Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G045906.12ON74743847e-50
ACR014C6.12ON70741608e-16
Kpol_1032.36.12ON78821531e-14
Ecym_30156.12ON70741494e-14
KLTH0C11484g6.12ON89761402e-12
Suva_5.96.12ON73771322e-11
Kwal_56.223596.12ON91751314e-11
YEL059C-A (SOM1)6.12ON74771271e-10
Skud_5.306.12ON74771261e-10
SAKL0E00924g6.12ON97811272e-10
KAFR0L003506.12ON71701242e-10
Smik_5.286.12ON74771243e-10
KLLA0D00880g6.12ON71751243e-10
TPHA0M002206.12ON78641226e-10
ZYRO0F00528g6.12ON77801211e-09
KNAG0E009306.12ON109691114e-08
NCAS0F002106.12ON79861071e-07
TBLA0G009906.12ON7885835e-04
TBLA0G01145singletonON77551700.11
Kthe_YGOB_EST37.128ON19324584.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G04590
         (74 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}...   152   7e-50
ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON} Syn...    66   8e-16
Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)...    64   1e-14
Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to As...    62   4e-14
KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON...    59   2e-12
Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON} YEL0...    55   2e-11
Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A ...    55   4e-11
YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}  SO...    54   1e-10
Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON} YEL...    53   1e-10
SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to...    54   2e-10
KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12 Y...    52   2e-10
Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON} YEL...    52   3e-10
KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON} uniprot|P7...    52   3e-10
TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12 Y...    52   6e-10
ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to...    51   1e-09
KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON...    47   4e-08
NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12 YE...    46   1e-07
TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12 ...    37   5e-04
TBLA0G01145 Chr7 (302341..304668) [2328 bp, 775 aa] {ON}  possib...    32   0.11 
Kthe_YGOB_EST3 Chr6 complement(1055444..1055740,1055742..1056026...    27   4.7  

>TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 74

 Score =  152 bits (384), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 74/74 (100%), Positives = 74/74 (100%)

Query: 1  MAPPTPVLAREELPEIPQSKNCVLKSLTQFQCQLRPAGSGLYECVPFKRLFQECRDPSGR 60
          MAPPTPVLAREELPEIPQSKNCVLKSLTQFQCQLRPAGSGLYECVPFKRLFQECRDPSGR
Sbjct: 1  MAPPTPVLAREELPEIPQSKNCVLKSLTQFQCQLRPAGSGLYECVPFKRLFQECRDPSGR 60

Query: 61 FKSRIEVTSPLTNH 74
          FKSRIEVTSPLTNH
Sbjct: 61 FKSRIEVTSPLTNH 74

>ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YEL059C-A
          (SOM1)
          Length = 70

 Score = 66.2 bits (160), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 48/74 (64%), Gaps = 6/74 (8%)

Query: 1  MAPPTPVLAREEL-PEIPQSKNCVLKSLTQFQCQLRPAGSGLYECVPFKRLFQECRDPSG 59
          MAPPTPVL REE+ P +  S++CVL SLTQ +C     G   Y CVPF+RLF+EC     
Sbjct: 1  MAPPTPVLTREEVAPALATSRDCVLASLTQNECHFDGRG---YVCVPFQRLFREC--TLN 55

Query: 60 RFKSRIEVTSPLTN 73
          + + RIE+T   TN
Sbjct: 56 KRRVRIEITERNTN 69

>Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)
          [237 nt, 79 aa]
          Length = 78

 Score = 63.5 bits (153), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 39/82 (47%), Positives = 48/82 (58%), Gaps = 14/82 (17%)

Query: 1  MAPPTPVLAREE-------LPEIPQSKN-CVLKSLTQFQCQLRPAGSGLYECVPFKRLFQ 52
          MAPPTP+ +REE       L  +   K  C L S+TQFQC+   +  G Y C+PFKRLF+
Sbjct: 1  MAPPTPIQSREEVLRGKKCLTMVDNKKGKCTLTSITQFQCRFENSYEGEYICLPFKRLFE 60

Query: 53 ECRDPSGRFKSRIEVTSPLTNH 74
          EC   SG    RIEVT   TN+
Sbjct: 61 EC---SG---IRIEVTDRFTNN 76

>Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to
          Ashbya gossypii ACR014C
          Length = 70

 Score = 62.0 bits (149), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 47/74 (63%), Gaps = 6/74 (8%)

Query: 1  MAPPTPVLAREEL-PEIPQSKNCVLKSLTQFQCQLRPAGSGLYECVPFKRLFQECRDPSG 59
          MAPPTP++ R+E+ P + ++K+C+L SL Q +C         Y C+PFKRLF+EC     
Sbjct: 1  MAPPTPIITRDEVEPILSRTKDCILASLIQNECHFDGHN---YVCIPFKRLFEEC--TLN 55

Query: 60 RFKSRIEVTSPLTN 73
          + + RIEVT   TN
Sbjct: 56 KRRVRIEVTDISTN 69

>KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON}
          similar to uniprot|Q05676 Saccharomyces cerevisiae
          YEL059C-A SOM1 Protein whose overexpression suppresses
          the imp1 mutation may be required for the function of
          the Imp1p mitochondrial inner membrane peptidase and/or
          the protein sorting machinery
          Length = 89

 Score = 58.5 bits (140), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 43/76 (56%), Gaps = 7/76 (9%)

Query: 1  MAPPTPVLAREELPEIPQSKN--CVLKSLTQFQCQLRPAGSGLYECVPFKRLFQECRDPS 58
          MAPPT V  +EEL  I +     C LK+L Q +C+        Y C PFKRLF+EC   +
Sbjct: 1  MAPPTLVFGKEELKGIWEKAAEPCFLKALVQNECEF---NGHEYVCTPFKRLFKEC--GA 55

Query: 59 GRFKSRIEVTSPLTNH 74
          G+   RIEVT   TNH
Sbjct: 56 GKRIVRIEVTDQDTNH 71

>Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON}
          YEL059C-A (REAL)
          Length = 73

 Score = 55.5 bits (132), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 42/77 (54%), Gaps = 8/77 (10%)

Query: 1  MAPPTPVLAREE----LPEIPQSKNCVLKSLTQFQCQLRPAGSGLYECVPFKRLFQECRD 56
          MAPPT + AR++    L  +    +C LK L Q++CQ + A    Y C PF+RLF+ C  
Sbjct: 1  MAPPTTIRARDQALAPLATLDSRTHCHLKELVQWECQFKGAD---YVCSPFRRLFEHCTA 57

Query: 57 PSGRFKSRIEVTSPLTN 73
          P G   +  EVT   TN
Sbjct: 58 P-GEAATNYEVTDTYTN 73

>Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A
          (SOM1) - involved in mitochondrial inner peptidase
          function [contig 186] FULL
          Length = 91

 Score = 55.1 bits (131), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 42/75 (56%), Gaps = 7/75 (9%)

Query: 1  MAPPTPVLAREELPEIPQS--KNCVLKSLTQFQCQLRPAGSGLYECVPFKRLFQECRDPS 58
          MAPPT V  +EEL  + ++    C+ KSLTQ +C         Y CVPFKR+F+EC+   
Sbjct: 1  MAPPTVVFGKEELEPLLRNVMATCIFKSLTQSECNF---DGHQYVCVPFKRVFKECKVDG 57

Query: 59 GRFKSRIEVTSPLTN 73
               RIEVT   TN
Sbjct: 58 KSI--RIEVTDRNTN 70

>YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}
          SOM1Subunit of the mitochondrial inner membrane
          peptidase, which is required for maturation of
          mitochondrial proteins of the intermembrane space;
          Som1p facilitates cleavage of a subset of substrates;
          contains twin cysteine-x9-cysteine motifs
          Length = 74

 Score = 53.5 bits (127), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 41/77 (53%), Gaps = 8/77 (10%)

Query: 1  MAPPTPVLAREE----LPEIPQSKNCVLKSLTQFQCQLRPAGSGLYECVPFKRLFQECRD 56
          MAPPT +  R++    L  +    NC LK L Q++CQ + A    Y C PFKRLF+ C  
Sbjct: 1  MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAE---YVCSPFKRLFEHCIA 57

Query: 57 PSGRFKSRIEVTSPLTN 73
          P  +  +  EVT   TN
Sbjct: 58 P-DKSATNYEVTDTYTN 73

>Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score = 53.1 bits (126), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 41/77 (53%), Gaps = 8/77 (10%)

Query: 1  MAPPTPVLAREE----LPEIPQSKNCVLKSLTQFQCQLRPAGSGLYECVPFKRLFQECRD 56
          MAPPT + +R++    L  +     C LK L Q++CQ R A    Y C PFKRLF+ C  
Sbjct: 1  MAPPTTIRSRDQALAPLAALDSHTRCQLKELVQWECQFREAD---YVCFPFKRLFERCIA 57

Query: 57 PSGRFKSRIEVTSPLTN 73
          P  +  +  EVT   TN
Sbjct: 58 P-DKSATDYEVTDTYTN 73

>SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A SOM1
          Protein whose overexpression suppresses the imp1
          mutation may be required for the function of the Imp1p
          mitochondrial inner membrane peptidase and/or the
          protein sorting machinery
          Length = 97

 Score = 53.5 bits (127), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 42/81 (51%), Gaps = 11/81 (13%)

Query: 1  MAPPTPVLAREELPEIPQSKN--CVLKSLTQFQCQLRPAGSGLYECVPFKRLFQEC---- 54
          MAPPTPV  ++EL  + +     C LKSL Q +C         Y CVPFKRLF+EC    
Sbjct: 1  MAPPTPVFGKDELESLLKKVKPPCTLKSLIQNECTFNGEE---YICVPFKRLFKECLLDS 57

Query: 55 --RDPSGRFKSRIEVTSPLTN 73
            +D       RIE+T   TN
Sbjct: 58 KTKDGRTSRTVRIEITDRHTN 78

>KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 71

 Score = 52.4 bits (124), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 40/70 (57%), Gaps = 4/70 (5%)

Query: 1  MAPPTPVLAREELP-EIPQSKNCVLKSLTQFQCQLRPAGSGLYECVPFKRLFQECRDPSG 59
          MAP   V+  +    E+  ++ C L SL Q+ C+ R  G+   EC PFKR+F EC D SG
Sbjct: 1  MAPMIRVMDGDAAEREVKGAEGCQLYSLVQYNCEYRVGGT--LECFPFKRMFLECLDKSG 58

Query: 60 RFKSRIEVTS 69
          + K R+E  S
Sbjct: 59 KLK-RVETRS 67

>Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score = 52.4 bits (124), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 43/77 (55%), Gaps = 8/77 (10%)

Query: 1  MAPPTPVLAREE----LPEIPQSKNCVLKSLTQFQCQLRPAGSGLYECVPFKRLFQECRD 56
          MAPPT + +R++    L  +    +C LK L Q++CQ + A    Y C PFKRLF+ C +
Sbjct: 1  MAPPTTIRSRDQALAPLMALDSQASCQLKELVQWECQFKGAD---YVCSPFKRLFEHCVE 57

Query: 57 PSGRFKSRIEVTSPLTN 73
            G+  +  EVT   TN
Sbjct: 58 -HGKPATNYEVTDTYTN 73

>KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON}
          uniprot|P78699 Kluyveromyces lactis KLLA0D00880g SOM1
          Protein SOM1 mitochondrial precursor
          Length = 71

 Score = 52.4 bits (124), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 41/75 (54%), Gaps = 5/75 (6%)

Query: 1  MAPPTPVLAREELPEIPQ-SKNCVLKSLTQFQCQLRPAGSGLYECVPFKRLFQECRDPSG 59
          MAPPT +L  +    + Q  +NC LKSL Q +C         Y C PFKRLF++C    G
Sbjct: 1  MAPPTKILGLDTQQRMLQRGENCSLKSLVQNECAFNGND---YVCTPFKRLFEQCMVKDG 57

Query: 60 RFKSRIEVTSPLTNH 74
          R  + IEVT+  TN 
Sbjct: 58 RVLN-IEVTNLNTNR 71

>TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 51.6 bits (122), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 36/64 (56%), Gaps = 6/64 (9%)

Query: 1  MAPPTPVLAREELPEIPQS------KNCVLKSLTQFQCQLRPAGSGLYECVPFKRLFQEC 54
          MAP TPV+ RE +    Q+      + C LK+LTQ++CQ     S  Y C PFKRLF+ C
Sbjct: 1  MAPATPVVDREAVAATLQASKQRNRQECELKALTQYECQFVDLESNRYICRPFKRLFEVC 60

Query: 55 RDPS 58
             S
Sbjct: 61 AGTS 64

>ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A
          Length = 77

 Score = 51.2 bits (121), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 43/80 (53%), Gaps = 15/80 (18%)

Query: 1  MAPPTPVLAREELP------EIPQSKN-CVLKSLTQFQCQLRPAGSGLYECVPFKRLFQE 53
          MAPPTP+L  E++       +I + KN C LKSLTQ  C     G   Y CVPFKR+F++
Sbjct: 1  MAPPTPILTSEQVSRERERVQILKEKNKCELKSLTQHLCHAEAPGE--YICVPFKRVFEK 58

Query: 54 CRDPSGRFKSRIEVTSPLTN 73
          C          +EVT   TN
Sbjct: 59 C------LGHALEVTDADTN 72

>KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 109

 Score = 47.4 bits (111), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 40/69 (57%), Gaps = 5/69 (7%)

Query: 1  MAPPTPVLAREELPEIPQSKN-CVLKSLTQFQCQLRPAGSGLYECVPFKRLFQECRDPSG 59
          MAP   VL R ++P +PQ ++ CVLK L QF+C+        ++C PF+RLF++C    G
Sbjct: 1  MAPNVRVLTRNDVP-LPQPQDGCVLKELVQFRCE---NDGTQWQCAPFRRLFEQCPSQEG 56

Query: 60 RFKSRIEVT 68
            K +   T
Sbjct: 57 TNKGKCVAT 65

>NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 79

 Score = 45.8 bits (107), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 39/86 (45%), Gaps = 21/86 (24%)

Query: 1  MAPPTPVLAREEL-------------PEIPQSKNCVLKSLTQFQCQLRPAGSGLYECVPF 47
          MAPP  V  ++++              +      C    LTQFQCQL   G   Y C PF
Sbjct: 1  MAPPVVVFGKDDIRVKTALSNNRTGETDAETGDGCRQFQLTQFQCQLLEDGQ--YICFPF 58

Query: 48 KRLFQECRDPSGRFKSRIEVTSPLTN 73
          KR+FQEC+        R EVT+  +N
Sbjct: 59 KRVFQECQ------GVRTEVTNVDSN 78

>TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 36.6 bits (83), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 38/85 (44%), Gaps = 20/85 (23%)

Query: 1  MAPPTPVLAREELP------------EIPQSKNCVLKSLTQFQCQLRPAGSGLYECVPFK 48
          MAPP  +  +EEL             +  +S      S+TQ++C       G  EC PFK
Sbjct: 1  MAPPVTIQTKEELDILEKVNRKNRKDDTKKSAKPKKYSITQYEC--FDNDKGQIECFPFK 58

Query: 49 RLFQECRDPSGRFKSRIEVTSPLTN 73
          R+FQ+     G +  R E+T   TN
Sbjct: 59 RIFQQV----GEY--RREITDETTN 77

>TBLA0G01145 Chr7 (302341..304668) [2328 bp, 775 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 775

 Score = 31.6 bits (70), Expect = 0.11,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 20  KNCVLKSLTQFQCQLRPAGSGLYECVPF-KRLFQECRDPSGRFKSRIEVTS 69
           K+ +   +T++QCQ+   GSGL  C      L  ECRD + R K R E+T+
Sbjct: 627 KDSMYAEVTRYQCQICYEGSGLCICPHMITILLAECRDITHR-KLRQELTN 676

>Kthe_YGOB_EST3 Chr6 complement(1055444..1055740,1055742..1056026)
           [582 bp, 193 aa] {ON} ANNOTATED BY YGOB - Ribosomal
           frameshifting (Farabaugh, J Mol Evol 63:545, 2006).
           Replaces KLTH0F12606g.
          Length = 193

 Score = 26.9 bits (58), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 15/24 (62%)

Query: 31  QCQLRPAGSGLYECVPFKRLFQEC 54
           Q + RP+   LY+  PFK+LF E 
Sbjct: 170 QVEARPSFDYLYQLTPFKKLFCEV 193

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,989,834
Number of extensions: 262749
Number of successful extensions: 513
Number of sequences better than 10.0: 24
Number of HSP's gapped: 494
Number of HSP's successfully gapped: 24
Length of query: 74
Length of database: 53,481,399
Length adjustment: 46
Effective length of query: 28
Effective length of database: 48,206,763
Effective search space: 1349789364
Effective search space used: 1349789364
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)