQGRSGHSLTLLKNDK 411

Query: 261 ILWGG-----YCKVKAGK------GLQKGKIL 281
           IL  G     Y +V+          +QKG I+
Sbjct: 412 ILIMGGDKFDYARVEESDLHTSDIDMQKGTIV 443

>NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5.88
           YGR238C
          Length = 1086

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 68/254 (26%), Positives = 100/254 (39%), Gaps = 50/254 (19%)

Query: 124 WKRISSQNSPMPR---SSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEW 180
           W RI  QNSP PR    +++++   + V ++ G    S        Y DTW+L C   + 
Sbjct: 131 WNRIKLQNSPFPRYRHVASSVISDTNQVYVIGGLHDQS-------VYGDTWVLTCEDPQT 183

Query: 181 TKI-------EQKNGPSARSGHRMAVWKN-FIILHGGFRDLGTSTTYLNDCWLFDITTYK 232
           + +         +  P  R GH   +  N F+I  G            +D +LF+I +YK
Sbjct: 184 STMFSSRTVDITETTPPPRVGHASTLCGNAFVIFGGDTHKKNEMGEMDDDIYLFNINSYK 243

Query: 233 WKQVEFPQNHPV---PDARSGH--SLIAD---QEGAILWGGYCKVKAGKGLQKGKILTDC 284
           W     P  HP+   P  R GH  S+IA    Q    L+GG                 D 
Sbjct: 244 WT---IP--HPIGPRPKGRYGHKISIIARKQMQTKLYLFGGQF---------DDNYFNDL 289

Query: 285 WYLKMSS-NTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNF 343
               +SS       W+  K + F P P    +MV +  +  +FGG        ++LE   
Sbjct: 290 VVFDLSSFRRDDSHWEFIKPRSFIPPPITNHTMVSYDFKLWVFGG--------DTLEG-L 340

Query: 344 YNDVFTYQINMNRW 357
            N VF Y   +N W
Sbjct: 341 LNQVFMYDPAVNDW 354

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 84/191 (43%), Gaps = 33/191 (17%)

Query: 90  KSELIMFGGEHTIQSTSTTHFFNDLVVFS-----PDNEQWKRISSQN-SPMPRSSAAMVG 143
           +++L +FGG+         ++FNDLVVF       D+  W+ I  ++  P P ++  MV 
Sbjct: 271 QTKLYLFGGQFD------DNYFNDLVVFDLSSFRRDDSHWEFIKPRSFIPPPITNHTMVS 324

Query: 144 HPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIEQ-------KNGPSARSGHR 196
           +   + +  GG+      N  + Y      D A  +W  +E        +N P     H 
Sbjct: 325 YDFKLWVF-GGDTLEGLLNQVFMY------DPAVNDWCVVETTCQDDDLENMPPPMQEHA 377

Query: 197 MAVWKNFIILHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPQ-NHPVPDARSGHSL-I 254
             ++K  + + GG  +      YLND +  ++ + KW     P+    +P  RSGHS+ +
Sbjct: 378 TLIYKGLMCIVGGKDE---QDHYLNDVYFLNLKSLKW--FRLPRFMDGIPQGRSGHSVTL 432

Query: 255 ADQEGAILWGG 265
              +  ++ GG
Sbjct: 433 LKNDKLLIMGG 443

>YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON}
           KEL1Protein required for proper cell fusion and cell
           morphology; functions in a complex with Kel2p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 1164

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 67/250 (26%), Positives = 106/250 (42%), Gaps = 42/250 (16%)

Query: 124 WKRISSQNSPMPR---SSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLL---DCAT 177
           W RI  QNSP PR    ++A V   + + ++ G    S        Y DTW+L   D AT
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYVTDKNQIYVIGGLHDQSV-------YGDTWILTAFDNAT 165

Query: 178 K-EWTKIE-QKNGPSARSGHRMAVWKN-FIILHGGFRDLGTSTTYLNDCWLFDITTYKWK 234
           +   T I+  +  P  R GH   +  N F++  G    +       +D +L +I +YKW 
Sbjct: 166 RFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKWT 225

Query: 235 QVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMSS-NT 293
            V  P   P P  R GH +      +I+     K K       G    D ++  ++  + 
Sbjct: 226 -VPAPVG-PRPLGRYGHKI------SIIATTQMKTKL---YVFGGQFDDTYFNDLAVYDL 274

Query: 294 SAIR-----WDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYNDVF 348
           S+ R     W+  K + F P P    +M+ +  +  +FGG        ++L+    NDVF
Sbjct: 275 SSFRRPDSHWEFLKPRTFTPPPITNFTMISYDSKLWVFGG--------DTLQG-LVNDVF 325

Query: 349 TYQINMNRWY 358
            Y   +N W+
Sbjct: 326 MYDPAINDWF 335

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 51/220 (23%), Positives = 93/220 (42%), Gaps = 38/220 (17%)

Query: 81  SMIANPIHGKSELIMFGGEHTIQSTSTTHFFNDLVVFS------PDNEQWKRISSQN-SP 133
           S+IA     K++L +FGG+          +FNDL V+       PD+  W+ +  +  +P
Sbjct: 243 SIIAT-TQMKTKLYVFGGQFD------DTYFNDLAVYDLSSFRRPDS-HWEFLKPRTFTP 294

Query: 134 MPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIEQK-NGPSAR 192
            P ++  M+ + S + +  G              +D ++ D A  +W  I+     P   
Sbjct: 295 PPITNFTMISYDSKLWVFGGDTLQG-------LVNDVFMYDPAINDWFIIDTTGEKPPPV 347

Query: 193 SGHRMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPQNHPVPDARSGHS 252
             H   V+ + + + GG  +      YLN  +  ++ + KW ++       +P  RSGHS
Sbjct: 348 QEHATVVYNDLMCVVGGKDE---HDAYLNSVYFLNLKSRKWFKLPV-FTAGIPQGRSGHS 403

Query: 253 LIADQEGAILWGG-----YCKVK------AGKGLQKGKIL 281
           L   +   IL  G     Y +V+      +   +Q+G I+
Sbjct: 404 LTLLKNDKILIMGGDKFDYARVEEYDLHTSDIDMQRGTIV 443

>Suva_15.357 Chr15 complement(617637..618952,619001..621203) [3519
           bp, 1172 aa] {ON} YHR158C (REAL)
          Length = 1172

 Score = 61.2 bits (147), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 67/252 (26%), Positives = 105/252 (41%), Gaps = 42/252 (16%)

Query: 124 WKRISSQNSPMPR---SSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLL---DCAT 177
           W RI  QNSP PR    ++A     + + ++ G    S        Y DTW+L   D AT
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYATDKNQIYVIGGLHDQSV-------YGDTWILSAFDDAT 165

Query: 178 K-EWTKIE-QKNGPSARSGHRMAVWKN-FIILHGGFRDLGTSTTYLNDCWLFDITTYKWK 234
           K   T I+  +  P  R GH   +  N F++  G    +       +D +L ++ +YKW 
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNREGLMDDDIYLLNVNSYKWT 225

Query: 235 QVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMSS-NT 293
            V  P   P P  R GH +      +I+     K K       G    D ++  ++  + 
Sbjct: 226 -VPAPVG-PRPLGRYGHKI------SIIATTQMKTKL---YVFGGQFDDTYFNDLAVYDL 274

Query: 294 SAIR-----WDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYNDVF 348
           S+ R     WD  K   F P P    +M+ +  +  +FGG        ++L+    NDVF
Sbjct: 275 SSFRRPDSHWDFLKPMTFTPPPMTNFTMISYDSKLWVFGG--------DTLQG-LINDVF 325

Query: 349 TYQINMNRWYSL 360
            Y    N W+++
Sbjct: 326 MYDPAKNDWFTI 337

 Score = 47.8 bits (112), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 80/186 (43%), Gaps = 29/186 (15%)

Query: 90  KSELIMFGGEHTIQSTSTTHFFNDLVVFS------PDNEQWKRISSQN-SPMPRSSAAMV 142
           K++L +FGG+          +FNDL V+       PD+  W  +     +P P ++  M+
Sbjct: 251 KTKLYVFGGQFD------DTYFNDLAVYDLSSFRRPDS-HWDFLKPMTFTPPPMTNFTMI 303

Query: 143 GHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIEQK-NGPSARSGHRMAVWK 201
            + S + +  G              +D ++ D A  +W  IE     P     H   V+ 
Sbjct: 304 SYDSKLWVFGGDTLQG-------LINDVFMYDPAKNDWFTIETSGEKPPPVQEHATVVYN 356

Query: 202 NFIILHGGFRDLGTSTTYLNDCWLFDITTYKWKQVE-FPQNHPVPDARSGHSL-IADQEG 259
           + + + GG  +      YLN  +  ++ T+KW ++  F     +P  RSGHSL +   + 
Sbjct: 357 DLMCVVGGKDE---HDAYLNTVYFLNLKTHKWFKLPIFAAG--IPQGRSGHSLTLLKNDK 411

Query: 260 AILWGG 265
            ++ GG
Sbjct: 412 VLIMGG 417

>CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa]
           {ON} some similarities with uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1 involved in cell fusion and
           morphology
          Length = 1136

 Score = 60.8 bits (146), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 68/264 (25%), Positives = 104/264 (39%), Gaps = 58/264 (21%)

Query: 119 PDNEQWKRISSQNSPMPRSSAAMVGHPS--GVALLHGGEFSSPKQNTFYHYSDTWLLDCA 176
           PD   W RI   NSP PR       H +  G   + GG            Y DTW+L  +
Sbjct: 142 PDYTPWGRIRLSNSPFPRYRHVSSSHITDQGKIYVIGGLHDQSV------YGDTWILTAS 195

Query: 177 ---------TKEWTKIE-QKNGPSARSGHRMAVWKN-FIILHGGFRDLGTSTTYLNDCWL 225
                    + + T IE  ++ P  R GH   +  N F++  G    + +     +D +L
Sbjct: 196 DIDKTGAINSFKSTTIEITESTPPPRVGHASTLCGNAFVVFGGDTHKVNSDGLMDDDLYL 255

Query: 226 FDITTYKWKQVEFPQNHPV---PDARSGHSLI---ADQEGAILWGGYCKVKAGKGLQKGK 279
            +I +YKW     P+  PV   P  R GH ++   A+Q    L+GG              
Sbjct: 256 LNINSYKWT---IPK--PVGQRPLGRYGHKIVTISAEQTKLYLFGGQ------------- 297

Query: 280 ILTDCWYLKMSS-NTSAIR-----WDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFE 333
              D ++  ++  + S+ R     W   K  GF P P    +MV ++ +  +FGG     
Sbjct: 298 -FDDTYFGDLAVFDLSSFRRPDSHWVFLKPSGFNPPPLTNHTMVTYQDKIWVFGG----- 351

Query: 334 ETEESLESNFYNDVFTYQINMNRW 357
              ++LE    N V+ Y    N W
Sbjct: 352 ---DTLEEGLINRVYLYSPTNNSW 372

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 77/183 (42%), Gaps = 23/183 (12%)

Query: 90  KSELIMFGGEHTIQSTSTTHFFNDLVVFS------PDNEQWKRISSQNSPMPRSSAAMVG 143
           +++L +FGG+          +F DL VF       PD+       S  +P P ++  MV 
Sbjct: 288 QTKLYLFGGQFD------DTYFGDLAVFDLSSFRRPDSHWVFLKPSGFNPPPLTNHTMVT 341

Query: 144 HPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIEQKNG-PSARSGHRMAVWKN 202
           +   + +  G        N  Y YS T         W  +E     P     H   V+K+
Sbjct: 342 YQDKIWVFGGDTLEEGLINRVYLYSPT------NNSWEIVETTGDIPPPMQEHAAIVYKD 395

Query: 203 FIILHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPQNHPVPDARSGHSLIADQEGAIL 262
            + + GG +D      YLN  +  ++ + KW ++ F +N+ +P  RSGHS+   +   IL
Sbjct: 396 LMCVVGG-KD--AEDNYLNTLYFLNLQSLKWFKLPFYKNN-IPQGRSGHSVTLLKNDQIL 451

Query: 263 WGG 265
             G
Sbjct: 452 IMG 454

>KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {ON}
           Anc_5.88 YGR238C
          Length = 986

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 68/256 (26%), Positives = 97/256 (37%), Gaps = 42/256 (16%)

Query: 120 DNEQWKRISSQNSPMPR---SSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCA 176
           D   W RI   NSP PR    ++A       + ++ G    S        Y DTW+L   
Sbjct: 130 DQTVWNRIKLANSPFPRYRHVASAYATEDDKIYVIGGLHDQSV-------YGDTWILTSE 182

Query: 177 TKEWTKIEQK-----NGPSARSGHRMAVWKN-FIILHGGFRDLGTSTTYLNDCWLFDITT 230
                 I Q      N P  R GH   +  N FII  G    +       +D +LF+I +
Sbjct: 183 NNASRFISQTVDISDNTPPPRVGHAATLCGNAFIIFGGDTHKVNKDGLMDDDLYLFNINS 242

Query: 231 YKWKQVEFPQNHPVPDARSGH--SLIADQEGAI---LWGGYCKVKAGKGLQKGKILTDCW 285
           +KW  +  P   P P  R GH  S+IA         L+GG                 D  
Sbjct: 243 HKWT-IPNPVG-PRPLGRYGHKISIIATANSKTRLYLFGGQFD---------DAYFNDLV 291

Query: 286 YLKMSS-NTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFY 344
              +SS      RW+  K + F P P    +MV +  +  +FGG        ++L+    
Sbjct: 292 VFDLSSFRRPDSRWEFVKPKSFVPPPLTNHTMVSYDNKLWVFGG--------DTLQG-LT 342

Query: 345 NDVFTYQINMNRWYSL 360
           N VF Y   +N W ++
Sbjct: 343 NRVFMYDPMINDWTTI 358

 Score = 54.3 bits (129), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 59/220 (26%), Positives = 99/220 (45%), Gaps = 34/220 (15%)

Query: 81  SMIANPIHGKSELIMFGGEHTIQSTSTTHFFNDLVVFS------PDNEQWKRISSQN-SP 133
           S+IA   + K+ L +FGG+          +FNDLVVF       PD+ +W+ +  ++  P
Sbjct: 264 SIIAT-ANSKTRLYLFGGQFD------DAYFNDLVVFDLSSFRRPDS-RWEFVKPKSFVP 315

Query: 134 MPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIEQKNGPSARS 193
            P ++  MV + + + +  GG+      N  + Y D  + D  T E +     N      
Sbjct: 316 PPLTNHTMVSYDNKLWVF-GGDTLQGLTNRVFMY-DPMINDWTTIETSSDNPNNIAPPMQ 373

Query: 194 GHRMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPQNHP-VPDARSGHS 252
            H   V+K+ + + GG  +     TYLN  +  ++ T KW   + P   P +P  RSGHS
Sbjct: 374 EHAAIVYKDLMCIFGGKDE---QDTYLNGVYFLNLRTLKW--YKLPIFAPGIPQGRSGHS 428

Query: 253 L-IADQEGAILWGG----YCKV------KAGKGLQKGKIL 281
           + +   +  ++ GG    Y +V       +   + KG IL
Sbjct: 429 ITLLKNDKLLIMGGDKFDYARVDNFDLHTSETNMGKGTIL 468

>Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C
           (REAL)
          Length = 894

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/183 (28%), Positives = 90/183 (49%), Gaps = 25/183 (13%)

Query: 91  SELIMFGGEHTIQSTSTTHFFNDLVVFSPD-----NEQWKRISSQNS-PMPRSSAAMVGH 144
           +EL +FGG+  I  T    +FNDL VF        N  W+ +   ++ P P ++  MV  
Sbjct: 212 TELYLFGGQ--IDET----YFNDLAVFDLSSFRRPNSHWEFLEPISALPPPLTNHTMVTF 265

Query: 145 PSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIEQK-NGPSARSGHRMAVWKNF 203
            + + +  GGE  +PK  +    +DT+  D     W+K+E     P     H   V+K+ 
Sbjct: 266 DNKLWVF-GGE--TPKTIS----NDTYCYDPIQNAWSKVETTGEKPPPVQEHASVVYKHL 318

Query: 204 IILHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPQNHPVPDARSGHSL-IADQEGAIL 262
           + + GG +D+    TY ND +  ++ + KW ++   +   +P  RSGHSL + + E  ++
Sbjct: 319 MCVFGG-KDI--HNTYSNDVYFLNLLSLKWFKLPCVK-EGIPQERSGHSLTLMNNEKLVI 374

Query: 263 WGG 265
            GG
Sbjct: 375 MGG 377

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 62/252 (24%), Positives = 94/252 (37%), Gaps = 48/252 (19%)

Query: 124 WKRISSQNSPMPR--SSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWT 181
           W RI  ++SP PR   S++ +        + GG +          Y D W +  A    T
Sbjct: 73  WNRIKLKDSPFPRYRHSSSFITTNDNRIFVTGGLYDQSV------YGDVWEI-TANANGT 125

Query: 182 KIEQK------NGPSARSGHRMAVWKN-FIILHGGFRDLGTSTTYLNDCWLFDITTYKWK 234
               K      N P  R GH   +  N +++  G    L  +    +D +LF+I +YKW 
Sbjct: 126 SFTSKRIQIDHNTPPPRVGHASTMCGNAYVVFGGDTHKLNKNRLLDDDLYLFNINSYKWT 185

Query: 235 QVEFPQNHPV---PDARSGH--SLIADQE---GAILWGGYCKVKAGKGLQKGKILTDCWY 286
               P  HP+   P  R GH  S+IA ++      L+GG                 D   
Sbjct: 186 ---IP--HPIGSRPLGRYGHKISIIASKQMHTELYLFGGQI---------DETYFNDLAV 231

Query: 287 LKMSS-NTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYN 345
             +SS       W+  +     P P    +MV    +  +FGG     ET +++     N
Sbjct: 232 FDLSSFRRPNSHWEFLEPISALPPPLTNHTMVTFDNKLWVFGG-----ETPKTIS----N 282

Query: 346 DVFTYQINMNRW 357
           D + Y    N W
Sbjct: 283 DTYCYDPIQNAW 294

 Score = 36.2 bits (82), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 50/129 (38%), Gaps = 17/129 (13%)

Query: 231 YKWKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMS 290
           Y W +++  ++ P P  R   S I   +  I   G        GL    +  D W +  +
Sbjct: 71  YIWNRIKL-KDSPFPRYRHSSSFITTNDNRIFVTG--------GLYDQSVYGDVWEITAN 121

Query: 291 SNTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESN--FYNDVF 348
           +N ++    R +     P PRVG +        V+FGG          L  N    +D++
Sbjct: 122 ANGTSFTSKRIQIDHNTPPPRVGHASTMCGNAYVVFGG------DTHKLNKNRLLDDDLY 175

Query: 349 TYQINMNRW 357
            + IN  +W
Sbjct: 176 LFNINSYKW 184

>Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON}
           YGR238C (REAL)
          Length = 883

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 58/195 (29%), Positives = 94/195 (48%), Gaps = 30/195 (15%)

Query: 81  SMIA-NPIHGKSELIMFGGEHTIQSTSTTHFFNDLVVFSPD-----NEQWKRISSQNS-P 133
           S+IA NP+  K  L +FGG+  +  T    +FNDL +F        N  W+ +    + P
Sbjct: 201 SIIAYNPMQTK--LYLFGGQ--LDKT----YFNDLAMFDLSSFRRRNSHWEFLEPATTVP 252

Query: 134 MPRSSAAMVGHPSGVAL-LHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIEQKNG-PSA 191
            P ++  MV +  G  L + GGE  +PK  +    ++T+  D    +W+KIE     P  
Sbjct: 253 PPLANHTMVTY--GNKLWVFGGE--TPKTVS----NETYCYDPIQNDWSKIETTGEIPPP 304

Query: 192 RSGHRMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPQNHPVPDARSGH 251
              H   V+K+ + + GG     T   Y ND +  D+ ++KW ++   +   +P  RSGH
Sbjct: 305 VQEHASVVYKHIMCVFGGKY---THNAYSNDVYFLDLLSFKWYKLPHIK-EGIPRERSGH 360

Query: 252 SL-IADQEGAILWGG 265
           SL +   E  ++ GG
Sbjct: 361 SLTLMKNEKILIMGG 375

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 71/160 (44%), Gaps = 31/160 (19%)

Query: 124 WKRISSQNSPMPR---SSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCA---- 176
           W RI  ++SP PR   SS+ +V   + +  + GG ++         Y D W +       
Sbjct: 71  WNRIKLKDSPFPRYRHSSSPIVSSENRI-FVTGGLYNQSV------YGDVWQITANADGT 123

Query: 177 --TKEWTKIEQKNGPSARSGHRMAVWKN-FIILHGGFRDLGTSTTYLNDCWLFDITTYKW 233
             T +  +I+ +N P  R GH   +  N +++  G    L       +D +LF++ +YKW
Sbjct: 124 SFTPKAIQID-RNTPPPRVGHASTLCGNAYVVFGGDTHKLNEDKLLDDDIYLFNVNSYKW 182

Query: 234 KQVEFPQNHPV---PDARSGH--SLIA---DQEGAILWGG 265
                PQ  P+   P  R GH  S+IA    Q    L+GG
Sbjct: 183 T---IPQ--PIGSRPLGRYGHKISIIAYNPMQTKLYLFGG 217

>SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1085

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 73/261 (27%), Positives = 102/261 (39%), Gaps = 52/261 (19%)

Query: 115 VVFSPDNEQWKRISSQNSPMPR---SSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTW 171
            V+SP    W RI   +SP PR    ++A     + V ++ G    S        Y DTW
Sbjct: 68  AVYSP----WNRIKLGSSPFPRYRHVASAYASEQNQVFVIGGLHDQSV-------YGDTW 116

Query: 172 LLDCATKEWTKIEQKN------GPSARSGHRMAVWKN-FIILHGGFRDLGTSTTYLNDCW 224
           +L  A    T+   K        P  R GH   +  N F+I  G    +       +D +
Sbjct: 117 IL-TAHANNTRFTSKTVDISDTTPPPRVGHASTLCGNAFVIFGGDTHKVNNEGLMDDDVY 175

Query: 225 LFDITTYKWKQVEFPQNHPV---PDARSGH--SLIADQEGAI---LWGGYCKVKAGKGLQ 276
           LF+I +YKW     P  HPV   P  R GH  S+IA  +      ++GG         L 
Sbjct: 176 LFNINSYKWT---IP--HPVGPRPLGRYGHKISVIATSQMKTKLYVFGGQFDDTYFNDL- 229

Query: 277 KGKILTDCWYLKMSSNTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETE 336
                  C Y   S       W+  K Q F P P    +MV +  +  +FGG     +T 
Sbjct: 230 -------CVYDLSSFRRPDSHWEFLKPQSFVPPPLTNHTMVSYDYKLWIFGG-----DTA 277

Query: 337 ESLESNFYNDVFTYQINMNRW 357
           + L     N+VF Y   +N W
Sbjct: 278 QGL----INEVFMYDPTVNDW 294

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 80/170 (47%), Gaps = 26/170 (15%)

Query: 90  KSELIMFGGEHTIQSTSTTHFFNDLVVFS------PDNEQWKRISSQN-SPMPRSSAAMV 142
           K++L +FGG+          +FNDL V+       PD+  W+ +  Q+  P P ++  MV
Sbjct: 211 KTKLYVFGGQFD------DTYFNDLCVYDLSSFRRPDS-HWEFLKPQSFVPPPLTNHTMV 263

Query: 143 GHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIEQKNG-PSARSGHRMAVWK 201
            +   + +  GG+ +    N  + Y      D    +WT +E     P A   H   V+K
Sbjct: 264 SYDYKLWIF-GGDTAQGLINEVFMY------DPTVNDWTVVETTGSKPPAIQEHAAVVYK 316

Query: 202 NFIILHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPQNHPVPDARSGH 251
           + + + GG  +     +Y ND +  ++ ++KW ++ F +N  VP  RSGH
Sbjct: 317 DLMCVTGGKDE---QDSYSNDVYFLNLKSFKWFKLPFFKNG-VPQGRSGH 362

>KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} similar
           to uniprot|P50090 Saccharomyces cerevisiae YGR238C KEL2
           Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate AND similar to YHR158C
           uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 905

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 70/253 (27%), Positives = 98/253 (38%), Gaps = 38/253 (15%)

Query: 116 VFSPDNEQWKRISSQNSPMPR--SSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWL- 172
           VF+P    W RI  + SP PR    A+     SG   + GG            Y DTW+ 
Sbjct: 89  VFTP----WNRIRLKQSPFPRYRHVASSYATDSGELFVIGGLHDQSV------YGDTWII 138

Query: 173 --LDCAT--KEWTKIEQKNGPSARSGHRMAVWKN-FIILHGGFRDLGTSTTYLNDCWLFD 227
             LD AT  K  T       P  R GH   +  N F+I  G    +  +    +D +LF+
Sbjct: 139 KSLDNATSFKSITVPIADATPPPRVGHASTLCGNAFVIFGGDTHKVNDAGLMDDDIYLFN 198

Query: 228 ITTYKWKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVK--AGKGLQKGKILTDCW 285
           I ++KW  +  PQ  P P  R GH +      +I+     K K     G        D  
Sbjct: 199 INSHKWT-IPTPQG-PRPLGRYGHKI------SIIAANQMKTKLYVFGGQFDDTYFNDLA 250

Query: 286 YLKMSS-NTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFY 344
              +SS   S   W+  K   F P P    +M+    +  +FGG     +T + L     
Sbjct: 251 EFDLSSFRRSDSHWEFIKPATFMPPPLANHTMISFDHKLWVFGG-----DTPQGLT---- 301

Query: 345 NDVFTYQINMNRW 357
           N+VF +    N W
Sbjct: 302 NEVFMFDPAANDW 314

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 80/193 (41%), Gaps = 26/193 (13%)

Query: 90  KSELIMFGGEHTIQSTSTTHFFNDLV-----VFSPDNEQWKRISSQN-SPMPRSSAAMVG 143
           K++L +FGG+          +FNDL       F   +  W+ I      P P ++  M+ 
Sbjct: 231 KTKLYVFGGQFD------DTYFNDLAEFDLSSFRRSDSHWEFIKPATFMPPPLANHTMIS 284

Query: 144 HPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIEQK-NGPSARSGHRMAVWKN 202
               + +  G    +P+  T    ++ ++ D A  +W  ++   N P     H   ++++
Sbjct: 285 FDHKLWVFGG---DTPQGLT----NEVFMFDPAANDWCVVQTTGNIPPPLQEHAAIIYRD 337

Query: 203 FIILHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPQ-NHPVPDARSGHSLIADQEGAI 261
            + + GG +D      Y N  +  +  + KW   + P  N+ +P ARSGHSL       +
Sbjct: 338 LMCVFGG-KD--AQDNYSNAVYFLNFRSLKW--FKLPTFNNMIPRARSGHSLTLLSNNKL 392

Query: 262 LWGGYCKVKAGKG 274
           L  G  K     G
Sbjct: 393 LIMGGDKFDYAVG 405

>TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5.88
           YGR238C
          Length = 1009

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 68/252 (26%), Positives = 103/252 (40%), Gaps = 48/252 (19%)

Query: 124 WKRISSQNSPMPR---SSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLL---DCAT 177
           W R+  Q+SP PR    +++ V   + + ++ G    S        Y DTW++   D  T
Sbjct: 94  WNRVKLQDSPFPRYRHVASSYVSDDNRIYVIGGLHDESV-------YGDTWIINVDDSGT 146

Query: 178 KEWTKIEQKN--GPSARSGHRMAVWKN-FIILHGGFRDLGTSTTYLNDCWLFDITTYKWK 234
           +  +K    +   P  R GH   +  N F+I  G    + +     +D +LF+I ++KW 
Sbjct: 147 QFSSKTVDISEFTPPPRVGHAATLCGNAFVIFGGDTHKVNSEGLMDDDLYLFNINSFKWT 206

Query: 235 QVEFPQNHPV---PDARSGH--SLIADQEGAI---LWGGYCKVKAGKGLQKGKILTDCWY 286
               P  HPV   P  R GH  S+IA  +      L+GG                 D   
Sbjct: 207 ---IP--HPVGPRPLGRYGHKISIIATNQMKTKLYLFGGQF---------DDTFFNDLAV 252

Query: 287 LKMSS-NTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYN 345
             +SS   S   W+  K + F P P    +MV +  +  +FGG     +T + L     N
Sbjct: 253 YDLSSFRRSDSHWEFLKPKTFVPPPLANHTMVSYDHKLWIFGG-----DTMQGL----IN 303

Query: 346 DVFTYQINMNRW 357
            VF Y I  N W
Sbjct: 304 KVFVYDIMSNDW 315

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 78/184 (42%), Gaps = 26/184 (14%)

Query: 90  KSELIMFGGEHTIQSTSTTHFFNDLVV-----FSPDNEQWKRISSQN-SPMPRSSAAMVG 143
           K++L +FGG+          FFNDL V     F   +  W+ +  +   P P ++  MV 
Sbjct: 232 KTKLYLFGGQFD------DTFFNDLAVYDLSSFRRSDSHWEFLKPKTFVPPPLANHTMVS 285

Query: 144 HPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIEQKNG-PSARSGHRMAVWKN 202
           +   + +  GG+      N  + Y      D  + +W+ +E     P     H   ++K+
Sbjct: 286 YDHKLWIF-GGDTMQGLINKVFVY------DIMSNDWSLVETTGARPPPLQEHAALIYKD 338

Query: 203 FIILHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPQ-NHPVPDARSGHSLIADQEGAI 261
            + + GG  +      YLN  +  ++ + +W   +FP     +P  RSGHS+   +   I
Sbjct: 339 LMCVVGGKDE---QDIYLNSIYFLNLKSCRW--FKFPVFKAGIPQGRSGHSITLLKNNKI 393

Query: 262 LWGG 265
           L  G
Sbjct: 394 LIMG 397

>Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON}
           YGR238C (REAL)
          Length = 894

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 59/198 (29%), Positives = 97/198 (48%), Gaps = 36/198 (18%)

Query: 81  SMIAN-PIHGKSELIMFGGEHTIQSTSTTHFFNDLVVFSPDNEQWKRISSQ--------N 131
           S+IAN P+  K  L +FGG+  I  T    +FNDL +F  D   ++R +S          
Sbjct: 203 SIIANNPMQTK--LFLFGGQ--IDET----YFNDLAMF--DLSSFRRPNSHWVFLKPVSI 252

Query: 132 SPMPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIEQKNG--P 189
            P P ++  MV   + + +  G    +P  NT  +  +T+  D    +W+KI Q  G  P
Sbjct: 253 VPPPLTNHTMVTFDNKLWVFGG---KTP--NTLSN--ETFCYDPVQNDWSKI-QTTGERP 304

Query: 190 SARSGHRMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPQ-NHPVPDAR 248
            A   H   V+K+ + + GG +D+  +  Y ND +  ++ T+KW   + P+    +P  R
Sbjct: 305 PAVQEHASVVYKHLMCIFGG-KDIQNA--YSNDVYFLNLITFKW--YKLPRIKEGLPKER 359

Query: 249 SGHSL-IADQEGAILWGG 265
           SGHSL +   +  ++ GG
Sbjct: 360 SGHSLTLIKNDKLVIMGG 377

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 69/266 (25%), Positives = 103/266 (38%), Gaps = 48/266 (18%)

Query: 124 WKRISSQNSPMPR---SSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDC---AT 177
           W RI  +NSP PR   S++ +V + + +       F +   +    Y DTW +      T
Sbjct: 73  WNRIKLKNSPFPRYRHSASPIVTNDNRI-------FVTGGLHDHLVYGDTWQITGNLDGT 125

Query: 178 KEWTKIEQ--KNGPSARSGHRMAVWKN-FIILHGGFRDLGTSTTYLNDCWLFDITTYKWK 234
              +K  Q  +N P  R GH   +  N +++  G    L  +    +D +LF+I +YKW 
Sbjct: 126 SFVSKTIQIGQNTPPPRVGHASTICGNAYVVFGGDTHKLNMNRLLDDDLYLFNINSYKWT 185

Query: 235 QVEFPQNHPV---PDARSGH--SLIAD---QEGAILWGGYCKVKAGKGLQKGKILTDCWY 286
               PQ  PV   P  R GH  S+IA+   Q    L+GG                 D   
Sbjct: 186 ---IPQ--PVGTRPLGRYGHKISIIANNPMQTKLFLFGGQI---------DETYFNDLAM 231

Query: 287 LKMSS-NTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYN 345
             +SS       W   K     P P    +MV    +  +FGG     +T  +L     N
Sbjct: 232 FDLSSFRRPNSHWVFLKPVSIVPPPLTNHTMVTFDNKLWVFGG-----KTPNTLS----N 282

Query: 346 DVFTYQINMNRWYSLSLRPQRKKQVK 371
           + F Y    N W  +    +R   V+
Sbjct: 283 ETFCYDPVQNDWSKIQTTGERPPAVQ 308

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 77/195 (39%), Gaps = 35/195 (17%)

Query: 174 DCATKEWTKIEQKNGPSARSGHR---MAVWKNFIILHGGFRDLGTSTTYLNDCWL----F 226
           D     W +I+ KN P  R  H    +    N I + GG  D         D W      
Sbjct: 67  DAGKYVWNRIKLKNSPFPRYRHSASPIVTNDNRIFVTGGLHD----HLVYGDTWQITGNL 122

Query: 227 DITTYKWKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTDCWY 286
           D T++  K ++  QN P P  R GH+        +++GG         L   ++L D  Y
Sbjct: 123 DGTSFVSKTIQIGQNTPPP--RVGHASTICGNAYVVFGG-----DTHKLNMNRLLDDDLY 175

Query: 287 LKMSSNTSAIRWDRKKRQGFQPSPRVG--CSMV---PHKGRGVLFGGVYDFEETEESLES 341
           L    N ++ +W   +  G +P  R G   S++   P + +  LFGG  D          
Sbjct: 176 L---FNINSYKWTIPQPVGTRPLGRYGHKISIIANNPMQTKLFLFGGQID---------E 223

Query: 342 NFYNDVFTYQINMNR 356
            ++ND+  + ++  R
Sbjct: 224 TYFNDLAMFDLSSFR 238

>ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} similar
           to uniprot|Q75AR9 Ashbya gossypii ADL149W ADL149Wp and
           some similarites with YHR158C uniprot|P38853
           Saccharomyces cerevisiae YHR158C KEL1 Protein required
           for proper cell fusion and cell morphology functions in
           a complex with Kel2p to negatively regulate mitotic exit
           interacts with Tem1p and Lte1p localizes to regions of
           polarized growth potential Cdc28p substrate
          Length = 1293

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 63/258 (24%), Positives = 101/258 (39%), Gaps = 60/258 (23%)

Query: 124 WKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNTFY-----H----YSDTWLL- 173
           W R+  QNSP PR               H    +  + N+ Y     H    Y DTW++ 
Sbjct: 141 WNRVKLQNSPFPR-------------YRHVASSNCSEDNSLYVIGGLHDQSVYGDTWIIS 187

Query: 174 --DCATKEWTKIEQ--KNGPSARSGHRMAVWKNFIILHGG-FRDLGTSTTYLNDCWLFDI 228
             D  T+  +K  +  +  P  R GH   +  N  +L GG    + +     +D +LF++
Sbjct: 188 TNDNGTQFQSKTVEISETTPPPRVGHAATLCGNAFVLFGGDTHKVNSEGLMDDDLYLFNV 247

Query: 229 TTYKWKQVEFPQNHPV---PDARSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTDCW 285
            +YKW     P  HP+   P  R GH +      +I+     K K       G    D +
Sbjct: 248 NSYKWT---IP--HPIGPRPLGRYGHKI------SIMAANQMKTKL---YLFGGQFDDTY 293

Query: 286 YLKMSS-NTSAIR-----WDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESL 339
           +  ++  + S+ R     W+  K   F P P    +M+ +     +FGG        ++L
Sbjct: 294 FNDLAVFDLSSFRRPDSHWEFLKPTTFSPPPLTNHTMISYDNHLWVFGG--------DTL 345

Query: 340 ESNFYNDVFTYQINMNRW 357
           +    N VF Y +  N W
Sbjct: 346 QG-LINQVFKYDVANNDW 362

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 91/195 (46%), Gaps = 33/195 (16%)

Query: 82  MIANPIHGKSELIMFGGEHTIQSTSTTHFFNDLVVFS------PDNEQWKRISSQN-SPM 134
           M AN +  K++L +FGG+          +FNDL VF       PD+  W+ +     SP 
Sbjct: 273 MAANQM--KTKLYLFGGQFD------DTYFNDLAVFDLSSFRRPDS-HWEFLKPTTFSPP 323

Query: 135 PRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIEQKNG--PSAR 192
           P ++  M+ + + + +  GG+      N  + Y      D A  +W+ I +  G  P   
Sbjct: 324 PLTNHTMISYDNHLWVF-GGDTLQGLINQVFKY------DVANNDWS-IAETTGTKPPPM 375

Query: 193 SGHRMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDITTYKW-KQVEFPQNHPVPDARSGH 251
             H   V+K+ +++ GG  +     TYLN  +  ++ T++W K   F     +P  RSGH
Sbjct: 376 QEHAAVVYKHVMVVVGGKDE---HDTYLNSVYFLNLKTHEWFKLPTFKAG--IPQGRSGH 430

Query: 252 SL-IADQEGAILWGG 265
           SL + + +  ++ GG
Sbjct: 431 SLTLLNNDKLLIMGG 445

>NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1167

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 79/190 (41%), Gaps = 32/190 (16%)

Query: 90  KSELIMFGGEHTIQSTSTTHFFNDLVVFS------PDNEQWKRISSQN-SPMPRSSAAMV 142
           K++L +FGG+          +FNDLVVF       PD+  W+ I  ++  P P ++  M 
Sbjct: 300 KTKLYLFGGQFD------DTYFNDLVVFDLSSFRRPDS-HWEFIRPKSFIPPPLTNHTMC 352

Query: 143 GHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIEQ-------KNGPSARSGH 195
            +   + +  G          F       + D    +W  +E         N P     H
Sbjct: 353 SYDHKLWVFGGDTLQGLTNQVF-------MYDPVDNDWCVVETFANNNDVSNIPPPIQEH 405

Query: 196 RMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPQNHPVPDARSGHSLIA 255
              ++K+ + + GG  +   S  YLND +  ++ T KW ++ F     VP  RSGHS+  
Sbjct: 406 AAVLYKDLMCVIGGKDE---SDNYLNDVYFLNLKTLKWFKLPF-YKEGVPQGRSGHSVTL 461

Query: 256 DQEGAILWGG 265
            +   IL  G
Sbjct: 462 LKNDKILIMG 471

 Score = 51.2 bits (121), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 98/255 (38%), Gaps = 52/255 (20%)

Query: 124 WKRISSQNSPMPR---SSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLD------ 174
           W RI  QNSP PR    +++ V     + ++ G    S        Y DTW+L       
Sbjct: 160 WNRIKLQNSPFPRYRHVASSYVSDDGKIYVIGGLHDQSV-------YGDTWILSYENNGL 212

Query: 175 --CATKEWTKIEQKNGPSARSGHRMAVWKN-FIILHGGFRDLGTSTTYLNDCWLFDITTY 231
               T +   I + N P  R GH   +  N F+I  G    +    +  +D +LF+I +Y
Sbjct: 213 STTITSKTVDISE-NTPPPRVGHAATLCGNAFVIFGGDTHKVNKDGSMDDDIYLFNINSY 271

Query: 232 KWKQVEFPQNHPV---PDARSGH--SLIADQEGAI---LWGGYCKVKAGKGLQKGKILTD 283
           KW     P+  PV   P  R GH  S+IA  +      L+GG                 D
Sbjct: 272 KWT---IPK--PVGQRPLGRYGHKISIIATSQMKTKLYLFGGQF---------DDTYFND 317

Query: 284 CWYLKMSS-NTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESN 342
                +SS       W+  + + F P P    +M  +  +  +FGG        ++L+  
Sbjct: 318 LVVFDLSSFRRPDSHWEFIRPKSFIPPPLTNHTMCSYDHKLWVFGG--------DTLQG- 368

Query: 343 FYNDVFTYQINMNRW 357
             N VF Y    N W
Sbjct: 369 LTNQVFMYDPVDNDW 383

>KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1056

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 64/247 (25%), Positives = 95/247 (38%), Gaps = 38/247 (15%)

Query: 124 WKRISSQNSPMPR---SSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEW 180
           W R+   NSP PR    ++A     + V ++ G    S        Y DTW++  A    
Sbjct: 78  WSRVKLANSPFPRYRHVASAYASEQNQVYVIGGLHDQS-------VYGDTWII-SAHDNG 129

Query: 181 TKIEQKN------GPSARSGHRMAVWKN-FIILHGGFRDLGTSTTYLNDCWLFDITTYKW 233
           +K   K        P  R GH   +  N F+I  G    + +     +D +LF+I +YKW
Sbjct: 130 SKFSSKTVDITDTTPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLMDDDVYLFNINSYKW 189

Query: 234 KQVEFPQNHPVPDARSGH--SLIADQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMSS 291
             +  P   P P  R GH  S+IA  +         K+    G        D     +SS
Sbjct: 190 T-IPRPVG-PRPLGRYGHKISIIATSQ------MRTKLYVFGGQFDDTYFNDLTVFDLSS 241

Query: 292 -NTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYNDVFTY 350
                  W   K   F P P    +M+ +  +  +FGG     +T + L     NDVF +
Sbjct: 242 FRRPDSHWQFIKPNTFTPPPLTNHTMISYDYKLWVFGG-----DTPQGL----INDVFMF 292

Query: 351 QINMNRW 357
              +N W
Sbjct: 293 DPQINDW 299

 Score = 38.9 bits (89), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 81/195 (41%), Gaps = 30/195 (15%)

Query: 90  KSELIMFGGEHTIQSTSTTHFFNDLVVFS------PDNEQWKRISSQN-SPMPRSSAAMV 142
           +++L +FGG+          +FNDL VF       PD+  W+ I     +P P ++  M+
Sbjct: 216 RTKLYVFGGQFD------DTYFNDLTVFDLSSFRRPDS-HWQFIKPNTFTPPPLTNHTMI 268

Query: 143 GHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIEQKNG--PSARSGHRMAVW 200
            +   + +  G    +P+       +D ++ D    +W K+ Q  G  P     H   ++
Sbjct: 269 SYDYKLWVFGG---DTPQG----LINDVFMFDPQINDW-KVMQTTGDKPPPLQEHAAVLY 320

Query: 201 KNFIILHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPQ-NHPVPDARSGHSLIADQEG 259
            + + + GG  +      Y N  +  ++ + KW   + P     +P  RSGHSL      
Sbjct: 321 GDLMCVVGGKDE---QDVYSNSVFFLNLISLKW--FKLPSYRSGIPQGRSGHSLTLLPNH 375

Query: 260 AILWGGYCKVKAGKG 274
            +L  G  K    +G
Sbjct: 376 KLLIMGGDKFDYARG 390

>KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1104

 Score = 51.2 bits (121), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 70/281 (24%), Positives = 112/281 (39%), Gaps = 59/281 (20%)

Query: 116 VFSPD-------NEQWKRISSQNSPMPR---SSAAMVGHPSGVALLHGGEFSSPKQNTFY 165
           VFSP        N  W RI  ++SP PR    +++       V ++ G    S       
Sbjct: 182 VFSPSPELVPKGNVVWNRIKLKDSPFPRYRHVTSSYATEDDRVFVIGGLHDQS------- 234

Query: 166 HYSDTWL---LDCATK-EWTKIE-QKNGPSARSGHRMAVWKN-FIILHGGFRDLGTSTTY 219
            + D W+   L+  TK   T I+  +N P  R GH   +  N F++  G    +      
Sbjct: 235 VFGDVWIIKSLENGTKFTSTTIDITENTPPPRVGHAATLCGNAFVVFGGDTHKVNKDGLM 294

Query: 220 LNDCWLFDITTYKWKQVEFPQNHPVPDARSGH--SLIAD---QEGAILWGGYCKVKAGKG 274
            +D +LF+I +YKW  +  P   P P  R GH  S+IA    +    L+GG         
Sbjct: 295 DDDLYLFNINSYKWT-IPNPIG-PRPLGRYGHKVSIIATTPMKTKLYLFGGQ-------- 344

Query: 275 LQKGKILTDCWYLKMSS-NTSAIR-----WDRKKRQGFQPSPRVGCSMVPHKGRGVLFGG 328
                   D ++  ++  + S  R     W+  K + F P P    +MV ++ +  +FGG
Sbjct: 345 ------FDDTYFNNLAVFDLSQFRRPDSHWEFLKPKSFMPPPLTNHTMVSYQNKLWIFGG 398

Query: 329 VYDFEETEESLESNFYNDVFTYQINMNRWYSLSLRPQRKKQ 369
                   ++L+    N +F Y   +N W  +   P    Q
Sbjct: 399 --------DTLQG-LINKIFMYDPEVNDWTVVETFPANNDQ 430

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 88/210 (41%), Gaps = 34/210 (16%)

Query: 90  KSELIMFGGEHTIQSTSTTHFFNDLVVFSPDNEQWKRISSQ--------NSPMPRSSAAM 141
           K++L +FGG+          +FN+L VF  D  Q++R  S           P P ++  M
Sbjct: 335 KTKLYLFGGQFD------DTYFNNLAVF--DLSQFRRPDSHWEFLKPKSFMPPPLTNHTM 386

Query: 142 VGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIE-------QKNGPSARSG 194
           V + + + +  GG+      N  + Y      D    +WT +E       Q+N P     
Sbjct: 387 VSYQNKLWIF-GGDTLQGLINKIFMY------DPEVNDWTVVETFPANNDQENFPPPMQE 439

Query: 195 HRMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPQNHPVPDARSGHSLI 254
           H   ++ + +++ GG  +      YLN  +   I T +W ++ F  +  +P  RSGHS+ 
Sbjct: 440 HASVMYGDLMVVMGGKDE---QDNYLNTVYFLKINTLEWYKLPF-LSVGIPQGRSGHSIT 495

Query: 255 ADQEGAILWGGYCKVKAGKGLQKGKILTDC 284
             +   +L  G  K    +  + G   TD 
Sbjct: 496 LLKGNKLLIMGGDKFDYARPEEHGLHTTDT 525

>YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}
           KEL2Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 882

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 65/253 (25%), Positives = 99/253 (39%), Gaps = 50/253 (19%)

Query: 124 WKRISSQNSPMPR---SSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEW 180
           W R+  +NSP PR   SS+ +V + + + +  G    S        Y D W +  A  + 
Sbjct: 73  WNRVKLKNSPFPRYRHSSSFIVTNDNRIFVTGGLHDQSV-------YGDVWQI-AANADG 124

Query: 181 TKIEQK------NGPSARSGHRMAVWKN-FIILHGGFRDLGTSTTYLNDCWLFDITTYKW 233
           T    K      N P  R GH   +  N +++  G    L  +    +D +LF+I +YKW
Sbjct: 125 TSFTSKRIDIDQNTPPPRVGHASTICGNAYVVFGGDTHKLNKNGLLDDDLYLFNINSYKW 184

Query: 234 KQVEFPQNHPV---PDARSGH--SLIAD---QEGAILWGGYCKVKAGKGLQKGKILTDCW 285
                PQ  P+   P  R GH  S+IA    Q    L+GG                 D  
Sbjct: 185 T---IPQ--PIGRRPLGRYGHKISIIASNPMQTKLYLFGGQV---------DETYFNDLV 230

Query: 286 YLKMSS-NTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFY 344
              +SS       W+  +  G  P P    +MV +  +  +FGG     ET +++     
Sbjct: 231 VFDLSSFRRPNSHWEFLEPVGDLPPPLTNHTMVAYDNKLWVFGG-----ETPKTIS---- 281

Query: 345 NDVFTYQINMNRW 357
           ND + Y    + W
Sbjct: 282 NDTYRYDPAQSEW 294

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 50/262 (19%), Positives = 96/262 (36%), Gaps = 48/262 (18%)

Query: 84  ANPIHGKSELIMFGGEHTIQSTSTTHFFNDLVVFSPDNEQWKRISSQNSPMPRSSAAMVG 143
           A+ I G + ++  G  H +         +DL +F+ ++ +W    +   P+ R      G
Sbjct: 146 ASTICGNAYVVFGGDTHKLNKNGL--LDDDLYLFNINSYKW----TIPQPIGRRPLGRYG 199

Query: 144 HPSGVALLHGGEFSSPKQNTFYHYS----DTWLLDCATKEWTKIEQKNG----------- 188
           H   +        S+P Q   Y +     +T+  D    + +   + N            
Sbjct: 200 HKISIIA------SNPMQTKLYLFGGQVDETYFNDLVVFDLSSFRRPNSHWEFLEPVGDL 253

Query: 189 PSARSGHRMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPQNHPVPDAR 248
           P   + H M  + N + + GG     T  T  ND + +D    +W +V+     P P   
Sbjct: 254 PPPLTNHTMVAYDNKLWVFGG----ETPKTISNDTYRYDPAQSEWSKVKTTGEKPPP--- 306

Query: 249 SGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMSSNTSAIRWDR--KKRQGF 306
                   +  ++++     V  GK         D ++L + S    ++W +  + ++G 
Sbjct: 307 ------IQEHASVVYKHLMCVLGGKDTHNA-YSNDVYFLNLLS----LKWYKLPRMKEGI 355

Query: 307 QPSPRVGCSMVPHKGRGVLFGG 328
            P  R G S+   K   +L  G
Sbjct: 356 -PQERSGHSLTLMKNEKLLIMG 376

>TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {ON}
           Anc_5.88 YGR238C
          Length = 828

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 63/258 (24%), Positives = 98/258 (37%), Gaps = 43/258 (16%)

Query: 120 DNEQWKRISSQNSPMPRSS--AAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCA- 176
           D   W +I+ + +P PR     +   +PS    ++GG F S        Y DTW L+   
Sbjct: 18  DYSPWSKINVKGTPFPRYRHITSSYIYPSNDLYINGGLFESDV------YGDTWKLNIKE 71

Query: 177 ------TKEW---TKIEQKNG--PSARSGHRMAVWKNFIILHGG-FRDLGTSTTYLND-C 223
                  + W     I    G  P  R GH   +  N +I+ GG    +  S   ++D  
Sbjct: 72  NYNENDLERWHYSCNIIDIMGTTPPPRVGHAATLCGNALIVFGGDTHKVNVSNGLMDDDL 131

Query: 224 WLFDITTYKWKQVEFPQNHPV-PDARSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILT 282
           +  ++ T KW     P    + P  R GH +        L+GG         L K  +L 
Sbjct: 132 YFLNLDTTKWT---IPSPKGIRPLGRYGHKISVINSNLYLFGGQFDETYFNDLVKFDLL- 187

Query: 283 DCWYLKMSSNTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESN 342
                  +   +  +W+  K +GF P P    SM   + +  +FGG     +T + L   
Sbjct: 188 -------NFKDANSQWEFIKPKGFIPPPLSNFSMCTFENKLYVFGG-----DTYQVLT-- 233

Query: 343 FYNDVFTYQINMNRWYSL 360
             N+ F Y   +N W  L
Sbjct: 234 --NETFVYDPELNEWSIL 249

>CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {ON}
           weakly similar to uniprot|P50090 Saccharomyces
           cerevisiae YGR238c KEL2 or uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1
          Length = 936

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/252 (23%), Positives = 92/252 (36%), Gaps = 42/252 (16%)

Query: 124 WKRISSQNSPMPRSS--AAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWT 181
           W R    +SP+PR    A+    P     + GG            Y DTW+L  A  + T
Sbjct: 162 WGRTRLMSSPLPRYRHIASTYATPDNRIFVMGGLHGE------LVYGDTWML-TANSDST 214

Query: 182 KIEQK------NGPSARSGHRMAVWKNFIILHGG-FRDLGTSTTYLNDCWLFDITTYKWK 234
               +      N P  R GH   +  N +++ GG    L +     +D +LF++ +++W 
Sbjct: 215 NFTTQVIDLTVNTPPPRVGHAATLCGNALVIFGGDTHKLNSEGLLDDDLYLFNVDSHRWT 274

Query: 235 QVEFPQNHPVPDARSGH--SLIA---DQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKM 289
                   P+   R GH  S+IA    +    L+GG                 D     +
Sbjct: 275 IPTPIGTRPL--GRYGHQVSVIATTPKKAKLYLFGGQL---------DDNYFNDLAMYDL 323

Query: 290 SS-NTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYNDVF 348
           S       RW   K + F P P    +MV +  +  +FGG         S      N ++
Sbjct: 324 SDFRNPHSRWQFLKSKAFTPPPLTNHTMVAYDYKLWVFGG---------SSRGELQNQLY 374

Query: 349 TYQINMNRWYSL 360
            Y  ++N W  L
Sbjct: 375 VYIPDLNEWRCL 386

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 60/138 (43%), Gaps = 17/138 (12%)

Query: 95  MFGGEHTIQSTSTTHFFNDLVVFSPDNEQWKRISSQ-NSPMPRSSAAMVGHPSGVALLHG 153
           +FGG      +S     N L V+ PD  +W+ + ++ + P P    +   + + + +  G
Sbjct: 360 VFGG------SSRGELQNQLYVYIPDLNEWRCLETEGDKPQPIQEHSATIYKNLMCVFGG 413

Query: 154 GEFSSPKQNTFYHYSDTWLLDCATKEWTKIEQK--NGPSARSGHRMAVWKN--FIILHGG 209
                  QNT Y       L+  T +W +++    N P  RSG  M++ +N   +I+ G 
Sbjct: 414 KNKDDEYQNTMY------FLNLQTLKWYRLDTSHCNEPLPRSGQSMSLMQNDKILIMGGD 467

Query: 210 FRDLGTSTTYLNDCWLFD 227
             D   +   LND   +D
Sbjct: 468 KNDYCVNGANLNDIDEYD 485

>Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C
           (KEL1) - involved in cell fusion and morphology;
           contains six Kelch repeats [contig 244] FULL
          Length = 978

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 62/247 (25%), Positives = 95/247 (38%), Gaps = 38/247 (15%)

Query: 124 WKRISSQNSPMPR---SSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCA---- 176
           W+RI   NSP PR    ++A     + V ++ G    S        Y DTW++       
Sbjct: 76  WRRIKLANSPFPRYRHVASAYASEQNQVYVIGGLHDQS-------VYGDTWIVTSHENGA 128

Query: 177 --TKEWTKIEQKNGPSARSGHRMAVWKN-FIILHGGFRDLGTSTTYLNDCWLFDITTYKW 233
             T +  +I     P  R GH   +  N F+I  G    + +     +D +LF+I +YKW
Sbjct: 129 RFTSKTVEISDAT-PPPRVGHASTLCGNAFVIFGGDTHKVNSDGLMDDDVYLFNINSYKW 187

Query: 234 KQVEFPQNHPVPDARSGH--SLIADQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMSS 291
             +  P   P P  R GH  S+IA      +     K+    G        D     +SS
Sbjct: 188 T-IPNPVG-PRPLGRYGHKISIIA------MSPMKTKLYVFGGQFDDTYFNDLAVFDLSS 239

Query: 292 -NTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYNDVFTY 350
                  W       F P P    +M+ +  +  +FGG     +T + L     +DVF +
Sbjct: 240 FRRPDSSWQFITPNSFTPPPLTNHAMISYDYKLWVFGG-----DTPQGL----IDDVFVF 290

Query: 351 QINMNRW 357
              +N W
Sbjct: 291 DPQVNDW 297

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/252 (22%), Positives = 100/252 (39%), Gaps = 38/252 (15%)

Query: 90  KSELIMFGGEHTIQSTSTTHFFNDLVVFS------PDNEQWKRISSQN-SPMPRSSAAMV 142
           K++L +FGG+          +FNDL VF       PD+  W+ I+  + +P P ++ AM+
Sbjct: 214 KTKLYVFGGQFD------DTYFNDLAVFDLSSFRRPDS-SWQFITPNSFTPPPLTNHAMI 266

Query: 143 GHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIEQKNG--PSARSGHRMAVW 200
            +   + +  G    +P+        D ++ D    +W K  Q  G  P     H   ++
Sbjct: 267 SYDYKLWVFGG---DTPQG----LIDDVFVFDPQVNDW-KFIQTTGQKPPPLQEHASVLY 318

Query: 201 KNFIILHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPQNHPVPDARSGHSLIADQEGA 260
            + + + GG  +      Y N  +  ++ + KW +  F +   +P  RSGHSL       
Sbjct: 319 GDLMCIVGGKDE---QDVYSNGVYFLNLISLKWFKFPFFRAG-IPQGRSGHSLTLLPNHK 374

Query: 261 ILWGGYCKVKAGKG----LQKGKILTDCWYLKMSSNTSAIR------WDRKKRQGFQPSP 310
           +L  G  K    +G        ++   C  L  + + S +R      +D  +        
Sbjct: 375 LLIMGGDKFDYARGGDDDFHTSEVDMACGTLLYTLDLSKLREQCPGIFDTNRAGALPKGV 434

Query: 311 RVGCSMVPHKGR 322
            V  +  P  GR
Sbjct: 435 AVTPNSTPQAGR 446

>TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1016

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 96/254 (37%), Gaps = 40/254 (15%)

Query: 124 WKRISSQNSPMPRSSAAMVGHPS--GVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWT 181
           W RI   NSP PR       + S      + GG            Y DTW +  +T   T
Sbjct: 142 WNRIKLTNSPFPRYRHVASSYESVDNEIFVIGGLHDQSV------YGDTWSI-TSTNNGT 194

Query: 182 KIEQKN------GPSARSGHRMAVWKN-FIILHGGFRDLGTSTTYLNDCWLFDITTYKWK 234
           +   K        P  R GH   +  N F++  G    +       +D +LF+I ++KW 
Sbjct: 195 QFISKALEILDLSPPPRVGHASTLCGNAFVVFGGDTHKVNKDGLMDDDIYLFNINSHKWT 254

Query: 235 QVEFPQNHPVPDARSGH--SLIADQEGAI---LWGGYCKVKAGKGLQKGKILTDCWYLKM 289
            +  P   P P  R GH  S+IA         L+GG                 D     +
Sbjct: 255 -IPSPVG-PRPLGRYGHKISIIATSSSKTKLYLFGGQFD---------DTYFNDIAVFDL 303

Query: 290 SSNTSA-IRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYNDVF 348
           SS   A   W+  K +G  P P    +MV +  +  +FGG     +T++ L ++ Y   F
Sbjct: 304 SSFRRADSHWEFIKPKGLIPPPMTNHTMVTYDNKLWVFGG-----DTKDGLINDIY--AF 356

Query: 349 TYQINMNRWYSLSL 362
               ++N W  + +
Sbjct: 357 DPADSINTWTKIDV 370

>Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa]
           {ON} complement(151895..154816) [2922 nt, 974 aa]
          Length = 973

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 57/244 (23%), Positives = 99/244 (40%), Gaps = 48/244 (19%)

Query: 132 SPMPRSSAAMVGHPSGVA----LLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIEQKN 187
           +P PR     VGH S +     +L GG+     ++      D +L +  + +WT I +  
Sbjct: 101 TPPPR-----VGHASTICGNALILFGGDTHKVNEDGLMD-DDLYLFNLNSYKWT-IPEPI 153

Query: 188 G--PSARSGHRMAVW-----KNFIILHGG-FRDLGTSTTYLNDCWLFDITTYKWKQVEFP 239
           G  P  R GH++++      K  + L GG F D     TY ND  +FD++T++    ++ 
Sbjct: 154 GLRPLGRYGHKISIIATQPTKTKLFLFGGQFDD-----TYFNDLSMFDLSTFRKPDAQWE 208

Query: 240 QNHP---VPDARSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMSSNTSAI 296
              P    P   S H++I+      ++GG    +  +GL     + D             
Sbjct: 209 FIKPKSFFPPPVSNHTMISYDNKLWVFGG----ETLQGLINEVFVYDPI---------VN 255

Query: 297 RWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYNDVFTYQINMNR 356
            W   +  G  P P    + V +K    + GG        +  + N+ N V+   +N  +
Sbjct: 256 DWSVIETTGSSPPPIQEHAAVVYKNLMCVVGG--------KDSKDNYMNSVYFLNLNTLK 307

Query: 357 WYSL 360
           W+ L
Sbjct: 308 WFKL 311

>TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1172

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 66/174 (37%), Gaps = 23/174 (13%)

Query: 189 PSARSGHRMAVWKN-FIILHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPQN-HPVPD 246
           P  R GH   +  N F+I  G            +D +LF+I +YKW     PQ   P P 
Sbjct: 140 PPPRVGHASTLCGNAFVIFGGDTHKTNKDGLMDDDIYLFNINSYKWT---IPQPVGPRPL 196

Query: 247 ARSGHSLIADQEGAILWGGYCKVKA---GKGLQKGKILTDCWYLKMSSNTSAIRWDRKKR 303
            R GH +      +I+     K K    G           C Y   S       W+  K 
Sbjct: 197 GRYGHKI------SIIATSQMKTKLYVFGGQFDDSYFNDLCVYDLSSFRKPESHWEFLKP 250

Query: 304 QGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYNDVFTYQINMNRW 357
           + F P P    +MV +  +  +FGG     +T++ L     N +F +   +N W
Sbjct: 251 KSFIPPPLTNHTMVSYDYKLWVFGG-----DTQQGL----INQLFMFDPVINDW 295

>Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar to
           Ashbya gossypii ADL149W
          Length = 1362

 Score = 39.7 bits (91), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 60/253 (23%), Positives = 93/253 (36%), Gaps = 42/253 (16%)

Query: 120 DNEQWKRISSQNSPMP--RSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCA- 176
           D   W R+    SP P  R  A+     S    + GG            Y DTW++    
Sbjct: 154 DETPWNRVKLLQSPFPRYRHVASSYASDSNEVFVIGGLHDQSV------YGDTWIIKSHE 207

Query: 177 -----TKEWTKIEQKNGPSARSGHRMAVWKN-FIILHGGFRDLGTSTTYLNDCWLFDITT 230
                T +  +I +   P  R GH   +  N F+I  G            +D +L +I +
Sbjct: 208 NGNKFTSKTVEITETT-PPPRVGHASTLCGNAFVIFGGDTHKTNAEGLMDDDVYLLNINS 266

Query: 231 YKWKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMS 290
           +KW  +  P   P P  R GH +      +I+     K K       G    D ++  ++
Sbjct: 267 HKWT-IPRPVG-PRPLGRYGHKI------SIIATSQMKTKL---YVFGGQFDDTYFNDLA 315

Query: 291 S-NTSAIR-----WDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFY 344
             + S+ R     W   K   F P P    +MV +  +  +FGG     +T + L     
Sbjct: 316 VYDLSSFRRPDSHWQFLKPVSFVPPPLTNHTMVSYDYKLWVFGG-----DTPQGL----I 366

Query: 345 NDVFTYQINMNRW 357
           N++F Y    N W
Sbjct: 367 NELFMYDPTTNDW 379

>Kpol_538.45 s538 complement(101351..103897) [2547 bp, 848 aa] {ON}
           complement(101351..103897) [2547 nt, 849 aa]
          Length = 848

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 66/309 (21%), Positives = 112/309 (36%), Gaps = 75/309 (24%)

Query: 74  PSRRINPSMIANPIHGKSELIMFGGEHTIQSTSTTHFFNDLVVFSPDNEQWK-----RIS 128
           PS+R  P  +  P+   SE+     E  +     + F  +  +F  DN+Q +     ++ 
Sbjct: 560 PSKRAFPGFVVPPVQLSSEVDFGDFETRLLERLKSSFHVETNLF--DNDQKEDSPILKVQ 617

Query: 129 SQNSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIEQKNG 188
           + N+     S+ + G+  G+      + SSP   + Y                   ++NG
Sbjct: 618 TSNTEEMSISSHLTGYSEGMQ-----KKSSPSCLSLY------------------SKRNG 654

Query: 189 PSARSGHRMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPQNHPVPDAR 248
                 ++  +    +I+HGG       T  + D WLF+ T   W+   F   +P  D  
Sbjct: 655 KLESESNKGKI----LIIHGG----SDHTNVIGDMWLFNFTKETWEHEHFLIKNPQEDRY 706

Query: 249 S-------GHSLIADQEGAILWGGYCK------------VKAG---KGLQKGKILT---- 282
                   GH+L      A+ +GG  +             K G   +GL  G  L     
Sbjct: 707 KAIDIPLVGHTLTFIGYSAVSFGGLTQDDINSVYNLGDEAKVGGDHEGLALGSNLVNYIN 766

Query: 283 ------DCWYLKMSSNTSAIRWDRKKRQGFQPSP-RVGCSMVPHKGRGVLFGGVYDFEET 335
                 +   LK+ + T   +  R K    + +   +GC +  + G  +L GGV      
Sbjct: 767 LKTFQLESKELKLVAGTDEYKLVRDKTVNARSTVLAIGCIVAMNNGSYLLIGGVL----A 822

Query: 336 EESLESNFY 344
           E S  S FY
Sbjct: 823 ERSKLSKFY 831

>KAFR0I02910 Chr9 complement(582726..584801) [2076 bp, 691 aa] {ON}
           Anc_3.15 YOL141W
          Length = 691

 Score = 35.0 bits (79), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 82/191 (42%), Gaps = 42/191 (21%)

Query: 134 MPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIEQKNG---PS 190
           + R+  + + H  G  +  GG   +P +      SDT  +D  T++ T I+ +N    P 
Sbjct: 390 LKRNFGSSIKHDEGNIMYTGG--CNPNR-----ISDTLKID--TQKNTFIQLQNHSVLPP 440

Query: 191 ARSGH---RMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPQNHPVPDA 247
           AR+ H   R+   +  +++ G           +NDCW +++ T +W+     +   +P+ 
Sbjct: 441 ARACHTFTRLGDGETAMVIGGR----NAPHRAVNDCWFYNLNTNEWQ-----KGPELPEP 491

Query: 248 RSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTD--------CWY----LKMSSNTSA 295
           R  HS +A  +  +L  G      GK   +  +L D        C      LK+   ++A
Sbjct: 492 RFRHSCVATDKNTLLVCG------GKTDGQAFLLYDNISETFKPCPVDHPSLKIPLISAA 545

Query: 296 IRWDRKKRQGF 306
           + +D K  +G 
Sbjct: 546 VAFDEKNNRGI 556

>ZYRO0C00550g Chr3 (39312..41858) [2547 bp, 848 aa] {ON} similar to
           uniprot|Q08886 Saccharomyces cerevisiae YOR371C GPB1
           Proposed beta subunit of the heterotrimeric G protein
           that interacts with the receptor Grp1p has signaling
           role in response to nutrients involved in regulation of
           pseudohyphal growth through cAMP levels homolog of Gpb2p
          Length = 848

 Score = 34.7 bits (78), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 59/156 (37%), Gaps = 36/156 (23%)

Query: 204 IILHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPQNH------PVPDARSGHSLIADQ 257
           +I+HGG       T    D W +DI T  W Q+     H      P+     GHSL+   
Sbjct: 671 LIMHGG----SNKTDVCRDMWWYDIETETWSQITTHGKHEASKMIPIGVGLVGHSLVCVG 726

Query: 258 EGAILWGG--------------YCKVKAGKGLQKGK-------ILTDCW--YLKMSSNTS 294
             A+  GG              Y  ++    L  G        + T C   +  +   T+
Sbjct: 727 GMAVFVGGLLQEDVDFLYHGVDYEDMRIPPQLAIGSDFINLFDLATQCLLGHTVIGDETN 786

Query: 295 A-IRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGV 329
           A +R D + R G   S   G +++   G  +LFGGV
Sbjct: 787 AYLRDDLEARLGVILS--CGFTVIQFNGDILLFGGV 820

>TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7.9
           YAL056W
          Length = 838

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 40/100 (40%), Gaps = 10/100 (10%)

Query: 172 LLDCATKEWTKIEQKNGPSARSGHRMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDITTY 231
           L    + + TK    +GP  +         + +++HGG      +T   +D W FD  T 
Sbjct: 627 LFPIGSPKSTKSNGPSGPVLQLHINETSEGHTLVMHGG----SNATHIYSDMWWFDFETE 682

Query: 232 KWKQVEFPQNH------PVPDARSGHSLIADQEGAILWGG 265
            W Q+E           P+  A +GHS+      +I  GG
Sbjct: 683 SWVQIETQAQTEDKGLVPIEMALAGHSMATVGSASIFVGG 722

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 31/80 (38%), Gaps = 15/80 (18%)

Query: 150 LLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIEQKNGPS---------ARSGHRMAVW 200
           ++HGG       N  + YSD W  D  T+ W +IE +             A +GH MA  
Sbjct: 660 VMHGG------SNATHIYSDMWWFDFETESWVQIETQAQTEDKGLVPIEMALAGHSMATV 713

Query: 201 KNFIILHGGFRDLGTSTTYL 220
            +  I  GG         YL
Sbjct: 714 GSASIFVGGMMQSDVDKLYL 733

>KAFR0C04910 Chr3 (975629..978265) [2637 bp, 878 aa] {ON} Anc_7.9
           YAL056W
          Length = 878

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 35/76 (46%), Gaps = 12/76 (15%)

Query: 204 IILHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEF---PQNH-----PVPDARSGHSLIA 255
           I+LHGG  D    T    D W FD+ T++W +V     P++      P+     GH+++ 
Sbjct: 696 IVLHGGSDD----TNVYGDMWWFDLETFQWTKVATYIKPKDQDSSLVPINIKIVGHTMMT 751

Query: 256 DQEGAILWGGYCKVKA 271
               A+  GG  + + 
Sbjct: 752 SGCMAVCVGGITQAEV 767

>NCAS0B05440 Chr2 (1017388..1022040) [4653 bp, 1550 aa] {ON} 
          Length = 1550

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 52/232 (22%), Positives = 91/232 (39%), Gaps = 38/232 (16%)

Query: 151 LHGGEFSSPKQN-TFYHYSDTWLLDCATKEWTKIEQKNGPSARSGHRMAVWK-------N 202
           + GG   SP+        ++ W L+  TK WT I +    + R  H M +          
Sbjct: 194 IFGGLIVSPQSGYELIATNELWRLNLKTKVWTLISKDPRITRRFNHNMHIKNENNDTRDT 253

Query: 203 FIILHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPQNHPVPDARS---GHSLIADQE- 258
            +I+ GG  +L    ++++   ++++T   WK    P++ P+ DAR+   GH +  + + 
Sbjct: 254 KLIIIGGLNNLDQPVSHID---VYNLTQNCWKADSIPKD-PL-DARTNVDGHEITLNNDV 308

Query: 259 --GAILWGGYCKVKAGKGLQKGKILTDCWYLKMSSNTSAIRWDRKKRQGFQ-----PSPR 311
               ++     K+ A          T  W   ++        +R +    Q      SP 
Sbjct: 309 DFSILIENNEAKIPA------LAYYTPNWQNDVNEEDEENNENRSESSLKQSGKKLASPI 362

Query: 312 VGCSMVPHKGRGVLFGGVYDFEETEESLESNF-----YNDVFTYQINMNRWY 358
           V   +V H  RG+     Y+ E+  E LE  F       D F Y I +  +Y
Sbjct: 363 VALPLVTH-ARGIRMN--YNPEQKNELLEQAFNLQYPTGDYFGYSITVGGFY 411

>YDL074C Chr4 complement(324047..326149) [2103 bp, 700 aa] {ON}
           BRE1E3 ubiquitin ligase, forms heterodimer with Rad6p to
           monoubiquinate histone H2B-K123, which is required for
           the subsequent methylation of histone H3-K4 and H3-K79;
           required for DSBR, transcription, silencing, and
           checkpoint control
          Length = 700

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 5/72 (6%)

Query: 146 SGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIEQKNGPSARSGHRMAVWKNFII 205
           S +A+L   +  +   +   H      +D   ++WTKI+Q++  +  S  + A+ K    
Sbjct: 393 SKIAILEAEKSKTEVLSDLQHA-----IDILKEQWTKIDQRSNDTKSSSTQDALIKEIQD 447

Query: 206 LHGGFRDLGTST 217
           L  GFR+L   T
Sbjct: 448 LEKGFRELSDLT 459

>ZYRO0C03344g Chr3 complement(259809..261785) [1977 bp, 658 aa] {ON}
           similar to similar to uniprot|Q08282 YOL141w
           Saccharomyces cerevisiae PPM2 Putative carboxyl methyl
           transferase
          Length = 658

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 43/94 (45%), Gaps = 13/94 (13%)

Query: 90  KSELIMFGGEHTIQSTSTTHFFNDLVVFSPDNE-QWKRISSQNSPMPRSSAAMVGHPSGV 148
           K +L+ FGG       S     N+++   PD + +        +P+ R+        +  
Sbjct: 372 KKQLLYFGG-------SCPQRTNEIISIGPDGDCEAVPFDKTTAPVARACHTFTLVNNDT 424

Query: 149 ALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTK 182
           A++ GG     ++N +   SDTW+ + ++ EWT+
Sbjct: 425 AMVVGG-----RRNPWQPLSDTWMFNLSSHEWTR 453

>Suva_15.19 Chr15 (34295..36421) [2127 bp, 708 aa] {ON} YOL141W
           (REAL)
          Length = 708

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 62/150 (41%), Gaps = 24/150 (16%)

Query: 189 PSARSGHRMAVW--KNFIILHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPQNHPVPD 246
           P AR  H +  +   + ++L GG +        L+D W+FD  T +W  V+      +  
Sbjct: 450 PLARMCHTLTSFCGSSQLLLVGGRK---APHQGLSDNWIFDTKTNEWSMVQ-----KLSH 501

Query: 247 ARSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMSSNTSAIRWDRKKRQGF 306
            R  HS     + ++L  G        G+ KG ++     L+  +N  A +    K   F
Sbjct: 502 TRFRHSACNLSDNSVLIFG--------GVTKGPVM-----LRYDANEQAFQDITPKDAFF 548

Query: 307 QPS-PRVGCSMVPHKGRGVLFGGVYDFEET 335
           Q S    G +  P   +GV+ GG +  + T
Sbjct: 549 QHSLVSAGLAFNPVSKQGVILGGGFKDQTT 578

>NCAS0B04460 Chr2 (806663..811321) [4659 bp, 1552 aa] {ON} Anc_8.157
           YER132C
          Length = 1552

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 47/115 (40%), Gaps = 12/115 (10%)

Query: 197 MAVWKNFIILHGGFRDLGTSTTYLND-----CWLFDITTYKWKQVEFPQNHPVPDARSGH 251
           +++ K  I+     +D  +S   LND      +  D+ T  W+++E   +      R  H
Sbjct: 70  VSLQKELILYFAKIKDSSSSFKNLNDWISSEIFYLDLITRAWQRIEIETSSENFQERLFH 129

Query: 252 SLIADQEGAILWGGYC-------KVKAGKGLQKGKILTDCWYLKMSSNTSAIRWD 299
           S+ +D     ++GG         ++ A   L K  +LT  W L       A R+D
Sbjct: 130 SMCSDGSNIYIFGGLMVSPQNDYELIATNELWKLDLLTKKWTLMSKDPLIARRFD 184

>CAGL0K02101g Chr11 (182946..187847) [4902 bp, 1633 aa] {ON} similar
           to uniprot|P32634 Saccharomyces cerevisiae YER132c PMD1
           or uniprot|P53094 Saccharomyces cerevisiae YGL197w MDS3
          Length = 1633

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 42/96 (43%), Gaps = 11/96 (11%)

Query: 147 GVALLHGGEFSSP-KQNTFYHYSDTWLLDCATKEWTKIEQKNGPSARSGHRMAVWKN--- 202
           G   + GG   SP  +  F   +D W LD    +W+ + +  G   R  H M V  +   
Sbjct: 170 GFLYIFGGLMISPHNEYEFVATNDLWQLDLRGNKWSLLSKDPGVGRRYNHEMHVLNSEDP 229

Query: 203 ----FIILHGGFRDLGTSTTYLNDCWLFDITTYKWK 234
                +++ GG  ++      ++   +F++TT +W+
Sbjct: 230 TKDTKLVIVGGIDNMDEPVAKID---IFNLTTLQWE 262

>NCAS0A07640 Chr1 complement(1521774..1524515) [2742 bp, 913 aa]
           {ON} Anc_7.9 YAL056W
          Length = 913

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 35/86 (40%), Gaps = 17/86 (19%)

Query: 148 VALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIEQ-----------KNGPSARSGHR 196
           + ++HGG       N    Y D W  D   ++WTKI+             N   A  GH 
Sbjct: 728 MIIIHGG------SNDHKVYGDMWWFDVEMEKWTKIDMYAETNDAKEGLVNCDLALVGHT 781

Query: 197 MAVWKNFIILHGGFRDLGTSTTYLND 222
           MA+  ++ I  GG       T ++++
Sbjct: 782 MAIIGHYAISVGGLIQQDVDTLFISE 807

>KNAG0D02100 Chr4 (351677..356740) [5064 bp, 1687 aa] {ON} Anc_8.157
           YGL197W
          Length = 1687

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 37/208 (17%), Positives = 79/208 (37%), Gaps = 29/208 (13%)

Query: 110 FFNDLVVFSPDNEQWKRISSQ----NSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNTFY 165
           FF DL+     + +W R+ +     + PM       + +      + GG   S       
Sbjct: 117 FFLDLI-----SRKWNRLPTSFKNPDVPMRERLFHTISYSHSAMYVFGGLIVSTNGYELI 171

Query: 166 HYSDTWLLDCATKEWTKIEQKNGPSARSGHRMAVWKNF-------IILHGGFRDLGTSTT 218
             ++ W LD   + W+ + +    + R  H   V   +       +++ GG  ++  S  
Sbjct: 172 ATNELWKLDLTNRVWSLLSEDPQITRRFNHTTQVLNTYSEAHDTKLLIIGGLNNMDQSIA 231

Query: 219 YLNDCWLFDITTYKWKQVEFPQNHPVPDARSGHSL-IADQEGAILWGGYCKVKAGKGLQK 277
           +++   +F+IT   W+       + V     G  + + + + A L   + +++A      
Sbjct: 232 HID---VFNITKGYWETANLDSKNGVLTNVGGEPVCLTNDKNAPLLIEHAELEAS----- 283

Query: 278 GKILTDCWYLKMSSNTSAIRWDRKKRQG 305
               T  +YL  ++N  A ++D   R  
Sbjct: 284 ----TLTFYLSQNNNIPATKYDTILRNA 307

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,786,223
Number of extensions: 2344480
Number of successful extensions: 6563
Number of sequences better than 10.0: 71
Number of HSP's gapped: 6359
Number of HSP's successfully gapped: 114
Length of query: 633
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 517
Effective length of database: 40,180,143
Effective search space: 20773133931
Effective search space used: 20773133931
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)