Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G046006.11ON52852828450.0
Kpol_1032.26.11ON53953417130.0
ZYRO0F00506g6.11ON55053916530.0
TPHA0M002106.11ON54553716180.0
TBLA0G009806.11ON55853515290.0
Skud_5.316.11ON55754615190.0
NCAS0F002006.11ON54953915130.0
Smik_5.296.11ON55554715130.0
YEL058W (PCM1)6.11ON55754915100.0
SAKL0E00902g6.11ON54453415070.0
NDAI0K028906.11ON56154914870.0
KAFR0L003406.11ON54053614790.0
Suva_5.106.11ON55354314790.0
Kwal_56.223556.11ON54153714760.0
CAGL0B03597g6.11ON54053714690.0
KLTH0C11506g6.11ON54453814190.0
KLLA0D00858g6.11ON54153613910.0
Ecym_30146.11ON55154513820.0
ACR015W6.11ON55252813730.0
KNAG0E009406.11ON53853513390.0
Kpol_1068.88.840ON63264950.007
TDEL0B005708.840ON63031940.007
ZYRO0G14190g8.840ON61097940.008
KLLA0D01573g8.840ON60731920.013
TPHA0I002508.840ON62969910.019
YMR278W (PGM3)8.840ON62228900.023
CAGL0M02981g8.840ON61728900.024
Skud_13.4508.840ON62228900.024
Suva_13.4668.840ON62228900.025
Kwal_27.102588.840ON62031900.026
NDAI0K004108.840ON62628890.028
Ecym_46118.840ON63043890.029
KNAG0J002708.840ON62528890.031
TBLA0B032508.840ON64375890.034
Smik_13.4918.840ON62228880.037
NCAS0C004108.840ON62545880.041
KAFR0B039208.840ON62427880.043
CAGL0J03762g8.669ON494114870.047
ABL126W8.840ON62427870.052
KLTH0C03872g8.840ON62142870.056
NCAS0B015908.669ON491133870.058
SAKL0D01474g8.840ON62427860.074
ZYRO0F07216g8.669ON488126850.095
Kwal_26.87598.669ON492183830.16
TPHA0G016208.669ON492133810.24
SAKL0H06732g8.669ON49558790.53
KAFR0A038208.669ON493130770.73
Smik_15.4258.669ON527133770.79
KLTH0D11066g8.669ON493121761.0
NDAI0E012008.669ON490133761.1
KLLA0F11297g8.669ON493119761.1
Ecym_24048.669ON48946751.3
Kpol_1072.188.669ON491108742.1
Skud_15.4088.669ON494128732.3
YOR241W (MET7)8.669ON548114732.6
Suva_8.2918.669ON535114706.1
SAKL0G15400g5.103ON54426706.4
KNAG0A029408.669ON491108697.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G04600
         (528 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...  1100   0.0  
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...   664   0.0  
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...   641   0.0  
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...   627   0.0  
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...   593   0.0  
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)   589   0.0  
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...   587   0.0  
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)   587   0.0  
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...   586   0.0  
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...   585   0.0  
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....   577   0.0  
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...   574   0.0  
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)   574   0.0  
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...   573   0.0  
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...   570   0.0  
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...   551   0.0  
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...   540   0.0  
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...   536   0.0  
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...   533   0.0  
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...   520   0.0  
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...    41   0.007
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...    41   0.007
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...    41   0.008
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...    40   0.013
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...    40   0.019
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...    39   0.023
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...    39   0.024
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...    39   0.024
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...    39   0.025
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...    39   0.026
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...    39   0.028
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...    39   0.029
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...    39   0.031
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...    39   0.034
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...    39   0.037
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...    39   0.041
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...    39   0.043
CAGL0J03762g Chr10 complement(359858..361342) [1485 bp, 494 aa] ...    38   0.047
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...    38   0.052
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...    38   0.056
NCAS0B01590 Chr2 (259518..260993) [1476 bp, 491 aa] {ON} Anc_8.669     38   0.058
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...    38   0.074
ZYRO0F07216g Chr6 (584726..586192) [1467 bp, 488 aa] {ON} simila...    37   0.095
Kwal_26.8759 s26 (932797..934275) [1479 bp, 492 aa] {ON} YOR241W...    37   0.16 
TPHA0G01620 Chr7 complement(334221..335699) [1479 bp, 492 aa] {O...    36   0.24 
SAKL0H06732g Chr8 complement(592276..593763) [1488 bp, 495 aa] {...    35   0.53 
KAFR0A03820 Chr1 (777572..779053) [1482 bp, 493 aa] {ON} Anc_8.6...    34   0.73 
Smik_15.425 Chr15 (736732..736764,736774..736821,736858..738360)...    34   0.79 
KLTH0D11066g Chr4 (904878..906359) [1482 bp, 493 aa] {ON} simila...    34   1.0  
NDAI0E01200 Chr5 complement(238271..239743) [1473 bp, 490 aa] {O...    34   1.1  
KLLA0F11297g Chr6 complement(1040048..1041529) [1482 bp, 493 aa]...    34   1.1  
Ecym_2404 Chr2 complement(786523..787992) [1470 bp, 489 aa] {ON}...    33   1.3  
Kpol_1072.18 s1072 complement(42308..43783) [1476 bp, 491 aa] {O...    33   2.1  
Skud_15.408 Chr15 (726149..727633) [1485 bp, 494 aa] {ON} YOR241...    33   2.3  
YOR241W Chr15 (786995..788641) [1647 bp, 548 aa] {ON}  MET7Folyl...    33   2.6  
Suva_8.291 Chr8 (526024..526038,526042..526149,526172..527656) [...    32   6.1  
SAKL0G15400g Chr7 (1325560..1327194) [1635 bp, 544 aa] {ON} simi...    32   6.4  
KNAG0A02940 Chr1 complement(358015..359490) [1476 bp, 491 aa] {O...    31   7.8  

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score = 1100 bits (2845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/528 (100%), Positives = 528/528 (100%)

Query: 1   MREPLESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVM 60
           MREPLESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVM
Sbjct: 1   MREPLESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVM 60

Query: 61  ITASHNPSGDNGVKVVEPDGSMLIQSWESTATELANLLANRPLEDIKAKVGQLTSGESSV 120
           ITASHNPSGDNGVKVVEPDGSMLIQSWESTATELANLLANRPLEDIKAKVGQLTSGESSV
Sbjct: 61  ITASHNPSGDNGVKVVEPDGSMLIQSWESTATELANLLANRPLEDIKAKVGQLTSGESSV 120

Query: 121 RPQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLTNETMITGAHVDE 180
           RPQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLTNETMITGAHVDE
Sbjct: 121 RPQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLTNETMITGAHVDE 180

Query: 181 QAYFAHFLGAWDQIAALQPVKLPNVVVDCANGIGGPKMSALLTQWGFAKQCSVINDKCDE 240
           QAYFAHFLGAWDQIAALQPVKLPNVVVDCANGIGGPKMSALLTQWGFAKQCSVINDKCDE
Sbjct: 181 QAYFAHFLGAWDQIAALQPVKLPNVVVDCANGIGGPKMSALLTQWGFAKQCSVINDKCDE 240

Query: 241 PELLNHGCGADFVKTSQRLPNGVKPNANDLYCSFDGDADRVVFYYLDQNLGFHLLDGDKI 300
           PELLNHGCGADFVKTSQRLPNGVKPNANDLYCSFDGDADRVVFYYLDQNLGFHLLDGDKI
Sbjct: 241 PELLNHGCGADFVKTSQRLPNGVKPNANDLYCSFDGDADRVVFYYLDQNLGFHLLDGDKI 300

Query: 301 STLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDNLQVPVSCTKTGVKHLHHE 360
           STLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDNLQVPVSCTKTGVKHLHHE
Sbjct: 301 STLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDNLQVPVSCTKTGVKHLHHE 360

Query: 361 AVNNYDIGIYFEANGHGTVMFSNKFHETVTNHADQTPELKILKYLAKLINQTVGDAISDM 420
           AVNNYDIGIYFEANGHGTVMFSNKFHETVTNHADQTPELKILKYLAKLINQTVGDAISDM
Sbjct: 361 AVNNYDIGIYFEANGHGTVMFSNKFHETVTNHADQTPELKILKYLAKLINQTVGDAISDM 420

Query: 421 MAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSAFTTTDQERRLVSPAGLQDKIDE 480
           MAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSAFTTTDQERRLVSPAGLQDKIDE
Sbjct: 421 MAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSAFTTTDQERRLVSPAGLQDKIDE 480

Query: 481 AVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSSIVGDLVREYC 528
           AVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSSIVGDLVREYC
Sbjct: 481 AVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSSIVGDLVREYC 528

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score =  664 bits (1713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/534 (60%), Positives = 410/534 (76%), Gaps = 16/534 (2%)

Query: 8   LIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMITASHNP 67
           L E+YCTT+ ++YVYGTAGFRD++  L+TVMF TGIVACLRS  L GK VGVMITASHNP
Sbjct: 5   LFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASHNP 64

Query: 68  SGDNGVKVVEPDGSMLIQSWESTATELANLLANRPLEDIKA----KVGQLT--SGESSVR 121
             DNGVK+VEP+G+ML QSWE  ATELAN+ AN   +D+KA    KV + +  SG S V+
Sbjct: 65  PEDNGVKIVEPNGAMLDQSWEPMATELANIAANSTFDDLKAYVEEKVKKFSPESG-SKVQ 123

Query: 122 PQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLTNETMITGAH-VDE 180
           P ++VGRDSR SG +LL CL+ASA +  +AKI +YGLLTTPQLHFLTNE  +  ++ V E
Sbjct: 124 PVVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEINVKKSYAVQE 183

Query: 181 QAYFAHFLGAWDQIAALQPVK---LPNVVVDCANGIGGPKMSALLTQWGFAKQCSVINDK 237
            +Y+ +F+ +W++I AL  +      ++ +D ANGIGGPK+  LL  W FA + +++N++
Sbjct: 184 SSYYNYFIESWNKITALHNITDLYCSSLTIDTANGIGGPKIQELLKSWPFASKVTLVNNE 243

Query: 238 CDEPELLNHGCGADFVKTSQRLPNGVKPNA--NDLYCSFDGDADRVVFYYLDQNLGFHLL 295
            ++P+LLN  CGADFVKT+Q+LPNGV  N+  NDLYCS+DGDADR+VFY+ DQ+  FHLL
Sbjct: 244 WEKPDLLNKNCGADFVKTNQKLPNGVSGNSTENDLYCSYDGDADRIVFYFQDQDKQFHLL 303

Query: 296 DGDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDNLQVPVSCTKTGVK 355
           DGDKISTLFA  +AKLL    L+S +S+GVVQTAYANGSST YLQ  L VPVSC KTGVK
Sbjct: 304 DGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLNVPVSCAKTGVK 363

Query: 356 HLHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVTNHADQTPE---LKILKYLAKLINQT 412
           HLHHEAV NYDIG+YFEANGHGT++FS+ F++          E   +  L  L+ LINQT
Sbjct: 364 HLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKELKANSESIAVNTLVALSHLINQT 423

Query: 413 VGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSAFTTTDQERRLVSPA 472
           VGDAISDM+ VL+VLSI++ S  +WD E+TDLPN LTKV+V DRS F TTDQER+L+SP 
Sbjct: 424 VGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFITTDQERKLLSPE 483

Query: 473 GLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSSIVGDLVRE 526
           GLQ KID+A++   +GRSFVRASGTEDAVRVYAEA++Q E  +L+++V  LV+E
Sbjct: 484 GLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALVTKLVKE 537

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/539 (60%), Positives = 390/539 (72%), Gaps = 20/539 (3%)

Query: 5   LESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMITAS 64
           L  LI+QYC+     YVYGTAGFR  +  LDTV+FATGI+ACLRS  L G  +GVM+TAS
Sbjct: 7   LTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIGVMVTAS 66

Query: 65  HNPSGDNGVKVVEPDGSMLIQSWESTATELANLLANRPLEDIKAKV----------GQLT 114
           HNP  DNGVKVVEPDGSM+ +SWE  ATELAN LA +     +A+           GQL 
Sbjct: 67  HNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRELKGQLQ 126

Query: 115 SGESS----VRPQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLTNE 170
           S  +S    + P L+VGRDSR SGP LLSCLVASA  LF AKI D GLLTTPQLHFLT+E
Sbjct: 127 SANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQLHFLTSE 186

Query: 171 TMITGAHVDEQAYFAHFLGAWDQIAALQPV--KLPNV---VVDCANGIGGPKMSALLTQW 225
           T    A+V E  Y+ HFL AWD +A L  +   LP +    +D ANGIG PK+  LL+QW
Sbjct: 187 TAKGVANVTESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAPKVQELLSQW 246

Query: 226 GFAKQCSVINDKCDEPELLNHGCGADFVKTSQRLPNGVKPNANDLYCSFDGDADRVVFYY 285
               Q   INDK   PELLNH CGADFVK++QR P G   ++  L CS+DGDADRVVFYY
Sbjct: 247 ACRGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGFN-DSTGLGCSYDGDADRVVFYY 305

Query: 286 LDQNLGFHLLDGDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDNLQV 345
           +++   F LLDGD+IS LFA+F A +LKQ  L S LS+GVVQTAYANG+ST+YLQ  LQV
Sbjct: 306 INEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYANGNSTEYLQKTLQV 365

Query: 346 PVSCTKTGVKHLHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVTNHADQTPELKILKYL 405
           PVSC KTGVKHLHHEAV  YDIGIYFEANGHGT++FS KF++ +    +++  ++ L+  
Sbjct: 366 PVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVIKEQKERSVAVETLEAF 425

Query: 406 AKLINQTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSAFTTTDQE 465
           ++LINQTVGDAISDM+ VLA LSI +W+P  W +EFTDLPN+L KVVV DRS F TTDQE
Sbjct: 426 SRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNRLAKVVVPDRSVFITTDQE 485

Query: 466 RRLVSPAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSSIVGDLV 524
           RRL  P GLQ KIDEAV   + GRSFVRASGTEDAVRVYAEAA+  + ++LS+ V +LV
Sbjct: 486 RRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEAASLEDVEKLSNTVKELV 544

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/537 (60%), Positives = 388/537 (72%), Gaps = 18/537 (3%)

Query: 5   LESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMITAS 64
           LES+ E  CTTR +RYVYGTAGFRDD+  LDTVM  TG++ACLRS  L+GK VGVMITAS
Sbjct: 6   LESVFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGVMITAS 65

Query: 65  HNPSGDNGVKVVEPDGSMLIQSWESTATELANLLA-NRPLEDIK----AKVGQLTSGESS 119
           HN   DNGVK+VEPDGSML QSWE  ATELAN  +     ++ K     K  Q    +S 
Sbjct: 66  HNQPCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYKV-DSG 124

Query: 120 VRPQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLTN--ETMITGAH 177
           + P L+VGRDSR SGP LL CL + A  L   KI DYGLLTTPQLHFLTN   T  + A 
Sbjct: 125 ITPVLVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTTKSRAP 184

Query: 178 VDEQAYFAHFLGAWDQIAALQPVKL---PNVVVDCANGIGGPKMSALLTQWGFAKQCSVI 234
           V E  Y++ F+ AW  I AL  +K+   P + +D ANGIGGPK+S L   W  A Q +++
Sbjct: 185 VTEDDYYSFFMDAWVSITALHGIKVLQSPRLYIDAANGIGGPKVSKLFEVWPQAGQFTLV 244

Query: 235 NDKCDEPELLNHGCGADFVKTSQRLPNGVKPNAND----LYCSFDGDADRVVFYYLDQNL 290
           N+    P LLN+ CGAD+VKT+QRLP  + P A+     LYCSFDGDADR+VFYY D   
Sbjct: 245 NNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFDGDADRIVFYYQDAQN 304

Query: 291 GFHLLDGDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDNLQVPVSCT 350
            FHLLDGDKISTLFA F++K LK+  L   +SMGVVQTAYANG+ST YL++ L +PVSC 
Sbjct: 305 SFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNSTNYLENVLNIPVSCA 364

Query: 351 KTGVKHLHHEAVNNYDIGIYFEANGHGTVMFSNKFHET---VTNHADQTPELKILKYLAK 407
           KTGVKHLHHEA+ NYD+GIYFEANGHGT+MFSNKF ET   +    +++ E+K L   A 
Sbjct: 365 KTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCESLLKENNESLEVKTLLSFAH 424

Query: 408 LINQTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSAFTTTDQERR 467
           LINQTVGDAISDM+ VLAVLSI++ +PS WD+E+TDLPN LTKVVV DRS FTTTDQER+
Sbjct: 425 LINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVVPDRSLFTTTDQERK 484

Query: 468 LVSPAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSSIVGDLV 524
           L++P G Q KID  VA+ K+GRSFVRASGTEDAVRVYAEA+T  +   L+  V   V
Sbjct: 485 LLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDAAALNEEVSKAV 541

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/535 (56%), Positives = 377/535 (70%), Gaps = 32/535 (5%)

Query: 8   LIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMITASHNP 67
           L  + C T+ + Y YGTAGFRD +  LDTVMF TG VACLRS   +GK VGVM+TASHNP
Sbjct: 13  LFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAVGVMVTASHNP 72

Query: 68  SGDNGVKVVEPDGSMLIQSWESTATELANLLANRPLED----IKAKVGQLTSGESSVRPQ 123
             DNGVK+VEP+GSML Q WE  AT+LANL +   +++    + AK+ +L S +    P 
Sbjct: 73  PVDNGVKIVEPNGSMLSQDWEPIATDLANLASQGKIDELVQFVNAKLIELNSNKV---PT 129

Query: 124 LIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLTNETMITGAHVDEQAY 183
           LIVGRDSR S   LL CL   +  LFDAKI DY LLTTPQLHFLTN   +      E  Y
Sbjct: 130 LIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNAYNLEKDLPKETDY 189

Query: 184 FAHFLGAWDQIAALQ-------PVKLPNVVVDCANGIGGPKMSALLTQWGFAKQCSVIND 236
           + HF  AWDQ+ ++          K+ ++++D ANGIGGPKM  LL  W    +  +IN+
Sbjct: 190 YHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKMENLLKYWKTNYKVRLINN 249

Query: 237 KCDEPELLNHGCGADFVKTSQRLPNGV------KPNANDLYCSFDGDADRVVFYYLD-QN 289
               PE LN+ CGAD+VKT+Q+LPNG+      + + N ++CSFDGDADRVVFYY D Q+
Sbjct: 250 NWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNVIHCSFDGDADRVVFYYQDPQS 309

Query: 290 LGFHLLDGDKISTLFAYFVAKLLKQCKLD--SILSMGVVQTAYANGSSTKYLQDNLQVPV 347
             F+LLDGDKISTLFA F++  LK   +D  + + +GVVQTAYANGSST YLQ NL++PV
Sbjct: 310 NTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQTAYANGSSTNYLQQNLKIPV 369

Query: 348 SCTKTGVKHLHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVT------NHADQTPEL-- 399
           +C KTGVKHLHHEA   YDIG+YFEANGHGT++FS  F++ +       +  + TP+L  
Sbjct: 370 ACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYKIINQKINAESQIENTPKLRA 429

Query: 400 -KILKYLAKLINQTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSA 458
            K LK L+ LINQTVGDAISDMM V+AVL+IL W+P  W++E+TDLPNKL K+VV DRS 
Sbjct: 430 LKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWNKEYTDLPNKLAKLVVPDRSV 489

Query: 459 FTTTDQERRLVSPAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEK 513
           F TTDQER+L SPAGLQ KI++ VA+ ++GRSFVRASGTEDAVRVYAEA+    K
Sbjct: 490 FETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDAVRVYAEASDDVNK 544

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/546 (55%), Positives = 381/546 (69%), Gaps = 27/546 (4%)

Query: 3   EPLESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMIT 62
           E L  L ++ C T+  +Y YGTAGFR  ++ LDTVMF TGI+A LRS  L G+ VGVMIT
Sbjct: 6   EQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMIT 65

Query: 63  ASHNPSGDNGVKVVEPDGSMLIQSWESTATELANLLA-NRPLEDIKAKVGQLTS------ 115
           ASHNP  DNGVK+VEPDGSML+ SWE  A +LAN  +     E+  A++ +L        
Sbjct: 66  ASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIELEKIDL 125

Query: 116 GESSVRPQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLTN------ 169
           G S+V P ++VGRDSR S P+LL CL ++  S+F A++ D G +TTPQLH++T+      
Sbjct: 126 GASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYITDLSNRRE 185

Query: 170 -ETMITGAHVDEQAYFAHFLGAWDQIAAL----QPVKLPNVVVDCANGIGGPKMSALLTQ 224
            E     A   EQ Y++ F+GA++++       + + +P + +D ANGIGGP++  LL  
Sbjct: 186 REGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVPKLFIDTANGIGGPQLKKLLAS 245

Query: 225 WGF---AKQCSVINDKCDEPELLNHGCGADFVKTSQRLPNGVKPNA-NDLYCSFDGDADR 280
             +   + Q  +INDK D P+LLN  CGAD+VKT+QRLP G+ P++   LYCSFDGDADR
Sbjct: 246 KDWVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSSFESLYCSFDGDADR 305

Query: 281 VVFYYLDQNLGFHLLDGDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQ 340
           VVFYY+D  L FHLLDGDKISTLFA F++K L+   L+  L +GVVQTAYANGSST Y++
Sbjct: 306 VVFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYANGSSTAYIK 365

Query: 341 DNLQVPVSCTKTGVKHLHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVTNHADQ----T 396
           D L  PVSCTKTGVKHLHHEA   YDIGIYFEANGHGT++FS KFH+T+ +   +    T
Sbjct: 366 DTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESELSKPNGHT 425

Query: 397 PELKILKYLAKLINQTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDR 456
             LK L   AKLINQTVGDA+SDM+AVLA L+IL+ +P  WD E+ DLPNKL K +V DR
Sbjct: 426 LALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNKLVKCIVPDR 485

Query: 457 SAFTTTDQERRLVSPAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQL 516
           S F TTDQER+L +P GLQ KID  +A+   GRSFVRASGTEDAVRVYAE    S+ DQ 
Sbjct: 486 SIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAECQDMSKLDQF 545

Query: 517 -SSIVG 521
            + IVG
Sbjct: 546 CNEIVG 551

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/539 (54%), Positives = 379/539 (70%), Gaps = 22/539 (4%)

Query: 5   LESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMITAS 64
           L+ +    CTTR Y+Y YGTAGFRD + KLDTVMFATGI+AC RS VL G PVGVM+TAS
Sbjct: 8   LQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPVGVMVTAS 67

Query: 65  HNPSGDNGVKVVEPDGSMLIQSWESTATELANLLANRPLEDIKAKVGQLTSGES----SV 120
           HNP  DNGVKVVEP G+MLIQ WE   T+LAN+ AN   E +   + +++          
Sbjct: 68  HNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANESFEKVYDFILEVSKDPKFPFQEN 127

Query: 121 RPQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLT-------NETMI 173
           +P LI+G DSR S P L   LV +A  +++A I +YGL+TTPQLHF+T       N+   
Sbjct: 128 KPSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSLWNAKYNKNTN 187

Query: 174 TGAHVDEQAYFAHFLGAWDQIAALQPVK----LPNVVVDCANGIGGPKMSALLTQW--GF 227
               VD   Y+ +F  +W +   L          N+++D ANGIGGPK++ L++ W    
Sbjct: 188 DVISVDN--YYNYFNASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVTDLISTWPSTL 245

Query: 228 AKQCSVINDKCDEPELLNHGCGADFVKTSQRLPNGVK-PNANDLYCSFDGDADRVVFYYL 286
               S+IN+  + P LLN+ CGAD+VKT+Q+LP G++ P+  +L+CSFDGDADR+VFYY+
Sbjct: 246 RGNVSIINNSWENPNLLNNDCGADYVKTNQKLPKGIQNPSNLNLHCSFDGDADRIVFYYI 305

Query: 287 DQ-NLGFHLLDGDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDNLQV 345
            + +  FHLLDGDKI+TLFA F++ LLK+  L   L +GVVQTAYANGSST YL + L+V
Sbjct: 306 SEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSSTNYLTNVLKV 365

Query: 346 PVSCTKTGVKHLHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVTNHADQTPELKILKYL 405
           PVSCTKTGVKHLHHEA   YDIGIYFEANGHGTV+FS +F + + N    T    +L + 
Sbjct: 366 PVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVLQNEPKTTATQTLLLF- 424

Query: 406 AKLINQTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSAFTTTDQE 465
            K+INQTVGDA++DM+ V+ VLS+ + +PS+WD+ + DLPNKL KV+V DRS F TT+QE
Sbjct: 425 QKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKVIVPDRSVFITTNQE 484

Query: 466 RRLVSPAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSSIVGDLV 524
           R+L SP GLQ+KID AV+++ +GRSFVRASGTEDAVRVYAEAATQ E ++LS  V   V
Sbjct: 485 RQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQEETEKLSQEVCKFV 543

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/547 (54%), Positives = 388/547 (70%), Gaps = 24/547 (4%)

Query: 3   EPLESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMIT 62
           E L  L ++ C T+  +Y YGTAGFR  ++ LDTVMF TGI+A LRS  L G+ VGVMIT
Sbjct: 6   EQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMIT 65

Query: 63  ASHNPSGDNGVKVVEPDGSMLIQSWESTATELANLLA-NRPLEDIKAKVGQLTSGE---- 117
           ASHNP  DNGVK+VEPDGSML+ +WE  A +LAN  +     E+ +A++ +L   E    
Sbjct: 66  ASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEKIGL 125

Query: 118 -SSVRPQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLT---NETMI 173
            +S+ P ++VGRDSR S P+LL CL ++  S+F A++ D G +TTPQLH++T   N+   
Sbjct: 126 DTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLSNKRER 185

Query: 174 TGAHVD---EQAYFAHFLGAWDQIAALQPVK----LPNVVVDCANGIGGPKMSALLTQWG 226
            G   +   EQ Y++ F+GA++++ +   ++    +P + +D ANGIGGP++  LLT   
Sbjct: 186 EGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKLLTSKD 245

Query: 227 FA---KQCSVINDKCDEPELLNHGCGADFVKTSQRLPNGVKPNAND-LYCSFDGDADRVV 282
           +     Q  VINDK D PELLN  CGAD+VKT+QRLP G+ P+++D LYCSFDGDADRVV
Sbjct: 246 WVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCSFDGDADRVV 305

Query: 283 FYYLDQNLGFHLLDGDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDN 342
           FYY+D    FHLLDGDKISTLFA F++K L+   L++ L +GVVQTAYANGSST Y+++ 
Sbjct: 306 FYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTNYIENT 365

Query: 343 LQVPVSCTKTGVKHLHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVTNHADQTP----E 398
           L+ PVSCTKTGVKHLHHEA   YDIGIYFEANGHGT++FS KFH+ + +   +       
Sbjct: 366 LRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSRARGDMLA 425

Query: 399 LKILKYLAKLINQTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSA 458
           LK L   +KLINQTVGDA+SDM+AVLA L+I++ +P  WD+E+TDLPNKL K +V DRS 
Sbjct: 426 LKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKCIVPDRSI 485

Query: 459 FTTTDQERRLVSPAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSS 518
           F T DQER+L +P GLQ KID  +A+   GRSFVRASGTEDAVR+YAE    S+ DQ  +
Sbjct: 486 FQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQLDQFCN 545

Query: 519 IVGDLVR 525
            + +LV+
Sbjct: 546 EIVELVK 552

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/549 (55%), Positives = 385/549 (70%), Gaps = 26/549 (4%)

Query: 3   EPLESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMIT 62
           E L  L +  C T+  ++ YGTAGFR  ++ LDTVMF+TGI+A LRS  L G+ VGVMIT
Sbjct: 6   EQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGVMIT 65

Query: 63  ASHNPSGDNGVKVVEPDGSMLIQSWESTATELANLLA-NRPLEDIKAKVGQLTSGE---- 117
           ASHNP  DNGVK+VEPDGSML+ +WE  A +LAN  +     E+ + ++ +L   E    
Sbjct: 66  ASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEHEKIDL 125

Query: 118 -SSVRPQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLT---NETMI 173
            ++V P ++VGRDSR S P+LL CL +S  S+F A++ D G +TTPQLH++T   N   +
Sbjct: 126 NTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDLSNRRKL 185

Query: 174 TGAHV---DEQAYFAHFLGAWDQIAAL----QPVKLPNVVVDCANGIGGPKMSALLTQ-- 224
            G       EQ Y++ F+GA++++ A     + + +P + +D ANGIGGP++  LL    
Sbjct: 186 EGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLSVPKLFIDTANGIGGPQLKKLLASED 245

Query: 225 WGF-AKQCSVINDKCDEPELLNHGCGADFVKTSQRLPNGVKPNAND-LYCSFDGDADRVV 282
           W   A+Q  VIND+ D PELLN  CGAD+VKT+QRLP G+ P++ D LYCSFDGDADRVV
Sbjct: 246 WDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSFDSLYCSFDGDADRVV 305

Query: 283 FYYLDQNLGFHLLDGDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDN 342
           FYY+D    FHLLDGDKISTLFA F++K L+   L+  L +GVVQTAYANGSST Y+++ 
Sbjct: 306 FYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSSTAYIKNT 365

Query: 343 LQVPVSCTKTGVKHLHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVTNHADQ------T 396
           L  PVSCTKTGVKHLHHEA   YDIGIYFEANGHGT++FS KFH T+ +   +      T
Sbjct: 366 LHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSKSKLNGDT 425

Query: 397 PELKILKYLAKLINQTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDR 456
             L+ LK  ++LINQTVGDAISDM+AVLA L+IL+ SP  WD E+TDLPNKL K +V DR
Sbjct: 426 LALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLVKCIVPDR 485

Query: 457 SAFTTTDQERRLVSPAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQL 516
           S F TTDQER+L++P GLQDKID  VA+   GRSFVRASGTEDAVRVYAE    S+  Q 
Sbjct: 486 SIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAECKDSSKLGQF 545

Query: 517 SSIVGDLVR 525
              V + V+
Sbjct: 546 CDEVVEHVK 554

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score =  585 bits (1507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/534 (56%), Positives = 379/534 (70%), Gaps = 15/534 (2%)

Query: 5   LESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMITAS 64
           LE L +++C T G+ Y YGTAGFR  ++ LDTVMF TGI+A +RS  L G+ VGVMITAS
Sbjct: 7   LEELYDKHCKT-GFTYTYGTAGFRYKADVLDTVMFTTGILAAIRSIYLKGQYVGVMITAS 65

Query: 65  HNPSGDNGVKVVEPDGSMLIQSWESTATELANLLANRPLEDIKA--KVGQLTSGESSVRP 122
           HNP  DNGVK+V+P G ML Q+WE  ATELAN  +    E IKA  K+      + +   
Sbjct: 66  HNPPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGKQELIKALDKLITKLGIDDTESA 125

Query: 123 QLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLTNE-TMITGAHVDEQ 181
           ++ + RDSR SGP LL  ++     L + ++ D+ LLTTPQLHFLT +    + + V+E 
Sbjct: 126 KITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLTYQYNQGSSSKVEES 185

Query: 182 AYFAHFLGAWDQIAALQPVK-LP-NVVVDCANGIGGPKMSA-LLTQWGFAKQCSVINDKC 238
            Y++ F  AW +I  L  +  LP  V++D ANGIGGPK+S  LL    F+   SVIN++ 
Sbjct: 186 TYYSAFSSAWTKICGLHDINSLPYRVIIDAANGIGGPKVSEMLLKNKFFSSTVSVINNQW 245

Query: 239 DEPELLNHGCGADFVKTSQRLPNGVKPNAND--LYCSFDGDADRVVFYYLDQNLGFHLLD 296
             PELLN  CGAD+VKT+Q  P GV  N+ +  +YCSFDGDADR+VFYY D+   F+LLD
Sbjct: 246 QSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFDGDADRIVFYYHDEKSKFNLLD 305

Query: 297 GDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDNLQVPVSCTKTGVKH 356
           GDKISTLFA F  +LL     ++ L +GVVQTAYANGSST+YL   L+VPVSCT TGVKH
Sbjct: 306 GDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSSTEYLSSILEVPVSCTATGVKH 365

Query: 357 LHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVTNHADQTPE------LKILKYLAKLIN 410
           LHHEA++NYDIGIYFEANGHGTV+FS++FH+T+     +  +      LK L     LIN
Sbjct: 366 LHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKEPQDEKTAKALKTLYLFTNLIN 425

Query: 411 QTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSAFTTTDQERRLVS 470
           QTVGDAISDM+AVLAVL IL+WSP +WD+E+TDLPNKL KV+V DRS F T++ ER+LVS
Sbjct: 426 QTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKVIVPDRSVFKTSNAERQLVS 485

Query: 471 PAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSSIVGDLV 524
           P GLQ+KID  V   + GRSFVRASGTEDAVRVYAEAAT+ + D+L++ V DLV
Sbjct: 486 PKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKEKADRLAASVSDLV 539

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/549 (54%), Positives = 384/549 (69%), Gaps = 25/549 (4%)

Query: 2   REPLESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGK----PV 57
           ++ L+S   + C T+ Y Y YGTAGFRD++++LDTVMF TGIVACLRS  L        +
Sbjct: 9   KDQLKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNKHSAI 68

Query: 58  GVMITASHNPSGDNGVKVVEPDGSMLIQSWESTATELANLLANRPLEDI-KAKVGQLTSG 116
           GVM+TASHNP  DNGVK++EP+GSML+Q WE  AT+ AN+ AN   ++  +  +  + + 
Sbjct: 69  GVMVTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAANESFDEFYQLLIDSIVTL 128

Query: 117 ESSVR----PQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLTNETM 172
           E+ +     P LI+G DSR S P L++ ++ SAT +F+AKI +Y  +TTPQLHFLT    
Sbjct: 129 ENDLNIKQPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQLHFLT-NLT 187

Query: 173 ITGAHVDEQAYFAHFLGAWDQIAAL-QPVKLP--NVVVDCANGIGGPKMSALL-TQWGFA 228
            T    +E  Y+ HF     Q+ +L  P  LP  N+++D ANGIG P++  LL T+  F 
Sbjct: 188 NTTGTAEEINYYDHFNKYLSQLQSLYPPFNLPFDNLIIDAANGIGAPQVEKLLFTKNKFP 247

Query: 229 -----KQCSVINDKCDEPELLNHGCGADFVKTSQRLPNGVKPN--AND-LYCSFDGDADR 280
                    +IN+    P LLN  CGAD+VKT+Q+LP G+  +  AN  L+CS+DGDADR
Sbjct: 248 PLNIKNPIKIINNDSKNPNLLNMNCGADYVKTNQKLPQGIPKDIDANSTLFCSYDGDADR 307

Query: 281 VVFYYLD-QNLGFHLLDGDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYL 339
           +VFYY+D     F+LLDGDKI+TLFA F + LL   KL+ IL +GVVQTAYANGSST Y+
Sbjct: 308 IVFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQTAYANGSSTNYI 367

Query: 340 QDNLQVPVSCTKTGVKHLHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVTN--HADQTP 397
              L+VPVSCTKTGVKHLHHEA+  YDIGIYFEANGHGTV+FS+KFH  +T    +  + 
Sbjct: 368 SSKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFHSELTKLKESGSSR 427

Query: 398 ELKILKYLAKLINQTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRS 457
           E+K L   ++LINQTVGDA+SDM+AV+AVLSILQ SP+ WD+E+ DLPNKL KV+V DRS
Sbjct: 428 EIKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEYKDLPNKLAKVIVPDRS 487

Query: 458 AFTTTDQERRLVSPAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLS 517
            F TTDQER+LV P GLQ  ++EAVA +  GRSFVRASGTEDAVRVYAEA TQ E + LS
Sbjct: 488 KFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAVRVYAEAKTQEETEWLS 547

Query: 518 SIVGDLVRE 526
             V  LV E
Sbjct: 548 KKVCQLVIE 556

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/536 (54%), Positives = 379/536 (70%), Gaps = 19/536 (3%)

Query: 5   LESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMITAS 64
           LE    +YCTTR + Y YGTAGFR ++  LDTVMF TGIVA LRS VL GK +GVMITAS
Sbjct: 7   LEPAFIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIGVMITAS 66

Query: 65  HNPSGDNGVKVVEPDGSMLIQSWESTATELANLLANRPLEDIKAKVGQLTSG---ESSVR 121
           HNP  DNGVK+VEP G+MLI+SWE  AT+LAN+ ++         + Q+ +    + +  
Sbjct: 67  HNPPQDNGVKIVEPSGAMLIESWEQIATDLANIASHGNFTAFVMHLSQVIAKLNIDETTT 126

Query: 122 PQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLTNETMITGAHVDEQ 181
           P+LIVG DSR S P+L+ CL A+A  +FD  + ++ L+TTPQLH+LT   M+    V E 
Sbjct: 127 PRLIVGHDSRESSPYLMECLQAAA-PVFDTIVINHTLITTPQLHYLT---MLQNDVVTEV 182

Query: 182 AYFAHFLGAWDQIAALQP---VKLPNVVVDCANGIGGPKMSALLTQW-GFAKQCSVINDK 237
            Y+  F  +W+ + +L P   +   N++VD ANG+G  + S  L      A   ++INDK
Sbjct: 183 DYYKFFSTSWNNLFSLYPDLNLTFNNLIVDGANGVGSVQFSKFLPYLPQLATLTTIINDK 242

Query: 238 CDEPELLNHGCGADFVKTSQRLPNG-VKPNANDLYCSFDGDADRVVFYYLDQNLGFHLLD 296
            + P++LN  CGADFVKT+Q+LPNG V PN +DLY SFDGDADR+VFYY+D N  FHLLD
Sbjct: 243 HNVPQMLNVDCGADFVKTNQKLPNGIVNPNPSDLYASFDGDADRIVFYYVDNNKKFHLLD 302

Query: 297 GDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDNLQVPVSCTKTGVKH 356
           GDKIST+    +  +L++ +L + +++GVVQTAYANGSSTKY+  +L+VPV CTKTGVKH
Sbjct: 303 GDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKYITKSLKVPVECTKTGVKH 362

Query: 357 LHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVTNHADQ-TPELKILK------YLAKLI 409
           LHH A + +DIGIYFEANGHGTV+FSNKF+E +    D  +   KI K      Y +KLI
Sbjct: 363 LHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSSSEKIHKARLSLFYFSKLI 422

Query: 410 NQTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSAFTTTDQERRLV 469
           NQTVGD+++D++AV+A LSILQ SPS WD E+ DLPN LTK  V +R  F TTD ER+L 
Sbjct: 423 NQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKCTVLNRFVFKTTDMERKLT 482

Query: 470 SPAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSSIVGDLVR 525
           SP+GLQ+KID AV++  SGRSFVRASGTEDAVR+YAEA T++E + LS  V  LV 
Sbjct: 483 SPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEVEALSKEVTQLVE 538

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/543 (54%), Positives = 374/543 (68%), Gaps = 22/543 (4%)

Query: 5   LESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMITAS 64
           L  L E+ C T+  +Y YGTAGFR  ++ LDTVMF TGI+A LRS  L G+ VGVMITAS
Sbjct: 8   LRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMITAS 67

Query: 65  HNPSGDNGVKVVEPDGSMLIQSWESTATELANLLA-NRPLEDIKAKVGQLTSGES---SV 120
           HNP  DNGVK+VEPDGSML+ +WE  A +LAN  +     ++  A++ +L   E      
Sbjct: 68  HNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEHEKIDLDA 127

Query: 121 RPQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLTNETMI------T 174
            P ++VGRDSR S P LL CL ++  S+F A + D G +TTPQLH++TN +        +
Sbjct: 128 APHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVTNLSNKRQREGGS 187

Query: 175 GAHVDEQAYFAHFLGAWDQIAAL----QPVKLPNVVVDCANGIGGPKMSALLTQ--WGF- 227
                EQ Y++ F+ A++++       + + +P + VD ANGIGGP++  LL    W   
Sbjct: 188 AQVATEQDYYSFFINAFNELFTTCQIEKRLSVPKLFVDTANGIGGPQLKKLLASKDWAVP 247

Query: 228 AKQCSVINDKCDEPELLNHGCGADFVKTSQRLPNGVKPNAND-LYCSFDGDADRVVFYYL 286
           + +  ++NDK D P+LLN  CGAD+VKT+QRLP G+ P++ D LYCSFDGDADRVVFYY+
Sbjct: 248 SDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSPDSLYCSFDGDADRVVFYYV 307

Query: 287 DQNLGFHLLDGDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDNLQVP 346
           D    FHLLDGDKISTLFA F++K L+   L   L +GVVQTAYANGSST Y++D L  P
Sbjct: 308 DPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSSTSYIKDTLHCP 367

Query: 347 VSCTKTGVKHLHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVTNHADQTP----ELKIL 402
           VSCTKTGVKHLHHEA   YDIGIYFEANGHGT++FS KFH+T+ +   +       L  L
Sbjct: 368 VSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELSRAQGSLLALNTL 427

Query: 403 KYLAKLINQTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSAFTTT 462
           +  A LINQTVGDAISDM+AVLA LSIL  +P+ WD+E+TDLPNKL K +V DRS F TT
Sbjct: 428 RCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKCIVPDRSIFQTT 487

Query: 463 DQERRLVSPAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSSIVGD 522
           DQER+L +PAGLQ KID  + +   GRSFVRASGTEDAVRVYAE    ++ DQ  + V +
Sbjct: 488 DQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPTKLDQFCNEVVE 547

Query: 523 LVR 525
            V+
Sbjct: 548 YVK 550

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/537 (56%), Positives = 381/537 (70%), Gaps = 20/537 (3%)

Query: 5   LESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMITAS 64
           L+SL E +C+T G+ Y YGTAGFR  ++ LDTVMF TG+VA LRS  L GK VGVMITAS
Sbjct: 7   LKSLYEAHCST-GFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGVMITAS 65

Query: 65  HNPSGDNGVKVVEPDGSMLIQSWESTATELANLLANRPLEDIKAKVGQLTSG---ESSVR 121
           HNP  DNGVK+V+P G ML QSWE  AT+LAN  A++   +  A V +L +     S+  
Sbjct: 66  HNPPEDNGVKIVDPKGEMLEQSWEVYATDLANS-ASQGFSEFVASVERLMTKLEVGSNDH 124

Query: 122 PQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLTNET--MITGAHVD 179
             ++V RDSR SGP LL   ++    L + K+TD+GLLTTPQLHFLT+++  +  G  + 
Sbjct: 125 GSIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSNELPKGTEIG 184

Query: 180 EQAYFAHFLGAWDQIAALQPV-KLP-NVVVDCANGIGGPKMSALLTQWGFAKQC-SVIND 236
           +  Y+ +FL AW +IA L  +  LP  + +D ANGIG P ++ +L+Q  F K   +V+ND
Sbjct: 185 KSLYYDNFLSAWVEIAELCKIDSLPYKLEIDAANGIGAPVVTEMLSQHKFFKGAFAVVND 244

Query: 237 KCDEPELLNHGCGADFVKTSQRLPNGVKPNA--NDLYCSFDGDADRVVFYYLDQNLGFHL 294
           + + P+ LNH CGADFVKT+Q+LP+G+ P    N + CSFDGDADR+VFYY  +N  FHL
Sbjct: 245 EWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCSFDGDADRIVFYYCGKNGDFHL 304

Query: 295 LDGDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDNLQVPVSCTKTGV 354
           LDGDK++TLFA F  +LL+   L   L +GVVQTAYANGSST Y++  L + V+CT TGV
Sbjct: 305 LDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSSTAYIEQVLGISVTCTPTGV 364

Query: 355 KHLHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVTNHADQTPE-------LKILKYLAK 407
           KHLHHEAV  YDIG+YFEANGHGTV+FS+KF + +     +  E       LK+L   AK
Sbjct: 365 KHLHHEAVK-YDIGVYFEANGHGTVVFSSKFLDVIDRKLSEKLESDAAQKSLKVLHLFAK 423

Query: 408 LINQTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSAFTTTDQERR 467
           LINQTVGDAISDM+AVLAVLSIL+WSP +WD E+TDLPNKL KV+V DR+ F T + ER+
Sbjct: 424 LINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLIKVLVPDRTVFKTKNAERQ 483

Query: 468 LVSPAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSSIVGDLV 524
           LVSPAG+Q+KID  VA    GRSFVRASGTEDAVRVYAEAAT  E + LS  V  L+
Sbjct: 484 LVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAATPQETEALSQQVEKLL 540

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/537 (56%), Positives = 368/537 (68%), Gaps = 23/537 (4%)

Query: 8   LIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMITASHNP 67
           L  + C TR   Y YGTAGFR D+  LD+VMF TG++A LRS      PVGVMITASHNP
Sbjct: 5   LYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHNP 64

Query: 68  SGDNGVKVVEPDGSMLIQSWESTATELANLLAN-RPLEDIKAKVGQLTSGESSVRPQLIV 126
             DNGVK+VE DGSML+Q WE  AT LAN +A+    E     + Q  +      PQ++V
Sbjct: 65  PRDNGVKIVESDGSMLLQDWEPLATRLANSVADYHTFESTLNAIMQELNISPGHAPQIVV 124

Query: 127 GRDSRVSGPHLLSCLVASATSLF-DAKITDYGLLTTPQLHFLTNETMITGAHVDEQAYFA 185
           G DSR S P LL+ L+    ++  DA+IT++GLLTTPQLHFLT       AH  E  Y+ 
Sbjct: 125 GHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLTANP----AHF-EDYYYR 179

Query: 186 HFLGAWDQIAALQPVK----LPNVVVDCANGIGGPKMSALLT---------QWGFAKQCS 232
           +FL AW+Q+  L  ++       +V+D ANGIGGP+   +L+         Q     Q  
Sbjct: 180 YFLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQTDLPHLQKIRLHQID 239

Query: 233 VINDKCDEPELLNHGCGADFVKTSQRLPNGVKPNANDLYCSFDGDADRVVFYYLDQNLGF 292
           + N+    P +LN GCGADFVKT+QRLP G+  +  +LYCSFDGDADRVVFYY+D +L F
Sbjct: 240 ITNNSWLNPSMLNSGCGADFVKTNQRLPEGINADPRNLYCSFDGDADRVVFYYVDDSLTF 299

Query: 293 HLLDGDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDNLQVPVSCTKT 352
           HLLDGDKISTL AYF+  LLK+  L   L +GVVQTAYANGSST Y+   LQVPVS  KT
Sbjct: 300 HLLDGDKISTLLAYFINALLKEAGLAEELKLGVVQTAYANGSSTTYVTKKLQVPVSIAKT 359

Query: 353 GVKHLHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVTNHADQTPELK---ILKYLAKLI 409
           GVKHLHHEAV NYDIG+YFEANGHGTV+FS  F+E + +   +    K    L+ L++LI
Sbjct: 360 GVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAKNAHDKSTLTLRLLSRLI 419

Query: 410 NQTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSAFTTTDQERRLV 469
           NQT+GDAISDM+A++ VL IL WSP+ WD E+TDLPNKLTKVVV DRS F TTDQERRLV
Sbjct: 420 NQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVPDRSIFITTDQERRLV 479

Query: 470 SPAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSSIVGDLVRE 526
           SPAGLQDKID  VA    GRSF+RASGTEDAVRVYAEA T    ++LS+ V D + E
Sbjct: 480 SPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATEKLSTEVTDALIE 536

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score =  551 bits (1419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/538 (55%), Positives = 372/538 (69%), Gaps = 22/538 (4%)

Query: 5   LESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMITAS 64
           LE+L E +C + G+ Y YGTAGFR  ++ LDTVMF TG++A LRS  L G+ VGVMITAS
Sbjct: 7   LETLYETHCKS-GFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGVMITAS 65

Query: 65  HNPSGDNGVKVVEPDGSMLIQSWESTATELANLLANRPLEDIKAKVGQLTSG---ESSVR 121
           HNP  DNGVK+V+P G ML QSWES AT+LAN  A +      A +  L S    ++   
Sbjct: 66  HNPPEDNGVKIVDPKGEMLEQSWESYATDLANS-ATQSFTAFLAYLQNLVSELGLDTDAL 124

Query: 122 PQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLTNE--TMITGAHVD 179
             L V RDSR SGP LL  L+  +  L + +ITDYGLLTTPQLHFLT++   +     +D
Sbjct: 125 GSLAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLTSKRNELPNDTAID 184

Query: 180 EQAYFAHFLGAWDQIAALQPVK-LP-NVVVDCANGIGGPKMSALL-TQWGFAKQCSVIND 236
              Y+  FL AWD I AL  ++ LP  + +D ANGIG P++  +L T   F     V+ND
Sbjct: 185 RFFYYKEFLSAWDDITALCGIQSLPYKLEIDAANGIGAPRVKEMLSTHKFFDGVFRVVND 244

Query: 237 KCDEPELLNHGCGADFVKTSQRLPNGVKPNAND---LYCSFDGDADRVVFYYLDQNLGFH 293
             + P  LNH CGAD+VKT+QRLP G++ N ND   + CSFDGDADR+VFY+ D    F 
Sbjct: 245 DWETPASLNHLCGADYVKTNQRLPYGIQAN-NDCQRICCSFDGDADRIVFYFCDSEGQFR 303

Query: 294 LLDGDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDNLQVPVSCTKTG 353
           LLDGDK++TLFA F   +L    L   LS+GVVQTAYANGSST Y++  L +PV+CT TG
Sbjct: 304 LLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTHYIERVLGIPVTCTPTG 363

Query: 354 VKHLHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVT------NHADQTPE-LKILKYLA 406
           VKHLHHEA+N YDIG+YFEANGHGTV+FS KF E V       + +D + + L++L   A
Sbjct: 364 VKHLHHEAIN-YDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKHQSDSSLQSLEVLSKFA 422

Query: 407 KLINQTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSAFTTTDQER 466
            LINQTVGDAISDMM VLAVLSIL+W+P +W++E+TDLPNKL KV+V DR+ F TT+ ER
Sbjct: 423 NLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVKVLVPDRTVFKTTNAER 482

Query: 467 RLVSPAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSSIVGDLV 524
           +L+SP GLQ KI+  VA     RSFVRASGTEDAVRVYAEA+T+ E D L+S V  +V
Sbjct: 483 QLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTREEADSLASRVSQVV 540

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score =  540 bits (1391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/536 (54%), Positives = 364/536 (67%), Gaps = 17/536 (3%)

Query: 8   LIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMITASHNP 67
           L EQYC  +G+ Y YGTAGFR  +  LDTVMF TGIVA LRS  L  K VGVMITASHNP
Sbjct: 6   LYEQYCK-QGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITASHNP 64

Query: 68  SGDNGVKVVEPDGSMLIQSWESTATELANLLANR--PLEDIKAKVGQLTSGESSVRPQLI 125
             DNGVKVVEP G ML+Q+WE  AT+LAN  ++    LE     +    + +++    + 
Sbjct: 65  PEDNGVKVVEPYGEMLVQNWEPIATKLANAASSSFTQLESTLQSIIAELNIDTTQLANIT 124

Query: 126 VGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLTNE--TMITGAHVDEQAY 183
           V RDSR SGP LL+ L A  +     KI D+ LLTTPQLHFL     T    + V +  Y
Sbjct: 125 VARDSRESGPRLLAALKAGISVFPAVKIIDFELLTTPQLHFLVYSLNTSSQPSQVRDSTY 184

Query: 184 FAHFLGAWDQIAALQPV-KLP-NVVVDCANGIGGPKMSALLTQWGFAKQCSV--INDKCD 239
           + HF+  W+Q+  L  V +LP ++ +DCANGIG  K+  L++Q G   + S+  +N +  
Sbjct: 185 YDHFVSIWNQLTQLYEVTELPFHLTIDCANGIGADKVKQLISQAGHMLENSLTAVNGETK 244

Query: 240 EPELLNHGCGADFVKTSQRLPNGVKPNANDLYCSFDGDADRVVFYYLD-QNLGFHLLDGD 298
             +LLN  CGADFVKT+Q  P    P  + LYCSFDGDADRVVFYY+D +   FHLLDGD
Sbjct: 245 TFQLLNESCGADFVKTNQTFPANCNPKPSQLYCSFDGDADRVVFYYVDGKENKFHLLDGD 304

Query: 299 KISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDNLQVPVSCTKTGVKHLH 358
           KI+TL A  +A LL+ C L   L +GVVQTAYANGSSTKY+ D L++PVSCTKTGVKHLH
Sbjct: 305 KIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYITDKLKIPVSCTKTGVKHLH 364

Query: 359 HEAVNNYDIGIYFEANGHGTVMFSNKFHETVTNHADQTP-------ELKILKYLAKLINQ 411
           HEAV+ YDIGIYFEANGHGTV+FS +F ETV +   +T         L  LK L++LINQ
Sbjct: 365 HEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGNEQQYKSLLSLKLLSQLINQ 424

Query: 412 TVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSAFTTTDQERRLVSP 471
           TVGDAISDM+AV+A LSI    P  WD  + DLPN+LTKV+V DRS F +T+ ER+L+SP
Sbjct: 425 TVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIVPDRSVFVSTNAERQLLSP 484

Query: 472 AGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSSIVGDLVREY 527
            GLQ KID  V +  + RSFVRASGTEDAVRVYAEA T     +L++ VG+LV+ +
Sbjct: 485 EGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTESAIELATKVGELVKLF 540

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/545 (52%), Positives = 367/545 (67%), Gaps = 28/545 (5%)

Query: 3   EPLESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMIT 62
           E +  L +++C +R ++Y+YGTAGFR  +E LDTV+F TG++ACLRS  L G+ VG MIT
Sbjct: 5   EEVSKLYDKHCCSR-FKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGAMIT 63

Query: 63  ASHNPSGDNGVKVVEPDGSMLIQSWESTATELANLLAN------RPLEDIKAKVGQLTSG 116
           ASHNP  DNGVK+V+P G ML Q WE  ATELAN  ++        L+++  + G     
Sbjct: 64  ASHNPPQDNGVKLVDPKGEMLKQEWEVYATELANCASDGKHQFLHRLQELMNQFGIKADS 123

Query: 117 ESSVRPQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLT---NETMI 173
           E+    +++V RDSR SG  LL  LV   +   +  I DY +LTTPQLHFLT   N  M 
Sbjct: 124 EA----RIVVARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLNRQME 179

Query: 174 TG--AHVDEQAYFAHFLGAWDQIAALQPVK-LPN-VVVDCANGIGGPKMSALLTQWGFAK 229
           +     V+E  Y++HFL A  ++  L  +  LP  +V+D ANG+GG K   L  +  F K
Sbjct: 180 SERVIEVNEAFYYSHFLSALKELTELFNIPGLPYPLVIDAANGVGGAKAEELFMKNTFFK 239

Query: 230 -QCSVINDKCDEPELLNHGCGADFVKTSQRLPNGVKP--NANDLYCSFDGDADRVVFYYL 286
              ++IN    + +LLN  CGAD+VKT+Q LP G+    + N L+CSFDGDADRV+FYY 
Sbjct: 240 DSTTIINGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDINSLHCSFDGDADRVIFYYR 299

Query: 287 DQNLGFHLLDGDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDNLQVP 346
           D +  FHLLDGDKISTLFA F   +L    +   + +GVVQTAYANGSST+YL + L VP
Sbjct: 300 DVDGMFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYLSEVLIVP 359

Query: 347 VSCTKTGVKHLHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVTNH-------ADQTPEL 399
           VSCT TGVK+LH +AV NYD+GIYFEANGHGTV+FS  F+ TV+         A+    L
Sbjct: 360 VSCTPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSLSAESKMAL 419

Query: 400 KILKYLAKLINQTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSAF 459
           K L+  +KLINQTVGDA+SDMMAVLAVL IL+W+P +WD E+TDLPN L KVVV DRS F
Sbjct: 420 KTLQSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVVVPDRSLF 479

Query: 460 TTTDQERRLVSPAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSSI 519
            TT+ ER+LVSP GLQ +ID+ +    + RSFVRASGTEDAVR+YAEAAT+ + D LS  
Sbjct: 480 KTTNAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKEQADDLSIK 539

Query: 520 VGDLV 524
           +  LV
Sbjct: 540 ISQLV 544

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/528 (54%), Positives = 359/528 (67%), Gaps = 20/528 (3%)

Query: 17  GYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMITASHNPSGDNGVKVV 76
           G  Y YGTAGFR  +E L  V+FATG++ACLRS  L G  VGVM+TASHNP  DNGVK+V
Sbjct: 18  GRVYAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGVMLTASHNPPEDNGVKLV 77

Query: 77  EPDGSMLIQSWESTATELANLLAN--RPLEDIKAKVGQLTSGESSVRPQLIVGRDSRVSG 134
           +P G ML   WE  AT LAN  +   + L D    +      + ++R +++V RDSR SG
Sbjct: 78  DPHGEMLAAEWEKHATALANCASQGQQELLDALHMLVDRLGLDLALRARVVVARDSRASG 137

Query: 135 PHLLSCLVASATSLFDAKITDYGLLTTPQLHFLT---NETMITGAHVDEQAYFAHFLGAW 191
           P LL  L+     L D ++ D G+LTTPQLHFLT   NE   + A V E  Y+AHF+ A 
Sbjct: 138 PQLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACNERG-SAAGVREDLYYAHFVAAL 196

Query: 192 DQIAALQPVK-LP-NVVVDCANGIGGPKMSALLTQWG-FAKQCSVINDKCDEPELLNHGC 248
           +++AAL  ++ LP  +VVD ANG+G  K   L  +   F  + S+IND   + ELLN GC
Sbjct: 197 EELAALHGLETLPFPLVVDTANGVGALKARELFRRSPLFKNRVSIINDNWSQHELLNSGC 256

Query: 249 GADFVKTSQRLPNGVKPN--ANDLYCSFDGDADRVVFYYLDQNLGFHLLDGDKISTLFAY 306
           GAD+VKT Q LP G+  +     L+CS+DGDADRV+FYY+D    FHLLDGDKISTL A 
Sbjct: 257 GADYVKTKQCLPQGISADLLRESLFCSYDGDADRVIFYYIDGQERFHLLDGDKISTLIAK 316

Query: 307 FVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDNLQVPVSCTKTGVKHLHHEAVNNYD 366
           F+   L    ++  + +GVVQTAYANGSST+YL + L+VPVSCT TGVKHLH EAV  YD
Sbjct: 317 FLQSALLTAGINDDVCLGVVQTAYANGSSTRYLSEVLEVPVSCTPTGVKHLHREAVQKYD 376

Query: 367 IGIYFEANGHGTVMFSNKFHETVTNHADQTP--------ELKILKYLAKLINQTVGDAIS 418
           +GIYFEANGHGTV+FS  F  TV   A + P         L+ LK  A LINQT+GDAI+
Sbjct: 377 VGIYFEANGHGTVIFSEHFTLTV-ERALENPALSAKARLSLQTLKTFANLINQTIGDAIA 435

Query: 419 DMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSAFTTTDQERRLVSPAGLQDKI 478
           DM+AV+A+LSIL WSP  WD+++TDLPN L KVVV DRS F TT+ E++L SPAGLQ+ I
Sbjct: 436 DMLAVIAILSILHWSPEDWDKQYTDLPNNLVKVVVPDRSMFKTTNAEQQLTSPAGLQELI 495

Query: 479 DEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSSIVGDLVRE 526
           D+ V    SGRSFVRASGTEDAVR+YAEAA+Q + D+L++ V  LV E
Sbjct: 496 DDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQADELATKVSTLVVE 543

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score =  520 bits (1339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/535 (52%), Positives = 344/535 (64%), Gaps = 15/535 (2%)

Query: 2   REPLESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMI 61
           RE + ++ +  CTT+GY Y YGTAGFRD +  LDTVMFATG VA LRS  LNG  VGVM+
Sbjct: 3   REAVRAVFDAVCTTKGYTYTYGTAGFRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGVMV 62

Query: 62  TASHNPSGDNGVKVVEPDGSMLIQSWESTATELANLLANRPLEDIKAKVGQLTS-GESSV 120
           TASHNP  DNGVKVV+P+G ML + WE  AT LANL AN   +        L   G  + 
Sbjct: 63  TASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGTFDQWWEYWTSLVEEGNYTG 122

Query: 121 RPQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTT--PQLHFLTNETMITGAHV 178
             +L VG D+R S P LL  L+ +A ++    IT      T  PQLH+LT  ++      
Sbjct: 123 GARLCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQLHYLT--SLQRDGVT 180

Query: 179 DEQAYFAHFLGAWDQIAALQPVKLP--NVVVDCANGIGGPKMSALLTQWGFAK-QCSVIN 235
           D  AY  HF G W ++     V  P   + +D ANG+G  ++      W   + +  ++N
Sbjct: 181 DAAAYNDHFQGCWQKLFPDGVVAWPFDRLFIDTANGVGAVQLQQFFKGWAVDQNKFRLLN 240

Query: 236 DKCDEPELLNHGCGADFVKTSQRLPN------GVKPNANDLYCSFDGDADRVVFYYLDQN 289
                PE LN  CGADFVKT+ RLP+      G      DLYCSFDGDADR+VFY++ +N
Sbjct: 241 TDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTSGALPDLYCSFDGDADRIVFYFV-KN 299

Query: 290 LGFHLLDGDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDNLQVPVSC 349
             FHLLDGDKISTLFA F+ +L  +   D  L++GVVQTAYANG+ST+Y+   L +P +C
Sbjct: 300 KQFHLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYANGNSTRYIASELGIPSAC 359

Query: 350 TKTGVKHLHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVTNHADQTPELKILKYLAKLI 409
           TKTGVKHLHH A   YDIGIYFEANGHGTV+FS+KF+E V   A        L + +KLI
Sbjct: 360 TKTGVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVVAGVASTNDAASTLYHFSKLI 419

Query: 410 NQTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSAFTTTDQERRLV 469
           NQTVGDAI+DM+ VLAVL  LQW+P  W  E+TDLPN LTKVVV DRS F TTDQERRLV
Sbjct: 420 NQTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLTKVVVPDRSIFETTDQERRLV 479

Query: 470 SPAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSSIVGDLV 524
           SP GLQ+KID  V R K  RSFVRASGTE+AVR+Y EA    E  +LS  V + V
Sbjct: 480 SPEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAEDPQEVQELSKQVTEAV 534

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 33/64 (51%), Gaps = 2/64 (3%)

Query: 21  VYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMITASHNPSGDNGVKVVEPDG 80
           V+ +AGF   +         T +V     Q+  G  VGVMITASHNP  DNG KV   +G
Sbjct: 123 VFLSAGFTVYNLNPPGTFVHTPLVPFTVDQI--GASVGVMITASHNPKMDNGYKVYYSNG 180

Query: 81  SMLI 84
             +I
Sbjct: 181 CQII 184

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 21/31 (67%)

Query: 54  GKPVGVMITASHNPSGDNGVKVVEPDGSMLI 84
           G  VGVMITASHNP  DNG KV   +G  +I
Sbjct: 156 GASVGVMITASHNPKMDNGYKVYYSNGCQII 186

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 46/97 (47%), Gaps = 9/97 (9%)

Query: 57  VGVMITASHNPSGDNGVKVVEPDGSMLIQSWESTATEL--ANLLANRPLEDIKAKVGQLT 114
           VGVMITASHNP  DNG KV   +G  +I   +S       +NL     + D    + Q  
Sbjct: 147 VGVMITASHNPKLDNGYKVYYANGCQIIPPHDSAIARSIESNLEPGNGVWDWDQTMQQ-- 204

Query: 115 SGESSVRPQLIVGRDSRVSGPHLLSCLVASATSLFDA 151
              ++   +LI GRD  +     +SC+  S  +  D+
Sbjct: 205 ---AADEGKLIYGRDKMLE--QYISCVKDSFVTELDS 236

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 21/31 (67%)

Query: 54  GKPVGVMITASHNPSGDNGVKVVEPDGSMLI 84
           G  VG+MITASHNP  DNG KV   +G  +I
Sbjct: 151 GASVGIMITASHNPKMDNGYKVYYTNGCQII 181

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 34/69 (49%), Gaps = 12/69 (17%)

Query: 21  VYGTAGFR-----DDSEKLDTVMFATGIVACLRSQVLNGKPVGVMITASHNPSGDNGVKV 75
           V+  AGF+      + E + T M   GI        L    +GVMITASHNP  DNG KV
Sbjct: 123 VFLNAGFKVYYLNPNDEFVHTPMVPFGIN-------LYSASIGVMITASHNPEMDNGYKV 175

Query: 76  VEPDGSMLI 84
              +G  +I
Sbjct: 176 YYNNGCQII 184

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%)

Query: 57  VGVMITASHNPSGDNGVKVVEPDGSMLI 84
           VGVMITASHNP  DNG KV   +G  +I
Sbjct: 151 VGVMITASHNPKMDNGYKVYYSNGCQII 178

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%)

Query: 57  VGVMITASHNPSGDNGVKVVEPDGSMLI 84
           VGVMITASHNP  DNG KV   +G  +I
Sbjct: 148 VGVMITASHNPKMDNGYKVYYTNGCQII 175

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%)

Query: 57  VGVMITASHNPSGDNGVKVVEPDGSMLI 84
           VGVMITASHNP  DNG KV   +G  +I
Sbjct: 151 VGVMITASHNPKMDNGYKVYYSNGCQII 178

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%)

Query: 57  VGVMITASHNPSGDNGVKVVEPDGSMLI 84
           VGVMITASHNP  DNG KV   +G  +I
Sbjct: 151 VGVMITASHNPKMDNGYKVYYSNGCQII 178

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 20/31 (64%)

Query: 54  GKPVGVMITASHNPSGDNGVKVVEPDGSMLI 84
           G   GVMITASHNP  DNG KV   +G  +I
Sbjct: 152 GASAGVMITASHNPKMDNGYKVYYSNGCQII 182

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 20/28 (71%)

Query: 57  VGVMITASHNPSGDNGVKVVEPDGSMLI 84
           +GVMITASHNP  DNG KV   +G  +I
Sbjct: 154 IGVMITASHNPKMDNGYKVYYSNGCQII 181

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 24/43 (55%)

Query: 41  TGIVACLRSQVLNGKPVGVMITASHNPSGDNGVKVVEPDGSML 83
           T +V    S +  G   G+MITASHNP  DNG KV   +G  +
Sbjct: 147 TPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQI 189

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%)

Query: 57  VGVMITASHNPSGDNGVKVVEPDGSMLI 84
           VGVMITASHNP  DNG KV   +G  +I
Sbjct: 154 VGVMITASHNPKMDNGYKVYFANGCQII 181

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 39/75 (52%), Gaps = 7/75 (9%)

Query: 57  VGVMITASHNPSGDNGVKVVEPDGSMLIQSWESTATEL--ANLLANRPLEDIKAKVGQLT 114
           VGVM+TASHNP  DNG KV   +G  +I   +S  ++   ANL    P E+       + 
Sbjct: 166 VGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDSGISQCIDANL---EPWENSWNYKEIMA 222

Query: 115 SGESSVRPQLIVGRD 129
           + ES  +  LI  RD
Sbjct: 223 NAES--KGDLIYHRD 235

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 38.5 bits (88), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 20/28 (71%)

Query: 57  VGVMITASHNPSGDNGVKVVEPDGSMLI 84
           VGVM+TASHNP  DNG KV   +G  +I
Sbjct: 151 VGVMVTASHNPKMDNGYKVYYSNGCQII 178

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 51  VLNGKP-VGVMITASHNPSGDNGVKVVEPDGSMLIQSWESTATEL 94
           VLN K  VGVMITASHNP  DNG KV   +   +I   +    E+
Sbjct: 146 VLNLKASVGVMITASHNPKMDNGYKVYYDNACQIIPPHDKNIAEM 190

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 17/27 (62%), Positives = 19/27 (70%)

Query: 58  GVMITASHNPSGDNGVKVVEPDGSMLI 84
           GVMITASHNP  DNG KV   +G  +I
Sbjct: 158 GVMITASHNPKDDNGYKVYYSNGCQII 184

>CAGL0J03762g Chr10 complement(359858..361342) [1485 bp, 494 aa]
           {ON} highly similar to uniprot|Q08645 Saccharomyces
           cerevisiae YOR241w MET7 tetrahydrofolylpolyglutamate
           synthase
          Length = 494

 Score = 38.1 bits (87), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 49/114 (42%), Gaps = 8/114 (7%)

Query: 89  STATELANLLANRPLEDIKAKVGQLTSGESSVRPQLIVGRDSRVSGPHLLSCLVASATSL 148
           S  +  AN++A R   D K ++  L   E S R    V   ++++  H+       +T+ 
Sbjct: 24  SLQSNYANIMAVRQSGDRKNRMSILEMYEWSRRLGYKVSDFNKLNIVHITGTKGKGSTAA 83

Query: 149 FDA--------KITDYGLLTTPQLHFLTNETMITGAHVDEQAYFAHFLGAWDQI 194
           F +        K+T  GL T+P L  +     I G  + E  +  +F   WD++
Sbjct: 84  FTSSILQQYQDKLTKIGLYTSPHLRSVRERIRINGEPISESKFTEYFFQVWDKL 137

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score = 38.1 bits (87), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 17/27 (62%), Positives = 19/27 (70%)

Query: 58  GVMITASHNPSGDNGVKVVEPDGSMLI 84
           GVMITASHNP  DNG KV   +G  +I
Sbjct: 160 GVMITASHNPKMDNGYKVYYANGCQII 186

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score = 38.1 bits (87), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 26/42 (61%), Gaps = 2/42 (4%)

Query: 58  GVMITASHNPSGDNGVKVVEPDGSMLIQSWESTATE--LANL 97
           G+MITASHNP  DNG KV   +G  +I   +   ++  LANL
Sbjct: 157 GIMITASHNPKMDNGYKVYYSNGCQIIPPHDQRISQSILANL 198

>NCAS0B01590 Chr2 (259518..260993) [1476 bp, 491 aa] {ON} Anc_8.669
          Length = 491

 Score = 38.1 bits (87), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 57/133 (42%), Gaps = 10/133 (7%)

Query: 84  IQSWESTATELANLLANRPLEDIKAKVGQLTSGESSVRPQLIVGRDSRVSGPHLL----- 138
           I S  S  +  AN++A R   D K  +      E S R    V   ++++  H+      
Sbjct: 18  INSLNSLQSNYANIMAIRESGDRKNMMNIWEMKEWSRRIGYNVSEFNKLNIIHITGTKGK 77

Query: 139 ---SCLVASATSLFDAKITDYGLLTTPQLHFLTNETMITGAHVDEQAYFAHFLGAWDQIA 195
              +   +S  + +  K+   GL T+P L  +     I GA + E  +  +F   WD++ 
Sbjct: 78  GSTAAFTSSILNQYKEKLPKVGLYTSPHLKSVRERIRINGAPISEDKFTKYFFEVWDRLE 137

Query: 196 -ALQPV-KLPNVV 206
            +  P+ K P++V
Sbjct: 138 NSSSPLDKFPHMV 150

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score = 37.7 bits (86), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%)

Query: 58  GVMITASHNPSGDNGVKVVEPDGSMLI 84
           G+MITASHNP  DNG KV   +G  +I
Sbjct: 156 GIMITASHNPKMDNGYKVYYSNGCQII 182

>ZYRO0F07216g Chr6 (584726..586192) [1467 bp, 488 aa] {ON} similar
           to uniprot|Q08645 Saccharomyces cerevisiae YOR241W MET7
           Folylpolyglutamate synthetase catalyzes extension of the
           glutamate chains of the folate coenzymes required for
           methionine synthesis and for maintenance of
           mitochondrial DNA present in both the cytoplasm and
           mitochondria
          Length = 488

 Score = 37.4 bits (85), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 53/126 (42%), Gaps = 8/126 (6%)

Query: 89  STATELANLLANRPLEDIKAKVGQLTSGESSVRPQLIVGRDSRVSGPHLLSCLVASATSL 148
           S  +  AN++A R   D K ++      E S R    V    +++  H+       +T+ 
Sbjct: 23  SLQSNYANIMAIRESGDRKNQMNIWEMQEWSRRIGYNVSEFDKLNVVHITGTKGKGSTAA 82

Query: 149 FDA------KITDYGLLTTPQLHFLTNETMITGAHVDEQAYFAHFLGAWDQIAALQP--V 200
           F A      K+   GL T+P L  +T    I G  + E  +  +F   WD++   +    
Sbjct: 83  FVASILGKYKVPKVGLYTSPHLKSVTERIRINGNPISEDKFAKYFFEVWDKLENTESELS 142

Query: 201 KLPNVV 206
           K P+++
Sbjct: 143 KFPHMI 148

>Kwal_26.8759 s26 (932797..934275) [1479 bp, 492 aa] {ON} YOR241W
           (MET7) - Folylpolyglutamate synthetase [contig 67] FULL
          Length = 492

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 74/183 (40%), Gaps = 19/183 (10%)

Query: 84  IQSWESTATELANLLANRPLEDIKAKVGQLTSGESSVRPQLIVGRDSRVSGPHLLSCLVA 143
           I +  S  +  AN++A R   D K K+      E S R        ++++  H+      
Sbjct: 21  IAALNSLQSNYANIMAIRASGDRKNKMNIWEMQEWSRRIGYSTSDFNKLNIVHITGTKGK 80

Query: 144 SATSLFDA--------KITDYGLLTTPQLHFLTNETMITGAHVDEQAYFAHFLGAWDQI- 194
            +T+ F          KI   GL T+P L  +     I G  + E+ +  +F   WD++ 
Sbjct: 81  GSTAAFTHSILQQYGDKIKKVGLYTSPHLKSVRERIQINGQPICEEKFSRYFFDVWDKLD 140

Query: 195 AALQPV-KLPNVVVDCANGIGGPKMSALLTQWGFAKQCSVINDKCDEPELLNHGCGADFV 253
           A   P+ K P++      G    K   LL+   FA++      KCD   +   G G +F 
Sbjct: 141 ATSSPIDKFPHMTPGAKPGYF--KYLTLLSFHVFAQE------KCDSC-IYEVGVGGEFD 191

Query: 254 KTS 256
            T+
Sbjct: 192 STN 194

>TPHA0G01620 Chr7 complement(334221..335699) [1479 bp, 492 aa] {ON}
           Anc_8.669 YOR241W
          Length = 492

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 29/133 (21%), Positives = 56/133 (42%), Gaps = 10/133 (7%)

Query: 84  IQSWESTATELANLLANRPLEDIKAKVGQLTSGESSVRPQLIVGRDSRVSGPHLLSCLVA 143
           ++   S  +  A ++A R   + K K+  L   E + R    +     ++  H+      
Sbjct: 18  VKKLNSLQSNYATIMAIRQSGNSKNKMAILEMQEWTKRIGYSISDLDNLNMIHITGTKGK 77

Query: 144 SATSLF-DAKITDY-------GLLTTPQLHFLTNETMITGAHVDEQAYFAHFLGAWDQIA 195
            +T+ F D+ ++ Y       GL T+P L  +     I    +DE  +  +F   WD++ 
Sbjct: 78  GSTAAFTDSILSQYRDSLPKIGLFTSPHLKSVRERIRINSEPIDEMKFTKYFFEVWDKLE 137

Query: 196 ALQPV--KLPNVV 206
           + Q    K PN++
Sbjct: 138 STQSSTEKFPNMI 150

>SAKL0H06732g Chr8 complement(592276..593763) [1488 bp, 495 aa] {ON}
           highly similar to gnl|GLV|KLLA0F11297g Kluyveromyces
           lactis KLLA0F11297g and similar to YOR241W
           uniprot|Q08645 Saccharomyces cerevisiae YOR241W MET7
           Folylpolyglutamate synthetase catalyzes extension of the
           glutamate chains of the folate coenzymes required for
           methionine synthesis and for maintenance of
           mitochondrial DNA present in both the cytoplasm and
           mitochondria
          Length = 495

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 14/58 (24%), Positives = 29/58 (50%)

Query: 139 SCLVASATSLFDAKITDYGLLTTPQLHFLTNETMITGAHVDEQAYFAHFLGAWDQIAA 196
           +    S  S ++ ++++ GL T+P L  +     I G  + E+ +  +F   WD++ A
Sbjct: 86  AAFTQSILSQYNDRLSNIGLYTSPHLKSVRERIRINGNPITEEKFSQYFFEVWDKLEA 143

>KAFR0A03820 Chr1 (777572..779053) [1482 bp, 493 aa] {ON} Anc_8.669
           YOR241W
          Length = 493

 Score = 34.3 bits (77), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 55/130 (42%), Gaps = 8/130 (6%)

Query: 73  VKVVEPDGSMLIQSWESTATELANLLANRPLEDIKAKVGQLTSGESSVRPQLIVGRDSRV 132
           +K+VE   +  I +  S  +  AN++A R     K  +  L   E S R    +   +++
Sbjct: 7   LKMVEKTYNDAINALNSLQSNYANIMAIRESGIRKNDMAILEMKEWSRRIGYSISDLNKL 66

Query: 133 SGPHLLSCLVASATSLFDAKITD--------YGLLTTPQLHFLTNETMITGAHVDEQAYF 184
           +  H+       +T+ F + I +         GL T+P L  +     I G  + E  + 
Sbjct: 67  NMVHITGTKGKGSTAAFASSILNQYKRQLPKIGLYTSPHLRNVRERIRINGEPISEDKFT 126

Query: 185 AHFLGAWDQI 194
           A+F   W+++
Sbjct: 127 AYFFDVWNRL 136

>Smik_15.425 Chr15 (736732..736764,736774..736821,736858..738360)
           [1584 bp, 527 aa] {ON} YOR241W (REAL)
          Length = 527

 Score = 34.3 bits (77), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 30/133 (22%), Positives = 56/133 (42%), Gaps = 10/133 (7%)

Query: 84  IQSWESTATELANLLANRPLEDIKAKVGQLTSGESSVRPQLIVGRDSRVSGPHLLSCLVA 143
           + +  S  +  AN++A R   D K  +  L   E S R        ++++  H+      
Sbjct: 51  VTALNSLQSNYANIMAIRQTGDRKNIMTLLEMHEWSRRIGYAASDFNKLNIVHITGTKGK 110

Query: 144 SATSLFDA--------KITDYGLLTTPQLHFLTNETMITGAHVDEQAYFAHFLGAWDQI- 194
            +T+ F +        K+   GL T+P L  +     I G  + E+ +  +F   WD++ 
Sbjct: 111 GSTAAFTSSILGQYKEKLPRIGLYTSPHLRSVRERIRINGEPISEKKFAKYFFEVWDRLD 170

Query: 195 AALQPV-KLPNVV 206
               P+ K P++V
Sbjct: 171 KTTSPLDKFPHMV 183

>KLTH0D11066g Chr4 (904878..906359) [1482 bp, 493 aa] {ON} similar
           to uniprot|Q08645 Saccharomyces cerevisiae YOR241W MET7
           Folylpolyglutamate synthetase catalyzes extension of the
           glutamate chains of the folate coenzymes required for
           methionine synthesis and for maintenance of
           mitochondrial DNA present in both the cytoplasm and
           mitochondria
          Length = 493

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 50/121 (41%), Gaps = 8/121 (6%)

Query: 84  IQSWESTATELANLLANRPLEDIKAKVGQLTSGESSVRPQLIVGRDSRVSGPHLLSCLVA 143
           I +  S  +  AN++A R   D K K+      E S R        ++++  H+      
Sbjct: 21  IAALNSLQSNYANIMAIRASGDRKNKMNIWEMQEWSRRIGYSTSDFNKLNIVHITGTKGK 80

Query: 144 SATSLFDA--------KITDYGLLTTPQLHFLTNETMITGAHVDEQAYFAHFLGAWDQIA 195
            +T+ F          +I   GL T+P L  +     I G  + E+ + ++F   WD++ 
Sbjct: 81  GSTAAFTQSVLQQYGDQIRKIGLYTSPHLKSVRERIRINGQPICEEKFSSYFFDVWDKLE 140

Query: 196 A 196
           A
Sbjct: 141 A 141

>NDAI0E01200 Chr5 complement(238271..239743) [1473 bp, 490 aa] {ON}
           Anc_8.669 YOR241W
          Length = 490

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/133 (21%), Positives = 55/133 (41%), Gaps = 10/133 (7%)

Query: 84  IQSWESTATELANLLANRPLEDIKAKVGQLTSGESSVRPQLIVGRDSRVSGPHLLSCLVA 143
           I S  S  +  AN++A R   D + ++      E S R    V   ++++  H+      
Sbjct: 18  INSLNSLQSNYANIMAIRESGDRRNQMNIWEMQEWSKRIGYNVSDFNKLNVIHITGTKGK 77

Query: 144 SATSLFDA--------KITDYGLLTTPQLHFLTNETMITGAHVDEQAYFAHFLGAWDQIA 195
            +T+ F +        K+   GL T+P L  +     I G  + E  +  +F   W+++ 
Sbjct: 78  GSTAAFTSSILRQYNDKLPKIGLYTSPHLKTVRERIRINGEPISEDKFTKYFFEVWNKLG 137

Query: 196 ALQP--VKLPNVV 206
             +    K P++V
Sbjct: 138 NTKSNLEKFPHMV 150

>KLLA0F11297g Chr6 complement(1040048..1041529) [1482 bp, 493 aa]
           {ON} similar to uniprot|Q08645 Saccharomyces cerevisiae
           YOR241W MET7 Folylpolyglutamate synthetase catalyzes
           extension of the glutamate chains of the folate
           coenzymes required for methionine synthesis and for
           maintenance of mitochondrial DNA present in both the
           cytoplasm and mitochondria
          Length = 493

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 49/119 (41%), Gaps = 8/119 (6%)

Query: 84  IQSWESTATELANLLANRPLEDIKAKVGQLTSGESSVRPQLIVGRDSRVSGPHLLSCLVA 143
           +Q+  S  +  AN++A R   D K  +      E S R    V   ++++  H+      
Sbjct: 18  VQALNSLQSNYANIMAIRASGDRKNMMNIWEMQEWSRRIGYSVSDFNKLNVIHITGTKGK 77

Query: 144 SATSLFDAKI--------TDYGLLTTPQLHFLTNETMITGAHVDEQAYFAHFLGAWDQI 194
            +T+ F   I        +  GL T+P L  +     I G  + E+ +  +F   WD++
Sbjct: 78  GSTAAFTQGILNQYKDTLSKVGLYTSPHLRSVRERIRINGEPITEELFSKYFFEVWDRL 136

>Ecym_2404 Chr2 complement(786523..787992) [1470 bp, 489 aa] {ON}
           similar to Ashbya gossypii ACR134W
          Length = 489

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 22/46 (47%)

Query: 149 FDAKITDYGLLTTPQLHFLTNETMITGAHVDEQAYFAHFLGAWDQI 194
           ++ KI   GL T+P L  +     I G  + E+ +   F   WD++
Sbjct: 92  YEDKIGKVGLFTSPHLRTVRERIAINGRPISEEKFAKFFFEVWDRL 137

>Kpol_1072.18 s1072 complement(42308..43783) [1476 bp, 491 aa] {ON}
           complement(42308..43783) [1476 nt, 492 aa]
          Length = 491

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 44/108 (40%), Gaps = 8/108 (7%)

Query: 95  ANLLANRPLEDIKAKVGQLTSGESSVRPQLIVGRDSRVSGPHLLSCLVASATSLFDAKIT 154
           A +LA R   + K K+  L   E   R    +    +++  H+       +T+ F + I 
Sbjct: 29  ATILATRQSGNTKNKMNILEMKEWVRRIGYSISDIDKLNIIHITGTKGKGSTAAFTSSIL 88

Query: 155 D--------YGLLTTPQLHFLTNETMITGAHVDEQAYFAHFLGAWDQI 194
           +         GL T+P L  +     I G  + E+ +  +F   WD++
Sbjct: 89  NEYKDSIGKIGLYTSPHLKSVRERIRINGIPISEEKFTKYFFEVWDKL 136

>Skud_15.408 Chr15 (726149..727633) [1485 bp, 494 aa] {ON} YOR241W
           (REAL)
          Length = 494

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 53/128 (41%), Gaps = 10/128 (7%)

Query: 89  STATELANLLANRPLEDIKAKVGQLTSGESSVRPQLIVGRDSRVSGPHLLSCLVASATSL 148
           S  +  AN++A R   D K  +  L   E S R        ++++  H+       +T+ 
Sbjct: 23  SLQSNYANIMAIRQTGDRKNIMTLLEMHEWSRRIGYSASDFNKLNIVHITGTKGKGSTAA 82

Query: 149 FDAKI--------TDYGLLTTPQLHFLTNETMITGAHVDEQAYFAHFLGAWDQI-AALQP 199
           F + I           GL T+P L  +     I G  + E+ +  +F   WD++     P
Sbjct: 83  FTSSILGQYKEQLPRIGLYTSPHLRSVRERIRINGEPISEEKFAKYFFEVWDRLDKTTSP 142

Query: 200 V-KLPNVV 206
           + K P+++
Sbjct: 143 LDKFPHMI 150

>YOR241W Chr15 (786995..788641) [1647 bp, 548 aa] {ON}
           MET7Folylpolyglutamate synthetase, catalyzes extension
           of the glutamate chains of the folate coenzymes,
           required for methionine synthesis and for maintenance of
           mitochondrial DNA
          Length = 548

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 46/114 (40%), Gaps = 8/114 (7%)

Query: 89  STATELANLLANRPLEDIKAKVGQLTSGESSVRPQLIVGRDSRVSGPHLLSCLVASATSL 148
           S  +  AN++A R   D K  +  L   E S R        ++++  H+       +T+ 
Sbjct: 77  SLQSNYANIMAIRQTGDRKNTMTLLEMHEWSRRIGYSASDFNKLNIVHITGTKGKGSTAA 136

Query: 149 FDAKIT--------DYGLLTTPQLHFLTNETMITGAHVDEQAYFAHFLGAWDQI 194
           F + I           GL T+P L  +     I G  + E+ +  +F   WD++
Sbjct: 137 FTSSILGQYKEQLPRIGLYTSPHLKSVRERIRINGEPISEEKFAKYFFEVWDRL 190

>Suva_8.291 Chr8 (526024..526038,526042..526149,526172..527656)
           [1608 bp, 535 aa] {ON} YOR241W (REAL)
          Length = 535

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 25/114 (21%), Positives = 45/114 (39%), Gaps = 8/114 (7%)

Query: 89  STATELANLLANRPLEDIKAKVGQLTSGESSVR--------PQLIVGRDSRVSGPHLLSC 140
           S  +  AN++A R   D K  +  L   E S R         +L +   +   G    + 
Sbjct: 64  SLQSNYANIMAIRQTGDRKNIMTLLEMHEWSRRIGYSSSDFNKLNIVHITGTKGKGSTAA 123

Query: 141 LVASATSLFDAKITDYGLLTTPQLHFLTNETMITGAHVDEQAYFAHFLGAWDQI 194
             +S    +  ++   GL T+P L  +     I G  + E+ +  +F   WD++
Sbjct: 124 FTSSILGQYKEQLPRIGLYTSPHLKSVRERIRIDGEPISEEKFAKYFFEVWDRL 177

>SAKL0G15400g Chr7 (1325560..1327194) [1635 bp, 544 aa] {ON} similar
           to gnl|GLV|KLLA0E15928g Kluyveromyces lactis
           KLLA0E15928g and weakly similar to YHR150W
           uniprot|P38848 Saccharomyces cerevisiae YHR150W PEX28
           Peroxisomal integral membrane protein involved in
           regulation of peroxisome size and number genetic
           interactions suggest that Pex28p and Pex29p act at steps
           upstream of those mediated by Pex30p Pex31p and Pex32p
          Length = 544

 Score = 31.6 bits (70), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%), Gaps = 2/26 (7%)

Query: 19  RYVYGTAGFRDDSEKLDTVMFATGIV 44
           ++VYGTAGF+D  E   T +F TG+V
Sbjct: 337 KFVYGTAGFKD--EHHSTALFLTGLV 360

>KNAG0A02940 Chr1 complement(358015..359490) [1476 bp, 491 aa] {ON}
           Anc_8.669 YOR241W
          Length = 491

 Score = 31.2 bits (69), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 23/108 (21%), Positives = 46/108 (42%), Gaps = 8/108 (7%)

Query: 95  ANLLANRPLEDIKAKVGQLTSGESSVRPQLIVGRDSRVSGPHLLSCLVASATSLFDAKIT 154
           AN++A R     K ++  L   E + R    V   ++++  H+       +T+ F A I 
Sbjct: 29  ANIMAVRESGIRKNEMSMLEMKEWTRRVGYSVSDFNKLNVVHITGTKGKGSTAAFTASIF 88

Query: 155 D--------YGLLTTPQLHFLTNETMITGAHVDEQAYFAHFLGAWDQI 194
           +         GL T+P L  +     I G  + ++ +  +F   W+++
Sbjct: 89  NEYKKQLPRVGLFTSPHLRSVRERIRINGEPISQEKFTKYFFELWERL 136

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,509,391
Number of extensions: 2321909
Number of successful extensions: 5984
Number of sequences better than 10.0: 60
Number of HSP's gapped: 6027
Number of HSP's successfully gapped: 60
Length of query: 528
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 414
Effective length of database: 40,409,475
Effective search space: 16729522650
Effective search space used: 16729522650
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)