Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G045806.13ON48448425830.0
SAKL0E00946g6.13ON49348322240.0
KLLA0D00902g6.13ON49249122010.0
Ecym_30166.13ON48947021970.0
Kwal_56.223626.13ON49347321960.0
KLTH0C11462g6.13ON49246021960.0
ACR013C6.13ON48847021520.0
CAGL0A01045g6.13ON48348221200.0
Kpol_1032.46.13ON46746021110.0
Kpol_1045.766.13ON48548520820.0
TPHA0J002706.13ON49646820810.0
ZYRO0C07964g6.13ON50546320720.0
NCAS0D026206.13ON49346320670.0
Smik_6.4706.13ON48846120580.0
YPL262W (FUM1)6.13ON48847620560.0
Skud_16.166.13ON48846120470.0
Suva_16.436.13ON48846120460.0
KNAG0E027506.13ON49848420450.0
KAFR0B065206.13ON49546820110.0
NDAI0I024706.13ON47547019400.0
TBLA0A071306.13ON50045919250.0
TBLA0G010006.13ON46545918890.0
SAKL0D09746g1.354ON4642751312e-07
CAGL0I08987g1.354ON4612751242e-06
Skud_8.701.354ON4632381232e-06
AEL019W1.354ON4692991222e-06
Suva_15.2011.354ON4632391204e-06
Smik_8.831.354ON4632381205e-06
KLLA0A08404g1.354ON4612451196e-06
KNAG0I015601.354ON4622431179e-06
NDAI0G059401.354ON4622431161e-05
Ecym_27491.354ON4702401142e-05
NCAS0A090101.354ON4622381142e-05
YHR018C (ARG4)1.354ON4632391133e-05
TDEL0D022201.354ON4652451081e-04
TBLA0F034801.354ON4662371072e-04
KAFR0A009501.354ON4642561062e-04
Kpol_1018.1251.354ON4602381026e-04
Suva_10.4594.197ON4821861027e-04
YLR359W (ADE13)4.197ON4821861027e-04
ZYRO0G00748g1.354ON4622441018e-04
Smik_12.4464.197ON4821861028e-04
CAGL0B02794g4.197ON4821921010.001
TPHA0B010404.197ON482192990.001
Ecym_24524.197ON482194980.002
TPHA0A021901.354ON463240970.003
Kwal_27.127821.354ON465269970.003
Kwal_47.180664.197ON482189960.003
Skud_12.4434.197ON482186950.005
KAFR0A062304.197ON482192950.006
KLTH0G19338g1.354ON465261930.007
NDAI0J019504.197ON482194930.008
NCAS0J012004.197ON482192930.008
TBLA0A083204.197ON482213920.010
KNAG0B058404.197ON482192910.015
SAKL0B04972g4.197ON482192910.015
ZYRO0B07964g4.197ON482186910.016
KLLA0B13189g4.197ON482186890.027
Kpol_1042.164.197ON482192890.027
KLTH0A03344g4.197ON482192840.11
ABL006C4.197ON482190810.26
KLLA0D15081g3.438ON1010116780.64
Suva_4.4946.148ON85092713.9
Kpol_1050.635.94ON1058150714.4
ZYRO0C12606g3.438ON113063705.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G04580
         (484 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {O...   999   0.0  
SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly s...   861   0.0  
KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly s...   852   0.0  
Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to ...   850   0.0  
Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W ...   850   0.0  
KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {...   850   0.0  
ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON} S...   833   0.0  
CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {...   821   0.0  
Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..516...   817   0.0  
Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa] ...   806   0.0  
TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13...   806   0.0  
ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {...   802   0.0  
NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {O...   800   0.0  
Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON...   797   0.0  
YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumaras...   796   0.0  
Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W (...   793   0.0  
Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W (...   792   0.0  
KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.1...   792   0.0  
KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6...   779   0.0  
NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {O...   751   0.0  
TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6...   746   0.0  
TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.1...   732   0.0  
SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {...    55   2e-07
CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {...    52   2e-06
Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}...    52   2e-06
AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic ho...    52   2e-06
Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {...    51   4e-06
Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}...    51   5e-06
KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {...    50   6e-06
KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.3...    50   9e-06
NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON} Anc_1...    49   1e-05
Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {O...    49   2e-05
NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa] ...    49   2e-05
YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}  ...    48   3e-05
TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.3...    46   1e-04
TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.3...    46   2e-04
KAFR0A00950 Chr1 (178176..179570) [1395 bp, 464 aa] {ON} Anc_1.3...    45   2e-04
Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]...    44   6e-04
Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359...    44   7e-04
YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}  ADE13Aden...    44   7e-04
ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly s...    44   8e-04
Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359...    44   8e-04
CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {...    44   0.001
TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {O...    43   0.001
Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar t...    42   0.002
TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.3...    42   0.003
Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]...    42   0.003
Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359...    42   0.003
Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359...    41   0.005
KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa] ...    41   0.006
KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]...    40   0.007
NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4....    40   0.008
NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4....    40   0.008
TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa] ...    40   0.010
KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON} Anc_4...    40   0.015
SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly...    40   0.015
ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {...    40   0.016
KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]...    39   0.027
Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON} (40749....    39   0.027
KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly...    37   0.11 
ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON} S...    36   0.26 
KLLA0D15081g Chr4 (1271696..1274728) [3033 bp, 1010 aa] {ON} som...    35   0.64 
Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W ...    32   3.9  
Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON} (138...    32   4.4  
ZYRO0C12606g Chr3 (995841..999233) [3393 bp, 1130 aa] {ON} simil...    32   5.3  

>TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {ON}
           Anc_6.13 YPL262W
          Length = 484

 Score =  999 bits (2583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/484 (100%), Positives = 484/484 (100%)

Query: 1   MLRTGLLSRPLSVVKMSTKAGQFRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRER 60
           MLRTGLLSRPLSVVKMSTKAGQFRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRER
Sbjct: 1   MLRTGLLSRPLSVVKMSTKAGQFRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRER 60

Query: 61  MPEPIVRAFGVLKKSAAVVNESLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSG 120
           MPEPIVRAFGVLKKSAAVVNESLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSG
Sbjct: 61  MPEPIVRAFGVLKKSAAVVNESLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSG 120

Query: 121 TQSNMNANEVISNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHL 180
           TQSNMNANEVISNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHL
Sbjct: 121 TQSNMNANEVISNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHL 180

Query: 181 LPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLH 240
           LPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLH
Sbjct: 181 LPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLH 240

Query: 241 RLKYLAQGGTAVGTGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGA 300
           RLKYLAQGGTAVGTGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGA
Sbjct: 241 RLKYLAQGGTAVGTGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGA 300

Query: 301 LNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQV 360
           LNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQV
Sbjct: 301 LNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQV 360

Query: 361 MGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGK 420
           MGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGK
Sbjct: 361 MGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGK 420

Query: 421 LMHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMI 480
           LMHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMI
Sbjct: 421 LMHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMI 480

Query: 481 GPKP 484
           GPKP
Sbjct: 481 GPKP 484

>SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 493

 Score =  861 bits (2224), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/483 (85%), Positives = 441/483 (91%), Gaps = 2/483 (0%)

Query: 3   RTGLLSRPLSVVKMSTKAGQ--FRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRER 60
           R  L S  + ++  S+   Q  +R+ETDAFGEIKV AD+YWGAQTQRS ENF+IGG RER
Sbjct: 10  RNLLPSSSIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARER 69

Query: 61  MPEPIVRAFGVLKKSAAVVNESLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSG 120
           MPE +VRAFGVLKKSAA+VNESLGTLDP++++PI++AADEV QGKL  HFPLVVFQTGSG
Sbjct: 70  MPEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSG 129

Query: 121 TQSNMNANEVISNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHL 180
           TQSNMNANEVISNRAIE+IGGE GSKQ+HPNNHCNQAQSSNDTFPSVMHIAAVTEIT  L
Sbjct: 130 TQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSL 189

Query: 181 LPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLH 240
           LPEL  LRDS   KS EFS IVKIGRTHLQDATPLTLGQEFSGYVQQ++NGI RVE SLH
Sbjct: 190 LPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLH 249

Query: 241 RLKYLAQGGTAVGTGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGA 300
            LK+LAQGGTAVGTGLNTK+GFAEKIAEQVSKETG+DFKTAPNKFEALAAHDAVVE SGA
Sbjct: 250 HLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGA 309

Query: 301 LNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQV 360
           LNT+ACSLFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVCVQV
Sbjct: 310 LNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQV 369

Query: 361 MGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGK 420
           MGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGI AN DRI K
Sbjct: 370 MGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISK 429

Query: 421 LMHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMI 480
           L+HESLMLVTALNPKIGYDAASKVAKNAHKKGITLK+SAL LGVL E EFDEWV+PE MI
Sbjct: 430 LLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMI 489

Query: 481 GPK 483
           GPK
Sbjct: 490 GPK 492

>KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 492

 Score =  852 bits (2201), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/491 (83%), Positives = 446/491 (90%), Gaps = 8/491 (1%)

Query: 1   MLRTGLLSRPLSVVKMSTKAGQ--------FRVETDAFGEIKVAADRYWGAQTQRSLENF 52
           MLR  ++SR L+  ++S K  +        +RVETDAFGEI+V +D+YWGAQTQRSL+NF
Sbjct: 1   MLRNSIVSRGLAQTRVSAKVNRLASLRMVSYRVETDAFGEIQVPSDKYWGAQTQRSLQNF 60

Query: 53  RIGGPRERMPEPIVRAFGVLKKSAAVVNESLGTLDPKVAEPIKQAADEVAQGKLTAHFPL 112
           +IGGPRERMPEPIV+AFGVLKKSAAVVNE LGTLDP++A+PIKQAADEVAQGKL  HFPL
Sbjct: 61  KIGGPRERMPEPIVKAFGVLKKSAAVVNERLGTLDPEIAKPIKQAADEVAQGKLMEHFPL 120

Query: 113 VVFQTGSGTQSNMNANEVISNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAA 172
           VVFQTGSGTQSNMNANEVISNRAIELIGGELGSK+IHPNNHCNQAQSSNDTFPSVMHIAA
Sbjct: 121 VVFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAA 180

Query: 173 VTEITRHLLPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGI 232
           VTEIT HLLPEL  L+ +L  KS EF  IVKIGRTHLQDATPLTLGQEFSGYVQQV NGI
Sbjct: 181 VTEITHHLLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGI 240

Query: 233 DRVEGSLHRLKYLAQGGTAVGTGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAHD 292
            RV+ SL+ LK+LAQGGTAVGTGLNTK+GFAE IAEQVSKETG+DFKTAPNKFEALAAHD
Sbjct: 241 ARVKQSLYHLKFLAQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAHD 300

Query: 293 AVVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA 352
           AVVEASGALNT+A SLFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA
Sbjct: 301 AVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA 360

Query: 353 LTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGII 412
           +TQVCVQVMGN+AAITFAGASGQFELNVFKPVMISNLLSS+RLL DAS SFR+HCV+GI 
Sbjct: 361 MTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDASNSFRIHCVEGIK 420

Query: 413 ANRDRIGKLMHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKQSALDLGVLTESEFDE 472
           AN DRI KL+HESLMLVTALNPKIGYDAASKVAKNAHKKGITLK+SAL+L VL+  EFD+
Sbjct: 421 ANEDRIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLSSEEFDQ 480

Query: 473 WVVPENMIGPK 483
           WV+PE MIGPK
Sbjct: 481 WVIPEKMIGPK 491

>Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to
           Ashbya gossypii ACR013C
          Length = 489

 Score =  850 bits (2197), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/470 (85%), Positives = 436/470 (92%), Gaps = 3/470 (0%)

Query: 16  MSTKAG---QFRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVL 72
           MST AG   +FR+ETDAFGEIKV A++YWGAQTQRSLENF+IGGPRERMPEPI++AFG+L
Sbjct: 18  MSTTAGLNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPEPIIKAFGIL 77

Query: 73  KKSAAVVNESLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVIS 132
           KKSAA+VNESLGTLDPK+++PI+QAADEV +GKL  HFPLVVFQTGSGTQSNMNANEVIS
Sbjct: 78  KKSAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQSNMNANEVIS 137

Query: 133 NRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLD 192
           NRAIELIGGELG+KQIHPNNHCNQAQSSNDTFPSVMHIAAVTEIT  LLPEL  LRDS  
Sbjct: 138 NRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTALRDSFQ 197

Query: 193 AKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAV 252
            K++EFS IVKIGRTHLQDATPLTLGQEF GY QQ++NGI RVE SLH LK+LAQGGTAV
Sbjct: 198 KKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLAQGGTAV 257

Query: 253 GTGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKIA 312
           GTGLNTK+GFAEKIAEQVSKET ++FKTAPNKFEALAAHDAVVE SGALNTVACSLFKIA
Sbjct: 258 GTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVACSLFKIA 317

Query: 313 QDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGA 372
            DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQ CVQVMGNN+ ITFAGA
Sbjct: 318 NDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGNNSTITFAGA 377

Query: 373 SGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTAL 432
           SGQFELNVFKPVMISNLL+S+RLLADASYSFRVHCVDGI AN D+I K++HESLMLVTAL
Sbjct: 378 SGQFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKILHESLMLVTAL 437

Query: 433 NPKIGYDAASKVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGP 482
           NPKIGYD+A KVAKNAHKK ITLK+SAL+LGVL+E EF EWVVPE MIGP
Sbjct: 438 NPKIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIGP 487

>Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W
           (FUM1) - mitochondrial and cytoplasmic fumarase
           (fumarate hydralase) [contig 186] FULL
          Length = 493

 Score =  850 bits (2196), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/473 (85%), Positives = 438/473 (92%), Gaps = 1/473 (0%)

Query: 13  VVKMSTKAGQ-FRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGV 71
           ++  S+  GQ +RVETDAFGEIKV  D+ WGAQTQRSLENF+IGG RERMPEPIV+AFG+
Sbjct: 21  LISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGI 80

Query: 72  LKKSAAVVNESLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVI 131
           LKKSAA+VNESLGTLDPKV++PI+ AADEV  GKL  HFPLVVFQTGSGTQSNMNANEVI
Sbjct: 81  LKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVI 140

Query: 132 SNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSL 191
           SNRAI+L+GGE+GSK IHPNNHCNQAQSSNDTFPSVMHIAAVTE+T  LLPEL  LRD+ 
Sbjct: 141 SNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAF 200

Query: 192 DAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTA 251
             K++EF  IVKIGRTHLQDATPLTLGQEFSGYVQQ++NGI RVE SLH LK+LAQGGTA
Sbjct: 201 AKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTA 260

Query: 252 VGTGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKI 311
           VGTGLNTK+GFAEKIAEQVSKETG+DFKTAPNKFEALAAHDAVVE SGALNT+ACSLFKI
Sbjct: 261 VGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKI 320

Query: 312 AQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAG 371
           A DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAAITFAG
Sbjct: 321 ANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAG 380

Query: 372 ASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTA 431
           ASGQFELNVFKPVMISNLLSS+RLL DA YSFRVHCV+GI AN D+I KL+HESLMLVTA
Sbjct: 381 ASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVTA 440

Query: 432 LNPKIGYDAASKVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGPKP 484
           LNPKIGYDAASKVAKNAHKKGITLK+SAL+LGVL+ +EFDEWVVPENM+GPKP
Sbjct: 441 LNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGPKP 493

>KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 492

 Score =  850 bits (2196), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/460 (87%), Positives = 430/460 (93%)

Query: 24  RVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVLKKSAAVVNESL 83
           RVETDAFGEI V AD+YWGAQTQRSLENF+IGG RERMPEP+VRAFG+LKKSAA+VNESL
Sbjct: 33  RVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMPEPVVRAFGILKKSAAIVNESL 92

Query: 84  GTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGEL 143
           GTLDPK+++PI+QAADEV  GKL  HFPLVVFQTGSGTQSNMNANEVISNRAIE++GG++
Sbjct: 93  GTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNANEVISNRAIEIVGGKM 152

Query: 144 GSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDAKSKEFSDIVK 203
           G+K IHPNNHCNQAQSSNDTFPSVMHIAAVTEIT  LLPEL  LRDS   KSKEF  IVK
Sbjct: 153 GTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFATKSKEFESIVK 212

Query: 204 IGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVGTGLNTKIGFA 263
           IGRTHLQDATPLTLGQEFSGYVQQ++NGI RVE SL  LK+LAQGGTAVGTGLNTK+GF 
Sbjct: 213 IGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLAQGGTAVGTGLNTKVGFG 272

Query: 264 EKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSGPR 323
           EKIAEQVSKETG+DFKTAPNKFEALAAHDA+VE SGALNT+ACSLFKIA DIRYLGSGPR
Sbjct: 273 EKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPR 332

Query: 324 CGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGASGQFELNVFKP 383
           CGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAAITFAGASGQFELNVFKP
Sbjct: 333 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKP 392

Query: 384 VMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTALNPKIGYDAASK 443
           VMISNLLSSVRLL DA YSFRVHCVDGI ANRD+I KL+HESLMLVTALNPKIGYDAASK
Sbjct: 393 VMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHESLMLVTALNPKIGYDAASK 452

Query: 444 VAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGPK 483
           VAKNAHKKGITLK+SAL+L VLT +EFD+WVVPENM+GPK
Sbjct: 453 VAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGPK 492

>ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL262W
           (FUM1)
          Length = 488

 Score =  833 bits (2152), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/470 (85%), Positives = 431/470 (91%), Gaps = 2/470 (0%)

Query: 16  MSTKAG--QFRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVLK 73
           MST     QFRVETDAFGEI+V AD+YWGAQTQRSLENFRIGG RERMPEP+VRAFGVLK
Sbjct: 18  MSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFGVLK 77

Query: 74  KSAAVVNESLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISN 133
           KSAAVVNE LGTL+P +A+ I+QAADEVAQG+L  HFPLVVFQTGSGTQSNMNANEVISN
Sbjct: 78  KSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISN 137

Query: 134 RAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDA 193
           RAIEL+GGELGSKQ+HPNNHCNQAQSSNDTFPSVMHIAAVTEITR LLPEL  LR S   
Sbjct: 138 RAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSFQR 197

Query: 194 KSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVG 253
           K+ EF+ IVKIGRTHLQDATPLTLGQEFSGY QQ++NGI RVE +   L++LAQGGTAVG
Sbjct: 198 KTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVG 257

Query: 254 TGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKIAQ 313
           TGLNT+ GFAE+IA QVS+ETGL+F+TAPNKFEALAAHDAVVEASGALNT+ACSLFKIA 
Sbjct: 258 TGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIAN 317

Query: 314 DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGAS 373
           DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQ CVQVMGNNAAITFAGAS
Sbjct: 318 DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFAGAS 377

Query: 374 GQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTALN 433
           GQFELNVFKPVMI+NLLSSVRLLADA+ SFRVHCVDGI  N DRI KL+HESLMLVTALN
Sbjct: 378 GQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVTALN 437

Query: 434 PKIGYDAASKVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGPK 483
           PKIGYDAAS VAKNAHKKGITL+ SAL+LGVLT++EFDEWVVPE MIGP+
Sbjct: 438 PKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPR 487

>CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262w FUM1 fumarate hydratase
          Length = 483

 Score =  821 bits (2120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/482 (81%), Positives = 433/482 (89%), Gaps = 1/482 (0%)

Query: 1   MLRTGLLSRPLSVVKMSTKAGQFRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRER 60
           MLR    ++  S++  S +   +RVETD FGEIKV AD+YWGAQTQRS +NF+IGG RER
Sbjct: 1   MLRASSRAK-TSLIGYSARMMHYRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARER 59

Query: 61  MPEPIVRAFGVLKKSAAVVNESLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSG 120
           MPEPIVRAFGVLKKSAA+VNE LGTLD ++A PI+QAADEVA+GKL  HFPLVVFQTGSG
Sbjct: 60  MPEPIVRAFGVLKKSAAIVNEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSG 119

Query: 121 TQSNMNANEVISNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHL 180
           TQSNMNANEVISNRAIELIGGELGSK+IHPNNHCNQAQSSNDTFPSVMHIAAVTEIT  L
Sbjct: 120 TQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSL 179

Query: 181 LPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLH 240
           LPE+  L+D+L  K++EF DIVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+E +L 
Sbjct: 180 LPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLP 239

Query: 241 RLKYLAQGGTAVGTGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGA 300
            LKYLAQGGTAVGTGLNTK GF + IAEQ+SKETG+DFKTAPNKFEALAAHDA+VEASGA
Sbjct: 240 HLKYLAQGGTAVGTGLNTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGA 299

Query: 301 LNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQV 360
           LNTVACSLFKIAQDIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEA+TQVCVQV
Sbjct: 300 LNTVACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQV 359

Query: 361 MGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGK 420
           MGNNAA+TFAGA+GQFELNVFKPVMISNLLSS+RLLADA +SFRVHCV+GI ANR++I  
Sbjct: 360 MGNNAAVTFAGANGQFELNVFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINH 419

Query: 421 LMHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMI 480
            +H SLMLVTALNPKIGYDAASK+AKNA KK ITLK+SAL+L  LT  EFDEWV+PENM+
Sbjct: 420 NLHNSLMLVTALNPKIGYDAASKIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMV 479

Query: 481 GP 482
           GP
Sbjct: 480 GP 481

>Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..5164)
           [1404 nt, 468 aa]
          Length = 467

 Score =  817 bits (2111), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/460 (83%), Positives = 425/460 (92%)

Query: 23  FRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVLKKSAAVVNES 82
           FR+ETD FGEIKV AD+YWGAQTQRS ENF+IGGPRERMPEP+V+AFGVLKKSAA+VNE 
Sbjct: 7   FRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEE 66

Query: 83  LGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 142
            G LD  +++ I+QAADEV +GKL  HFPLVVFQTGSGTQSNMNANEVISNRAIEL GG 
Sbjct: 67  FGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGI 126

Query: 143 LGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDAKSKEFSDIV 202
           +GSK+IHPNNHCN AQSSNDTFP+VMHIAAVTEIT HL+P++  L+D+L  KSKEF  IV
Sbjct: 127 MGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIV 186

Query: 203 KIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVGTGLNTKIGF 262
           KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+E SL  LK+LAQGGTAVGTGLNTKIGF
Sbjct: 187 KIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGF 246

Query: 263 AEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSGP 322
           AE+IAEQVSKETG++FKTAPNKFEALAAHDA+VE+SGALNTVACSLFKIAQDIRYLGSGP
Sbjct: 247 AERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGP 306

Query: 323 RCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGASGQFELNVFK 382
           RCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAAITFAGASGQFELNVFK
Sbjct: 307 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 366

Query: 383 PVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTALNPKIGYDAAS 442
           PVMISNLLSS+RLL DA +SF +HCV+GI AN D+I KL+HESLMLVTALNPKIGYD+A+
Sbjct: 367 PVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSAT 426

Query: 443 KVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGP 482
           KVAKNAHKKGITLK+SAL+LGVLTE EFDEWVVPE M+GP
Sbjct: 427 KVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466

>Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa]
           {ON} complement(177449..178906) [1458 nt, 486 aa]
          Length = 485

 Score =  806 bits (2082), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/485 (80%), Positives = 432/485 (89%), Gaps = 5/485 (1%)

Query: 1   MLRTGLLSRPLSV---VKMSTKAGQFRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGP 57
           MLR+ +  RP +V    +  +    FRVETD FGEIKV A++YWGAQT+RS ENF+IGG 
Sbjct: 1   MLRSAI--RPNTVRVQTRYISNLKGFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGS 58

Query: 58  RERMPEPIVRAFGVLKKSAAVVNESLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQT 117
           RERMPE +VRAFGVLKK AA+VN  LG LDP  ++ I+QAADEVA GKL  HFPLVVFQT
Sbjct: 59  RERMPEAVVRAFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQT 118

Query: 118 GSGTQSNMNANEVISNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEIT 177
           GSGTQSNMNANEVISNRAIEL GG LGSK+IHPNNHCN AQSSNDTFP+VMHIAAVT+I+
Sbjct: 119 GSGTQSNMNANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQIS 178

Query: 178 RHLLPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEG 237
           +HLLPEL HLRD+L AKS EF  IVKIGRTHLQDATPLTLGQEFSGYVQQ++NGI+R+E 
Sbjct: 179 QHLLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIER 238

Query: 238 SLHRLKYLAQGGTAVGTGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEA 297
           +   L++LAQGGTAVGTGLNTK G+AE+IA ++SKETGL FKTAPNKFEALAAHDA+VEA
Sbjct: 239 AQQNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEA 298

Query: 298 SGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVC 357
           SGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVC
Sbjct: 299 SGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVC 358

Query: 358 VQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIIANRDR 417
           VQVMGNNAA+TFAGASGQFELNVFKPV+ISNLLSSV+LL DAS SFRVHCV+GI AN  +
Sbjct: 359 VQVMGNNAAVTFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAK 418

Query: 418 IGKLMHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPE 477
           I +L+H SLMLVTALNPKIGYDAA+KVAKNAHKKGITLK+SAL+LGVLTE EFDEWVVPE
Sbjct: 419 ISELLHRSLMLVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPE 478

Query: 478 NMIGP 482
            M+GP
Sbjct: 479 KMLGP 483

>TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13
           YPL262W
          Length = 496

 Score =  806 bits (2081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/468 (80%), Positives = 429/468 (91%), Gaps = 1/468 (0%)

Query: 16  MSTKAGQFRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVLKKS 75
           +S +AG FR+ETD FGEIKV A++YWGAQT+RS ENFRIGGPRERMP+P+V+AFGVLKKS
Sbjct: 30  LSDEAG-FRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVLKKS 88

Query: 76  AAVVNESLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISNRA 135
           AA+VNE  GTLDP++++ I++AADEV QGKL  HFPLVVFQTGSGTQSNMNANEVISNRA
Sbjct: 89  AAIVNEGYGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRA 148

Query: 136 IELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDAKS 195
           IEL+GG LGSKQ+HPNNH NQAQSSND+FP+VMHIAAVTEIT HL+PE+A+LRD+L++KS
Sbjct: 149 IELLGGTLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKS 208

Query: 196 KEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVGTG 255
           K+F+ IVKIGRTHLQDATPLTLGQEFSGYVQQ++NGI R+E SL  LK+LAQGGTAVGTG
Sbjct: 209 KDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTG 268

Query: 256 LNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKIAQDI 315
           LNT+IGFAEKIAEQ+SKETG+ FKTAPNKFEALAAHDA+VEASGA+ TVA SLFKIAQDI
Sbjct: 269 LNTRIGFAEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDI 328

Query: 316 RYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGASGQ 375
           RYLGSGPRCGYGELSLPENEPGSSIMPGK+NPTQNEA+TQVC Q++GNN  I FAG  GQ
Sbjct: 329 RYLGSGPRCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQGQ 388

Query: 376 FELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTALNPK 435
           FELNVFKPVMISNLLSS+RLL D S SFR+HCV+GI AN +RI  LM++SLMLVTALNPK
Sbjct: 389 FELNVFKPVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLVTALNPK 448

Query: 436 IGYDAASKVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGPK 483
           IGYD A+KVAKNAHKKGITLK+SA+ LG LTESEFDEWVVPE MIGPK
Sbjct: 449 IGYDEATKVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGPK 496

>ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 505

 Score =  802 bits (2072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/463 (82%), Positives = 418/463 (90%)

Query: 22  QFRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVLKKSAAVVNE 81
           + RVETDAFGEIKV AD+YWGAQTQRS ENFRIGG RERMPE +V AFG+LKK+ A VNE
Sbjct: 43  EHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNE 102

Query: 82  SLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISNRAIELIGG 141
           + G LDPK+A  IKQAADEVA GKL  HFPLVVFQTGSGTQSNMNANEVISNRAIEL+GG
Sbjct: 103 ANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGG 162

Query: 142 ELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDAKSKEFSDI 201
           +LGSK +HPNNH N +QSSNDTFP+VMHIAAV  IT+ LLP L  L+DSL  KS+EF+DI
Sbjct: 163 KLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADI 222

Query: 202 VKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVGTGLNTKIG 261
           VKIGRTHLQDATPLTLGQEFSGYVQQV+NGI RVE +L  LK LAQGGTAVGTGLNTKIG
Sbjct: 223 VKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIG 282

Query: 262 FAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSG 321
           +AE +A +V+KETG+DF+TAPNKFEALAAHDAVVEASGALNT+A SLFKIAQDIRYLGSG
Sbjct: 283 WAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSG 342

Query: 322 PRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGASGQFELNVF 381
           PRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQV GN++AITFAGASGQFELNVF
Sbjct: 343 PRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVF 402

Query: 382 KPVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTALNPKIGYDAA 441
           KPVMISNLLSS+ LL+DASYSFRVHCVDGI ANR+ I KL+HESLMLVTALNPKIGYDAA
Sbjct: 403 KPVMISNLLSSINLLSDASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAA 462

Query: 442 SKVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGPKP 484
           SKVAKNAHK GITLK+SAL L +LT  EFD WVVPE+MIGPKP
Sbjct: 463 SKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGPKP 505

>NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {ON}
           Anc_6.13 YPL262W
          Length = 493

 Score =  800 bits (2067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/463 (79%), Positives = 423/463 (91%)

Query: 22  QFRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVLKKSAAVVNE 81
           Q+R+ETD+FGEIKV AD+YWGAQTQRS +NF+IGG RER+P+PI+ AFG+LKKSAA+VNE
Sbjct: 31  QYRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERIPDPIITAFGILKKSAAIVNE 90

Query: 82  SLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISNRAIELIGG 141
           SLGTLDPKVA+PIK+AADEV QGKL  HFPLVVFQTGSGTQ+NMN NEVISNRAIEL+GG
Sbjct: 91  SLGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGTQTNMNVNEVISNRAIELVGG 150

Query: 142 ELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDAKSKEFSDI 201
           +LGSKQIHPNNHCNQ+QSSNDTFPSVMHIAAV EIT  L+PEL  L+D+LD K+KEF+DI
Sbjct: 151 KLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDVKAKEFADI 210

Query: 202 VKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVGTGLNTKIG 261
           VKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+E SL+ LK+LAQGGTAVGTGLNTKIG
Sbjct: 211 VKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVGTGLNTKIG 270

Query: 262 FAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSG 321
           F + IAE+VSKETG++FKTAPNKFEALAAHDA+V ASGALNTVA SLFKIAQDIRYLGSG
Sbjct: 271 FDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTVAGSLFKIAQDIRYLGSG 330

Query: 322 PRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGASGQFELNVF 381
           PRCGYGEL LPENEPGSSIMPGKVNPTQNEA+TQVCVQ+MGNN  I+ AG+ GQFELNV+
Sbjct: 331 PRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIMGNNQTISIAGSQGQFELNVY 390

Query: 382 KPVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTALNPKIGYDAA 441
           KP+MI+NLL+S+RL+ DA  SFR+HC+D + AN+D+I + +++SLMLVTALNPKIGYDAA
Sbjct: 391 KPLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNKSLMLVTALNPKIGYDAA 450

Query: 442 SKVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGPKP 484
           SK+AKNAH K ITLK+SAL+L  LT  EFDEWVVPENMIGPKP
Sbjct: 451 SKIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIGPKP 493

>Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON}
           YPL262W (REAL)
          Length = 488

 Score =  797 bits (2058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/461 (81%), Positives = 420/461 (91%)

Query: 23  FRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVLKKSAAVVNES 82
           FR ETDAFGEI V AD+YWGAQTQRS +NF+IGG RERMP P+V AFGVLKKSAA+VNES
Sbjct: 28  FRTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNES 87

Query: 83  LGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 142
           LG LDPK+++ I++AADEVA GKL  HFPLVVFQTGSGTQSNMNANEVISNRAIE++GG+
Sbjct: 88  LGGLDPKISKAIQEAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGK 147

Query: 143 LGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDAKSKEFSDIV 202
           +GSK++HPNNHCNQ+QSSNDTFP+VMHIAA  +I   L+PELA+L+++L+AKSKEF  IV
Sbjct: 148 IGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELANLKNALEAKSKEFDHIV 207

Query: 203 KIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVGTGLNTKIGF 262
           KIGRTHLQDATPLTLGQEFSGYVQQV NGI RV  SL  L +LAQGGTAVGTGLNTK GF
Sbjct: 208 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGF 267

Query: 263 AEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSGP 322
             KIAEQ+SKETGL F+TAPNKFEALAAHDA+VE SGALNT+ACSLFKIAQDIRYLGSGP
Sbjct: 268 DVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGP 327

Query: 323 RCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGASGQFELNVFK 382
           RCGY EL LPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAG+ GQFELNVFK
Sbjct: 328 RCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFK 387

Query: 383 PVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTALNPKIGYDAAS 442
           PVMI+NLL+S+RL+ DA+YSFRVHCV+GI AN  RI +L+ +SLMLVTALNPKIGYDAAS
Sbjct: 388 PVMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAAS 447

Query: 443 KVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGPK 483
           KVAKNAHKKGITLK+SAL+LGVLTE EFDEWVVPENM+GPK
Sbjct: 448 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488

>YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumarase,
           converts fumaric acid to L-malic acid in the TCA cycle;
           cytosolic and mitochondrial distribution determined by
           the N-terminal targeting sequence, protein conformation,
           and status of glyoxylate shunt; phosphorylated in
           mitochondria
          Length = 488

 Score =  796 bits (2056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/476 (79%), Positives = 427/476 (89%), Gaps = 3/476 (0%)

Query: 8   SRPLSVVKMSTKAGQFRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVR 67
           S  L++ +M++    FR ETDAFGEI V AD+YWGAQTQRS +NF+IGG RERMP P+V 
Sbjct: 16  SYKLNIRRMNSS---FRTETDAFGEIHVPADKYWGAQTQRSFQNFKIGGARERMPLPLVH 72

Query: 68  AFGVLKKSAAVVNESLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNA 127
           AFGVLKKSAA+VNESLG LDPK+++ I+QAADEVA GKL  HFPLVVFQTGSGTQSNMNA
Sbjct: 73  AFGVLKKSAAIVNESLGGLDPKISKAIQQAADEVASGKLDDHFPLVVFQTGSGTQSNMNA 132

Query: 128 NEVISNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHL 187
           NEVISNRAIE++GG++GSKQ+HPNNHCNQ+QSSNDTFP+VMHIAA  +I   L+PEL +L
Sbjct: 133 NEVISNRAIEILGGKIGSKQVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNL 192

Query: 188 RDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQ 247
           +++L+AKSKEF  IVKIGRTHLQDATPLTLGQEFSGYVQQV NGI RV  SL  L +LAQ
Sbjct: 193 KNALEAKSKEFDHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQ 252

Query: 248 GGTAVGTGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACS 307
           GGTAVGTGLNTK GF  KIAEQ+SKETGL F+TAPNKFEALAAHDA+VE SGALNT+ACS
Sbjct: 253 GGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACS 312

Query: 308 LFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAI 367
           LFKIAQDIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAI
Sbjct: 313 LFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAI 372

Query: 368 TFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLM 427
           TFAG+ GQFELNVFKPVMI+NLL+S+RL+ DA+YSFRVHCV+GI AN  RI +L+ +SLM
Sbjct: 373 TFAGSQGQFELNVFKPVMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLM 432

Query: 428 LVTALNPKIGYDAASKVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGPK 483
           LVTALNPKIGYDAASKVAKNAHKKGITLK+SAL+LGVLTE EFDEWVVPE+M+GPK
Sbjct: 433 LVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEHMLGPK 488

>Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/461 (81%), Positives = 418/461 (90%)

Query: 23  FRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVLKKSAAVVNES 82
           FR+ETDAFGEI V AD+YWGAQTQRS +NF+IGG RERMP P+V AFGVLKKSAAVVNES
Sbjct: 28  FRIETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAVVNES 87

Query: 83  LGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 142
           LG LDPK+++ I+QAADEV  GKL  HFPLVVFQTGSGTQSNMNANEVISNRAIE++GG+
Sbjct: 88  LGGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGK 147

Query: 143 LGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDAKSKEFSDIV 202
           +GSK++HPNNHCNQ+QSSNDTFP+VMHIAA  +I   L+PEL +L+++L+AKSKEF  IV
Sbjct: 148 IGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFEHIV 207

Query: 203 KIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVGTGLNTKIGF 262
           KIGRTHLQDATPLTLGQEFSGYVQQV NGI RV  SL  L +LAQGGTAVGTGLNTK GF
Sbjct: 208 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGF 267

Query: 263 AEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSGP 322
             KIAEQ+S ETGL F+TAPNKFEALAAHDA+VE SGALNT+ACSLFKIAQDIRYLGSGP
Sbjct: 268 DIKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGP 327

Query: 323 RCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGASGQFELNVFK 382
           RCGY EL LPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAG+ GQFELNVFK
Sbjct: 328 RCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFK 387

Query: 383 PVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTALNPKIGYDAAS 442
           PVMI+NLL+S+RL+ D++YSFRVHCV+GI AN  RI +L+ +SLMLVTALNPKIGYDAAS
Sbjct: 388 PVMIANLLNSIRLITDSAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAAS 447

Query: 443 KVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGPK 483
           KVAKNAHKKGITLK+SAL+LGVLTE EFDEWVVPENM+GPK
Sbjct: 448 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488

>Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  792 bits (2046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/461 (81%), Positives = 418/461 (90%)

Query: 23  FRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVLKKSAAVVNES 82
           FR ETDAFGEI V AD+YWGAQTQRS +NF+IGG RERMP P+V AFGVLKKSAA+VNES
Sbjct: 28  FRTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNES 87

Query: 83  LGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 142
           LG LDPKV++ I+QAADEVA GKL  HFPLVVFQTGSGTQSNMNANEVISNRAIE++GG+
Sbjct: 88  LGGLDPKVSKAIQQAADEVAAGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGK 147

Query: 143 LGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDAKSKEFSDIV 202
           +GSKQ+HPNN CNQ+QSSNDTFP+VMHIAA  +I + L+PEL +L+++L+AKSKEF  IV
Sbjct: 148 IGSKQVHPNNDCNQSQSSNDTFPTVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIV 207

Query: 203 KIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVGTGLNTKIGF 262
           KIGRTHLQDATPLTLGQEFSGYVQQV NGI RV  +L  L +LAQGGTAVGTGLNTK GF
Sbjct: 208 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGF 267

Query: 263 AEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSGP 322
             KIAEQ+SKETGL F+TAPNKFEALAAHDA+VE SGALNT+ACSLFKIAQDIRYLGSGP
Sbjct: 268 DVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGP 327

Query: 323 RCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGASGQFELNVFK 382
           RCGY EL LPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITF G+ GQFELNVFK
Sbjct: 328 RCGYNELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFGGSQGQFELNVFK 387

Query: 383 PVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTALNPKIGYDAAS 442
           PVMI+NLL+S+RL+ADAS SFR+HCV+GI AN  RI +L+ +SLMLVTALNPKIGYDAAS
Sbjct: 388 PVMIANLLNSIRLIADASRSFRIHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAAS 447

Query: 443 KVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGPK 483
           KVAKNAHKKGITLK+SAL+LGVLTE EFDEWVVPENM+GPK
Sbjct: 448 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488

>KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.13
           YPL262W
          Length = 498

 Score =  792 bits (2045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/484 (77%), Positives = 430/484 (88%), Gaps = 3/484 (0%)

Query: 1   MLRTGLLSRPLSVVKMSTKAGQFRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRER 60
           +LR  L  R +S   ++ +  +FRVETD+FGEI V ADRYWGAQTQRS +NF+IGG RE+
Sbjct: 18  LLRNNL-RRNMSASAITNQ--EFRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREK 74

Query: 61  MPEPIVRAFGVLKKSAAVVNESLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSG 120
           +PEP+VRAFG+LKKSAA VNE+LGTLD  +A  IK AADEVA+GKL+ HFPLVVFQTGSG
Sbjct: 75  IPEPVVRAFGILKKSAATVNENLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSG 134

Query: 121 TQSNMNANEVISNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHL 180
           TQSNMNANEVISNRAIEL+GGELGSKQ+HPNNH NQ+QSSNDTFP+VMHIAA TEI   L
Sbjct: 135 TQSNMNANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKL 194

Query: 181 LPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLH 240
           +PEL +L+D+L  K +EFS IVKIGRTHLQDATPLTLGQEFSGYVQQV NGI RV+ SL+
Sbjct: 195 IPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLY 254

Query: 241 RLKYLAQGGTAVGTGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGA 300
            L +LAQGGTAVGTGLNTK+GF + +AE+VSKETGL F+TAPNKFEALAAHDA+VEASGA
Sbjct: 255 HLHFLAQGGTAVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGA 314

Query: 301 LNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQV 360
           LNT+ACSLFKIAQDIRYLGSGPRCGYGEL LP NEPGSSIMPGKVNPTQNEA+TQVCVQV
Sbjct: 315 LNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQV 374

Query: 361 MGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGK 420
           MGNN+ ITFAG+ GQFELNV+KP+MISNLLSS+RLL DAS SFR+HC++ + AN+D+I +
Sbjct: 375 MGNNSTITFAGSQGQFELNVYKPLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDE 434

Query: 421 LMHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMI 480
            +++SLMLVTALNPKIGYDAA+KVAKNAH K ITLK+SAL+LGVLTE EFDEWV+PENMI
Sbjct: 435 NLNKSLMLVTALNPKIGYDAAAKVAKNAHHKNITLKESALELGVLTEKEFDEWVIPENMI 494

Query: 481 GPKP 484
            PKP
Sbjct: 495 SPKP 498

>KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6.13
           YPL262W
          Length = 495

 Score =  779 bits (2011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/468 (77%), Positives = 421/468 (89%)

Query: 16  MSTKAGQFRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVLKKS 75
           MS+    FR ETD+FGEI V  D+YWGAQTQRSL+NF+IGG RE++P PI+ AFG+LKKS
Sbjct: 27  MSSIKSSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPIIEAFGILKKS 86

Query: 76  AAVVNESLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISNRA 135
           AA+VNE LGTLD ++A+ I  AADEV+QGKL  HFPLVVFQTGSGTQSNMNANEVISNRA
Sbjct: 87  AAIVNERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRA 146

Query: 136 IELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDAKS 195
           IEL+GG+LGSK +HPNNH NQ+QSSNDTFP+VMHIAA+ EITR LLPEL  L++SLD KS
Sbjct: 147 IELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKKS 206

Query: 196 KEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVGTG 255
            EF+DIVKIGRTHLQDATPLTLGQEFSGYVQQ++NGI R+E +L+ LK+LAQGGTAVGTG
Sbjct: 207 NEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGTG 266

Query: 256 LNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKIAQDI 315
           LNTK GF + IAEQ+S+ETG++F+TAPNKFEALAAHDA+VE SGALNT+ACSLFKIAQDI
Sbjct: 267 LNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQDI 326

Query: 316 RYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGASGQ 375
           RYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVC+QVMGN++ ITFAG+ GQ
Sbjct: 327 RYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHSTITFAGSQGQ 386

Query: 376 FELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTALNPK 435
           FELNV+KP++ISNLLSS+RLL DASYSFRVHC+DG+ ANR+ I + +++SLMLVTALNP 
Sbjct: 387 FELNVYKPLLISNLLSSIRLLTDASYSFRVHCIDGLKANRENITENLNKSLMLVTALNPY 446

Query: 436 IGYDAASKVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGPK 483
           IGYD ASK+AKNAH K ITLK+SAL+LG+LTE +F EWV+PE MIGPK
Sbjct: 447 IGYDNASKIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGPK 494

>NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {ON}
           Anc_6.13 YPL262W
          Length = 475

 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/470 (74%), Positives = 422/470 (89%)

Query: 15  KMSTKAGQFRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVLKK 74
           K  +    FRVETD+FGEIKV +++YWGAQTQRS +NF+IGG RE++P PI++AFG+LKK
Sbjct: 6   KTPSNESSFRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKK 65

Query: 75  SAAVVNESLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISNR 134
           SAA+VN+SLGTLDP +A PI +A+DEV QGKL  HFPLVVFQTGSGTQ+NMNANEVISNR
Sbjct: 66  SAAIVNQSLGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNR 125

Query: 135 AIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDAK 194
           A ELIG ELGSK+IHPNNH NQ+QSSNDTFPSVMHIAAV E+  +L+P+L  L++SLD K
Sbjct: 126 ANELIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNK 185

Query: 195 SKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVGT 254
           +KE+++IVKIGRTHLQDATPLTLGQEFSGYVQQ++NGI+R++ SL+ LK+LAQGGTAVGT
Sbjct: 186 AKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGT 245

Query: 255 GLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKIAQD 314
           GLNTK+GF + IA++VSKETG+DF+TAPNKFEALAAHDA+V AS A+ TVA SLFKIAQD
Sbjct: 246 GLNTKVGFDKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQD 305

Query: 315 IRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGASG 374
           IRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEA+TQV +Q+MGNN  I  AG+ G
Sbjct: 306 IRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQG 365

Query: 375 QFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTALNP 434
           QFELNV+KP+MI+NLL+S+RL++DA +SF++HCVDG+ AN D+I + +H+SLMLVTALNP
Sbjct: 366 QFELNVYKPLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNP 425

Query: 435 KIGYDAASKVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGPKP 484
           KIGYDAASK+AKNAH K ITLK+SAL+LG+LTE EFD+WV+PENMIGPKP
Sbjct: 426 KIGYDAASKLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPKP 475

>TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6.13
           YPL262W
          Length = 500

 Score =  746 bits (1925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/459 (74%), Positives = 401/459 (87%)

Query: 24  RVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVLKKSAAVVNESL 83
           R ETD+FGEI+V A++YWGAQTQRS  NF+IGG RERMPEPI+RAFG  KK+AA+VN SL
Sbjct: 41  RTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAAIVNNSL 100

Query: 84  GTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGEL 143
           GTLD  + + I QAA+EV+QG L  HFPLVVFQTGSGTQSNMNANEVISNRAIEL+GG L
Sbjct: 101 GTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGTL 160

Query: 144 GSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDAKSKEFSDIVK 203
           GSKQ+HPNNH NQ+QSSNDTFP+VMHIAA+TEIT  LLP L  LR++LD+K+KEF  I+K
Sbjct: 161 GSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEFEKIIK 220

Query: 204 IGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVGTGLNTKIGFA 263
           IGRTHLQDATPLTLGQEFSGY QQ++N I R+E +L  L+Y+AQGGTAVGTGLNTKIGFA
Sbjct: 221 IGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNTKIGFA 280

Query: 264 EKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSGPR 323
           E+ A Q+S +T L F T+PNKFE+LAAHDA+V    +LNT+ACSLFKI+QDIRYL SGPR
Sbjct: 281 EQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPR 340

Query: 324 CGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGASGQFELNVFKP 383
           CGYGELS+PENEPGSSIMPGKVNPTQNEA+ Q CVQVMGNN+ I+FAGASGQFELN +KP
Sbjct: 341 CGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKP 400

Query: 384 VMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTALNPKIGYDAASK 443
           +MI+NLLSS RLL+DA +SF +HC  GI AN+D+I +L+HESLMLVT+LNPKIGYDAASK
Sbjct: 401 LMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGYDAASK 460

Query: 444 VAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGP 482
           VAKNAH KGITLKQSAL+L +L+  +FDEWV PENM+GP
Sbjct: 461 VAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGP 499

>TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.13
           YPL262W
          Length = 465

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/459 (72%), Positives = 403/459 (87%)

Query: 24  RVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVLKKSAAVVNESL 83
           R+E D FGE++V A++YWGAQTQR+L NF IGG RERMPEP++ A+G+LKKS A+VNESL
Sbjct: 5   RIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNESL 64

Query: 84  GTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGEL 143
           GTLDPK+++ I++AADEVA+G L  HFPLVVFQTGSGTQ+NMN NEVISNRAIE++GG+L
Sbjct: 65  GTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQL 124

Query: 144 GSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDAKSKEFSDIVK 203
           GSK +HPNNH NQ+QS+ND+FP+ MHI+AV E+   LLPEL  LRD+L  KS EF+ IVK
Sbjct: 125 GSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVK 184

Query: 204 IGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVGTGLNTKIGFA 263
           IGRTHLQDATPLTLGQEFSGYVQQV NGI RV+ SL  LK++AQGGTAVGTG+NTK  F 
Sbjct: 185 IGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFD 244

Query: 264 EKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSGPR 323
             +A+Q+S ETG++FKTAPNKFEALA+HDA+VE SGALNT+ACSLFKI+QDIR+LGSGPR
Sbjct: 245 ILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPR 304

Query: 324 CGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGASGQFELNVFKP 383
           CGYGELSLPENEPGSSIMPGKVNPTQNEA+ Q C+QVMGNN+AITFAGASGQFELN +KP
Sbjct: 305 CGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYKP 364

Query: 384 VMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTALNPKIGYDAASK 443
           +MISNLL+S+RLL D+  SFR+HC+ GI AN D+I KL++ESLMLVTALNPKIGYDAA+ 
Sbjct: 365 LMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATA 424

Query: 444 VAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGP 482
           +AK+AHK G+TLK++AL   +LT  +FDEW+VPE+M+ P
Sbjct: 425 IAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHP 463

>SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 464

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 71/275 (25%), Positives = 106/275 (38%), Gaps = 30/275 (10%)

Query: 89  KVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGELGSKQI 148
           KV   ++Q   E A G+   H            +    ANE    R  E+IG E+  K  
Sbjct: 63  KVHHGLEQIEKEWAAGEFARH---------PSDEDIHTANE---RRLGEIIGREISGK-- 108

Query: 149 HPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDAKSKEFSDIVKIGRTH 208
                 +  +S ND   + M I     +   LLP L      L  ++KE  D++  G TH
Sbjct: 109 -----VHTGRSRNDQVATDMRIYCRDILNEVLLPALQAFIKVLTTRAKEEIDVLMPGYTH 163

Query: 209 LQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVGTGLNTKIGFAEKIAE 268
           LQ A P+      S Y    +   +R++  + RL     G  A+        G    I  
Sbjct: 164 LQRAQPIRWSHWLSSYATYFTEDYNRLKQIVERLNKSPLGAGALA-------GHPYGIDR 216

Query: 269 QVSKETGLDFK-TAPNKFEALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSGPRCGYG 327
           +     GL F+    N   A++  D VVE           + + ++D+  + S    G+ 
Sbjct: 217 EFLAR-GLGFQGVIGNSLTAVSDRDFVVEIMFWGTLFMNHISRFSEDL-IIYSTAEFGFI 274

Query: 328 ELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMG 362
           +LS      GSS+MP K NP   E L     +V G
Sbjct: 275 KLS-DAYSTGSSLMPQKKNPDSLELLRGKAGRVFG 308

>CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018c ARLY
          Length = 461

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 67/275 (24%), Positives = 106/275 (38%), Gaps = 30/275 (10%)

Query: 89  KVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGELGSKQI 148
           K+   +K   +E  +GK   H            +S+ + +     R  ELIG ++  K  
Sbjct: 63  KIHSGLKDIENEWDEGKFVRH------------ESDEDIHTANERRLGELIGRDIAGK-- 108

Query: 149 HPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDAKSKEFSDIVKIGRTH 208
                 +  +S ND   + M I     +   + P +  L + L  ++++  DI+  G TH
Sbjct: 109 -----VHTGRSRNDQVVTDMRIYCREILNEKIFPAMKSLINVLVNRAEKEIDILMPGYTH 163

Query: 209 LQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVGTGLNTKIGFAEKIAE 268
           LQ A P+      S Y    +  + R+E    RL     G  A+        G    I  
Sbjct: 164 LQRAQPIRWAHWLSSYATYFTEDLKRLEQIAERLNKSPLGSGALA-------GHPYGIDR 216

Query: 269 QVSKETGLDFK-TAPNKFEALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSGPRCGYG 327
           Q   E GL F     N   A++  D VVE           + + ++D+  + S    G+ 
Sbjct: 217 QFLAE-GLGFNGVIGNSLVAVSDRDFVVELMFWATLFMNHVSRFSEDL-IIYSTAEFGFI 274

Query: 328 ELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMG 362
           +LS      GSS+MP K N    E L     +V G
Sbjct: 275 KLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 308

>Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 96/238 (40%), Gaps = 21/238 (8%)

Query: 127 ANEVISNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAH 186
           ANE    R  E+IG ++  K        +  +S ND   + + I     +  +L P L  
Sbjct: 91  ANE---RRLGEIIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNDNLFPALKG 140

Query: 187 LRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLA 246
           L D L  ++K   +I+  G THLQ A P+      S Y    +    R++  LHRL    
Sbjct: 141 LVDVLIKRAKGEINILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLDQILHRLNQSP 200

Query: 247 QGGTAVGTGLNTKIGFAEKIAEQVSKETGLDFKTA-PNKFEALAAHDAVVEASGALNTVA 305
            G  A+        G    I  +   E GL F +   N   A++  D +VE         
Sbjct: 201 LGAGALA-------GHPYGIDREFLAE-GLGFNSVIGNSMVAVSDRDFIVELMFWGTLFM 252

Query: 306 CSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGN 363
             + + A+D+  +      G+ +LS      GSS+MP K N    E L     +V G+
Sbjct: 253 NHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR018C (ARG4)
          Length = 469

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 71/299 (23%), Positives = 115/299 (38%), Gaps = 38/299 (12%)

Query: 72  LKKSAAVVNESLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVI 131
           L+K+  +  + L +    + E +KQ   E  QG    H            +    ANE  
Sbjct: 49  LQKTGLLTKDELES----IHEGLKQVEQEWEQGVFVKHVD---------DEDIHTANE-- 93

Query: 132 SNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSL 191
             R  E+IG  +  K        +  +S ND   + M +     +   + P L  L   L
Sbjct: 94  -RRLGEIIGRHISGK-------VHTGRSRNDQVATDMRLYCREMLQDKVEPALFELIKVL 145

Query: 192 DAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTA 251
             +++E  D++  G THLQ A P+      S Y         R++  + RL     G  A
Sbjct: 146 LHRAREEIDVLMPGYTHLQRAQPIRWSHWLSCYATYFVEDFKRLKEVIARLNQSPLGAGA 205

Query: 252 VG---TGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSL 308
           +     G++          E ++ E G D     N   A++  D VVE     +     +
Sbjct: 206 LAGHPYGIDR---------EYLACELGFD-GVIGNSMTAVSDRDFVVEIMSWGSLFMNHI 255

Query: 309 FKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAI 367
            ++A+D+  + S    G+ +L+      GSS+MP K NP   E L     +V G  A  
Sbjct: 256 SRLAEDL-IIYSTAEFGFVKLA-DAYSTGSSLMPQKRNPDSLELLRGKSGRVFGQLAGF 312

>Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 63/239 (26%), Positives = 94/239 (39%), Gaps = 21/239 (8%)

Query: 126 NANEVISNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELA 185
            ANE    R  ELIG ++  K        +  +S ND   + + I     +   L P + 
Sbjct: 90  TANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNDSLFPAMK 139

Query: 186 HLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYL 245
            L D L  +++   DI+  G THLQ A P+      S Y    +    R+   LHRL   
Sbjct: 140 GLVDVLVKRAEGEMDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLVQILHRLNQS 199

Query: 246 AQGGTAVGTGLNTKIGFAEKIAEQVSKETGLDFKTA-PNKFEALAAHDAVVEASGALNTV 304
             G  A+        G    I  +   E GL F +   N   A++  D +VE        
Sbjct: 200 PLGAGALA-------GHPYGIDREFLAE-GLGFNSVIGNSLVAVSDRDFIVELMFWGTLF 251

Query: 305 ACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGN 363
              + + A+D+  +      G+ +LS      GSS+MP K N    E L     +V G+
Sbjct: 252 MNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 94/238 (39%), Gaps = 21/238 (8%)

Query: 127 ANEVISNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAH 186
           ANE    R  ELIG ++  K        +  +S ND   + + I     +   L P L  
Sbjct: 91  ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNGTLFPALKG 140

Query: 187 LRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLA 246
           L D L  +++   DI+  G THLQ A P+      S Y    +    R+   LHRL    
Sbjct: 141 LVDVLIKRAEGEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLNQSP 200

Query: 247 QGGTAVGTGLNTKIGFAEKIAEQVSKETGLDFKTA-PNKFEALAAHDAVVEASGALNTVA 305
            G  A+        G    I  +   E GL F +   N   A++  D +VE         
Sbjct: 201 LGAGALA-------GHPYGIDREFLAE-GLGFNSVIGNSLVAVSDRDFIVELMFWGTLFM 252

Query: 306 CSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGN 363
             + + A+D+  +      G+ +LS      GSS+MP K N    E L     +V G+
Sbjct: 253 NHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 461

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 99/245 (40%), Gaps = 27/245 (11%)

Query: 127 ANEVISNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAH 186
           ANE    R  E+IG  +  K        +  +S ND   + M I     +   +LP L+ 
Sbjct: 90  ANE---RRLGEIIGRGIAGK-------VHTGRSRNDQVATDMRIYCRDILNGTVLPALSS 139

Query: 187 LRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLA 246
           L   +  +++E  D++  G THLQ A P+      S Y    +    R++  + RL    
Sbjct: 140 LIKVILQRAEEEIDVLMPGYTHLQRAQPIRWAHWLSCYATYFTEDYKRLQQIVERLNVSP 199

Query: 247 QGGTAVG---TGLNTKIGFAEKIAEQVSKETGLDFK-TAPNKFEALAAHDAVVEASGALN 302
            G  A+     G++ +   A           GL+F     N   A+A  D VVE     +
Sbjct: 200 LGAGALAGHPYGIDREFLAA-----------GLNFNGVIGNSLTAVADRDFVVEIMFWGS 248

Query: 303 TVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMG 362
                + + A+D+  + S    G+ +LS      GSS+MP K NP   E L     +V G
Sbjct: 249 LFMNHISRFAEDL-IIYSTAEFGFIQLS-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFG 306

Query: 363 NNAAI 367
             A  
Sbjct: 307 QLAGF 311

>KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.354
           YHR018C
          Length = 462

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 65/243 (26%), Positives = 95/243 (39%), Gaps = 21/243 (8%)

Query: 126 NANEVISNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELA 185
            ANE    R  E+IG  +  K        +  +S ND   + M I     +   LLP +A
Sbjct: 90  TANE---RRLGEIIGRHIAGK-------VHTGRSRNDQVVTDMRIYCRDILNEKLLPFMA 139

Query: 186 HLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYL 245
            L   L  +++   D +  G THLQ A P+      S Y    +    R++  L RL   
Sbjct: 140 DLIKVLVKRAENEIDTLMPGYTHLQRAQPIRWAHWLSSYATYFTEDYKRLKQILERLNVS 199

Query: 246 AQGGTAVGTGLNTKIGFAEKIAEQVSKETGLDF-KTAPNKFEALAAHDAVVEASGALNTV 304
             G  A+        G    I  +   E GL+F     N   A++  D VVE        
Sbjct: 200 PLGAGALA-------GHPYGIDREFLAE-GLNFGGVIGNSLVAVSDRDFVVELMFWGTLF 251

Query: 305 ACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNN 364
              + + A+D+  + S    G+ +LS      GSS+MP K N    E L     +V G+ 
Sbjct: 252 MNHISRFAEDL-IIYSTAEFGFVKLS-DSYSTGSSLMPQKKNADSLELLRGKSGRVFGDL 309

Query: 365 AAI 367
           A  
Sbjct: 310 AGF 312

>NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON}
           Anc_1.354 YHR018C
          Length = 462

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 96/243 (39%), Gaps = 21/243 (8%)

Query: 126 NANEVISNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELA 185
            ANE    R  E+IG ++  K        +  +S ND   + + I     +   L P + 
Sbjct: 90  TANE---RRLGEIIGRDIAGK-------VHTGRSRNDQCVTDLRIYCRDVLNEKLFPGMT 139

Query: 186 HLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYL 245
            L + L  +++E  DI+  G THLQ A P+      S Y    +  + R++  L R    
Sbjct: 140 SLIEVLIKRAEEEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLKQILERFNKS 199

Query: 246 AQGGTAVGTGLNTKIGFAEKIAEQVSKETGLDFK-TAPNKFEALAAHDAVVEASGALNTV 304
             G  A+        G    I  +   E GL F     N   A++  D VVE        
Sbjct: 200 PLGAGALA-------GHPYGIDREFLAE-GLGFDGVIGNSLVAVSDRDFVVELMFWGTLF 251

Query: 305 ACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNN 364
              + + A+D+  + S    G+ +LS      GSS+MP K N    E L     +V G+ 
Sbjct: 252 MNHISRFAEDL-VIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDL 309

Query: 365 AAI 367
           A  
Sbjct: 310 AGF 312

>Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {ON}
           similar to Ashbya gossypii AEL019W
          Length = 470

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 99/240 (41%), Gaps = 27/240 (11%)

Query: 127 ANEVISNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAH 186
           ANE    R  ELIG  +  K        +  +S ND   + M I     +   +LP ++ 
Sbjct: 91  ANE---RRLGELIGTAVAGK-------VHTGRSRNDQVATDMRIYCREILNEKILPAVSS 140

Query: 187 LRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLA 246
               L  +++E  D++  G THLQ A P+      S Y    +   +R+   + RL    
Sbjct: 141 FIRVLINRAREEVDVLMPGYTHLQRAQPIRWSHWLSCYATYFTEDYNRLRQVVERLNQSP 200

Query: 247 QGGTAVG---TGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNT 303
            G  A+     G++ K      +AEQ+    G +     N   A++  D V+E     + 
Sbjct: 201 LGAGALAGHPYGIDRKY-----LAEQL----GFN-GIIGNSLVAVSDRDFVIEIMFWGSL 250

Query: 304 VACSLFKIAQDIRYLGSGPRCGYGELSLPE-NEPGSSIMPGKVNPTQNEALTQVCVQVMG 362
               + + A+D+    +     +G ++L +    GSS+MP K NP   E L     +V G
Sbjct: 251 FMNHISRFAEDLIIYSTAE---FGFINLADAYSTGSSLMPQKKNPDSLELLRGKSGRVFG 307

>NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa]
           {ON} Anc_1.354 YHR018C
          Length = 462

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 95/238 (39%), Gaps = 21/238 (8%)

Query: 127 ANEVISNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAH 186
           ANE    R  E+IG ++  K        +  +S ND   + + I     +   L P L  
Sbjct: 91  ANE---RRLGEIIGRDIAGK-------VHTGRSRNDQCVTDLRIYCRDVLNEKLFPALTS 140

Query: 187 LRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLA 246
           L   L  + +E  DI+  G THLQ A P+      S Y    +  ++R++  L R     
Sbjct: 141 LIQVLIKRGEEEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLNRLKQILVRFNKSP 200

Query: 247 QGGTAVGTGLNTKIGFAEKIAEQVSKETGLDFK-TAPNKFEALAAHDAVVEASGALNTVA 305
            G  A+        G    I  +   E GL+F     N   A++  D VVE         
Sbjct: 201 LGAGALA-------GHPYGIDREFLAE-GLEFNGVIGNSLVAVSDRDFVVELMFWSTLFM 252

Query: 306 CSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGN 363
             + + A+D+  + S    G+ +L+      GSS+MP K N    E L     +V G+
Sbjct: 253 NHISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}
           ARG4Argininosuccinate lyase, catalyzes the final step in
           the arginine biosynthesis pathway
          Length = 463

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 94/239 (39%), Gaps = 21/239 (8%)

Query: 126 NANEVISNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELA 185
            ANE    R  ELIG ++  K        +  +S ND   + + I     +   L P L 
Sbjct: 90  TANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDIVNDTLFPALK 139

Query: 186 HLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYL 245
            L + L  +++   D++  G THLQ A P+      S Y    +    R+   LHRL   
Sbjct: 140 GLVEVLIKRAEGEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLNQS 199

Query: 246 AQGGTAVGTGLNTKIGFAEKIAEQVSKETGLDFKTA-PNKFEALAAHDAVVEASGALNTV 304
             G  A+        G    I  +   E GL F +   N   A++  D +VE        
Sbjct: 200 PLGAGALA-------GHPYGIDREFLAE-GLGFNSVIGNSLVAVSDRDFIVELMFWGTLF 251

Query: 305 ACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGN 363
              + + A+D+  +      G+ +LS      GSS+MP K N    E L     +V G+
Sbjct: 252 MNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.354
           YHR018C
          Length = 465

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 60/245 (24%), Positives = 95/245 (38%), Gaps = 27/245 (11%)

Query: 127 ANEVISNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAH 186
           ANE    R  E+IG  +  K        +  +S ND   + + I     +   L P+L  
Sbjct: 91  ANE---RRLGEIIGRNIAGK-------VHTGRSRNDQCVTDLRIYCRDLLNDKLFPDLQA 140

Query: 187 LRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLA 246
           L D +  + KE  D++  G THLQ A P+      S Y    +    R+   + R+    
Sbjct: 141 LVDVMIKRGKEEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDFKRLRQIMDRINQSP 200

Query: 247 QGGTAVG---TGLNTKIGFAEKIAEQVSKETGLDFK-TAPNKFEALAAHDAVVEASGALN 302
            G  A+     G++ +   A           GL F     N   A++  D +VE      
Sbjct: 201 LGAGALAGHPYGIDREFLAA-----------GLGFDGVIGNSLVAVSDRDFIVELMFWGT 249

Query: 303 TVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMG 362
                + + A+D+  + S    G+ +L+      GSS+MP K N    E L     +V G
Sbjct: 250 LFMNHISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 307

Query: 363 NNAAI 367
           + A  
Sbjct: 308 DLAGF 312

>TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.354
           YHR018C
          Length = 466

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 93/237 (39%), Gaps = 21/237 (8%)

Query: 127 ANEVISNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAH 186
           ANE    R  E+IG  +  K        +  +S ND   + + I     +   LLP +  
Sbjct: 91  ANE---RRLGEIIGTHIAGK-------VHTGRSRNDQCVTDLRIYCRDILVEKLLPFMID 140

Query: 187 LRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLA 246
           L   +  +++   DI+  G THLQ A P+      S Y    +    R++  L RL    
Sbjct: 141 LVQVITKRAENEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQVLERLNKCP 200

Query: 247 QGGTAVGTGLNTKIGFAEKIAEQ-VSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVA 305
            G  A+        G    I  Q +S E G +     N   A++  D +V+         
Sbjct: 201 LGAGAIA-------GHPYGIDRQYLSDELGFN-SIIGNSLVAVSDRDFIVDIMFWSTLFM 252

Query: 306 CSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMG 362
             + + ++D+  + S    G+ +LS      GSS+MP K N    E L     +V G
Sbjct: 253 NHISRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 307

>KAFR0A00950 Chr1 (178176..179570) [1395 bp, 464 aa] {ON} Anc_1.354
           YHR018C
          Length = 464

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 64/256 (25%), Positives = 103/256 (40%), Gaps = 27/256 (10%)

Query: 127 ANEVISNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAH 186
           ANE    R  E+IG  +  K        +  +S ND   + M I     +T +LL  L  
Sbjct: 92  ANE---RRLGEIIGTGIAGK-------VHTGRSRNDQVATDMRIYCRDILTNNLLTYLKE 141

Query: 187 LRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLA 246
           L   +  ++ E  DI+  G THLQ A P+      S Y    +    R++  L RL    
Sbjct: 142 LISVICRRANEEMDILMPGYTHLQRAQPIRWSHWLSFYATYFTEDYKRLQEILARLNVSP 201

Query: 247 QGGTAVG---TGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNT 303
            G  A+     G++          E ++++ G       N   A++  D VVE     + 
Sbjct: 202 LGAGALAGHPYGID---------REFLAQDLGFS-GVIGNSLVAVSDRDFVVEIMFWGSL 251

Query: 304 VACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGN 363
               + + ++D+  + S    G+ +LS      GSS+MP K N    E L     +V G+
Sbjct: 252 FMNHISRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 309

Query: 364 NAA--ITFAGASGQFE 377
            A   +T  G    ++
Sbjct: 310 LAGFLMTLKGVPSTYD 325

>Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]
           {ON} complement(330965..332347) [1383 nt, 461 aa]
          Length = 460

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 90/238 (37%), Gaps = 21/238 (8%)

Query: 127 ANEVISNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAH 186
           ANE    R  ELIG ++  K        +  +S ND   + + I     I   LLP L  
Sbjct: 89  ANE---RRLGELIGTDISGK-------VHTGRSRNDQCVTDLRIYCRDIIQDKLLPSLKS 138

Query: 187 LRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLA 246
           L   L  + +    I+  G THLQ A P+      S Y    +    R++  L RL    
Sbjct: 139 LIQVLVKRGEGEIGILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQLLDRLNVSP 198

Query: 247 QGGTAVGTGLNTKIGFAEKIAEQVSKETGLDFK-TAPNKFEALAAHDAVVEASGALNTVA 305
            G  A+        G    I  +     GL F     N   A++  D VVE         
Sbjct: 199 LGAGALA-------GHPYGIDREFLA-NGLGFNGVIGNSLVAVSDRDFVVELLFWGTLFM 250

Query: 306 CSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGN 363
             + + A+D+  + S    G+  LS      GSS+MP K N    E L     +V GN
Sbjct: 251 NHISRFAEDL-IIYSTAEFGFITLS-DAYSTGSSLMPQKKNSDSLELLRGKSGRVFGN 306

>Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 87/186 (46%), Gaps = 19/186 (10%)

Query: 180 LLPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSL 239
           ++P+L ++ + L   + E+ D+  +G TH Q A   TLG+  + ++Q++   +   E + 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFERAR 187

Query: 240 HRLKYLAQGGT--------AVGTGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAH 291
           + +      GT        A+  G + K+   E + E+V++  G D K  P   +   + 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDERVTELLGFD-KVYPVTGQTY-SR 242

Query: 292 DAVVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 351
              ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243 KIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 352 ALTQVC 357
              +VC
Sbjct: 300 ---RVC 302

>YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}
           ADE13Adenylosuccinate lyase, catalyzes two steps in the
           'de novo' purine nucleotide biosynthetic pathway;
           expression is repressed by adenine and activated by
           Bas1p and Pho2p; mutations in human ortholog ADSL cause
           adenylosuccinase deficiency
          Length = 482

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 87/186 (46%), Gaps = 19/186 (10%)

Query: 180 LLPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSL 239
           ++P+L ++ + L   + E+ D+  +G TH Q A   TLG+  + ++Q++   +   E + 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 240 HRLKYLAQGGT--------AVGTGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAH 291
           + +      GT        A+  G + K+   E + E+V++  G D K  P   +   + 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDERVTELLGFD-KVYPVTGQTY-SR 242

Query: 292 DAVVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 351
              ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243 KIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 352 ALTQVC 357
              +VC
Sbjct: 300 ---RVC 302

>ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly
           similar to uniprot|P04076 Saccharomyces cerevisiae
           YHR018C ARG4 Argininosuccinate lyase catalyzes the final
           step in the arginine biosynthesis pathway
          Length = 462

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 59/244 (24%), Positives = 95/244 (38%), Gaps = 25/244 (10%)

Query: 127 ANEVISNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAH 186
           ANE    R  E+IG ++  K        +  +S ND   + M I     +   LLP L  
Sbjct: 91  ANE---RRLGEIIGRDIAGK-------VHTGRSRNDQVVTDMRIFCRDTVNEKLLPGLKE 140

Query: 187 LRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLA 246
           L   +  ++++    +  G THLQ A P+      S Y    +  + R+   L R     
Sbjct: 141 LVSVMVKRAEKEIGYLMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLRQLLERFNQSP 200

Query: 247 QGGTAVG---TGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNT 303
            G  A+     G++ +   AE++  Q             N   A++  D VVE       
Sbjct: 201 LGAGALAGHPYGIDREF-LAEELGFQ---------GVIGNSLVAVSDRDFVVELMFWGTL 250

Query: 304 VACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGN 363
               + + A+D+  + S    G+ +L+      GSS+MP K N    E L     +V G+
Sbjct: 251 FMNHISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

Query: 364 NAAI 367
            A  
Sbjct: 309 LAGF 312

>Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 86/186 (46%), Gaps = 19/186 (10%)

Query: 180 LLPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSL 239
           ++P+L ++ + L   + E+ D+  +G TH Q A   TLG+  + ++Q++   +   E + 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 240 HRLKYLAQGGT--------AVGTGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAH 291
           + +      GT        A+  G + K+   E + E+V++  G D K  P   +   + 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDERVTELLGFD-KVYPVTGQTY-SR 242

Query: 292 DAVVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 351
              ++    L++ A +  K+A DIR L +       E    + + GSS M  K NP + E
Sbjct: 243 KIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPMRCE 299

Query: 352 ALTQVC 357
              +VC
Sbjct: 300 ---RVC 302

>CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359w ADE13
          Length = 482

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 88/192 (45%), Gaps = 31/192 (16%)

Query: 180 LLPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSL 239
           ++P+L ++ + L   + E+ D+  +G TH Q A   TLG+  + ++Q++   +   E + 
Sbjct: 128 VIPKLVNVINRLAKFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 240 HRLKYLAQGGT--------AVGTGLNTKIGFAEKIAEQVSKETGLDF------KTAPNKF 285
           + +      GT        A+  G + K+   E++ E+V++  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EELDERVTELLGFDTVYPVTGQTYSRKI 244

Query: 286 EALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 345
           +        ++    L++ A S  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 346 NPTQNEALTQVC 357
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 86/192 (44%), Gaps = 31/192 (16%)

Query: 180 LLPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSL 239
           ++P+L ++ D L   + E+ D+  +G TH Q A   TLG+  + ++Q++   +     + 
Sbjct: 128 IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRSTLWIQELLWDLRNFVRAR 187

Query: 240 HRLKYLAQGGT--------AVGTGLNTKIGFAEKIAEQVSKETGLDF------KTAPNKF 285
           + L      GT        A+  G + K+   E++ E+V++  G D       +T   K 
Sbjct: 188 NDLGLRGVKGTTGTQASFLALFHGNHDKV---EELDERVTELLGFDTVYPVTGQTYSRKI 244

Query: 286 EALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 345
           +        ++    L + A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 346 NPTQNEALTQVC 357
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar to
           Ashbya gossypii ABL006C
          Length = 482

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 90/194 (46%), Gaps = 35/194 (18%)

Query: 180 LLPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSL 239
           L+P+L ++ + L   + ++ D+  +G TH Q A   TLG+  + ++Q++   +     + 
Sbjct: 128 LIPKLVNVINRLSTFAIKYKDLPVLGWTHYQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 240 HRLKYLAQGGT--------AVGTGLNTKIGFAEKIAEQVSKETGLDF------KTAPNKF 285
           + + +    GT        A+  G + K+   E + ++V++ +G D       +T   K 
Sbjct: 188 NDIGFRGVKGTTGTQASFLALFHGDHDKV---EALDKRVAELSGFDIIYPVTGQTYSRKV 244

Query: 286 EALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLP--ENEPGSSIMPG 343
           +        ++  G L++ A +  K+A DIR L +       EL  P   ++ GSS M  
Sbjct: 245 D--------IDVLGPLSSFAATSHKLATDIRLLAN-----LKELEEPFEASQIGSSAMAY 291

Query: 344 KVNPTQNEALTQVC 357
           K NP + E   +VC
Sbjct: 292 KRNPMRCE---RVC 302

>TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.354
           YHR018C
          Length = 463

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 62/240 (25%), Positives = 96/240 (40%), Gaps = 25/240 (10%)

Query: 127 ANEVISNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAH 186
           ANE    R  E+IG ++  K        +  +S ND   + + I     ++  LL  L  
Sbjct: 91  ANE---RRLGEIIGTKISGK-------VHTGRSRNDQCVTDLRIYCREYLSDKLLKNLET 140

Query: 187 LRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLA 246
           L + L  +++E  + +  G THLQ A P+      S Y         R+     RL    
Sbjct: 141 LINVLINRAEEEIEFIMPGYTHLQRAQPIRWSHWLSSYATYFLEDYKRLVQLKERLNKSP 200

Query: 247 QGGTAVG---TGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNT 303
            G  A+     G++      E +AE++    G D     N   A++  D VVE       
Sbjct: 201 LGAGALAGHPYGID-----REYLAEKL----GFD-SVIGNSLVAVSDRDFVVEILFWSTL 250

Query: 304 VACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGN 363
               + + A+D+  + S    G+ +LS      GSS+MP K N    E L     +V GN
Sbjct: 251 FMNHISRFAEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGN 308

>Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]
           {ON} YHR018C (ARG4) - argininosuccinate lyase [contig
           260] FULL
          Length = 465

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 65/269 (24%), Positives = 102/269 (37%), Gaps = 46/269 (17%)

Query: 115 FQTGSGTQSNMNANEVISNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVT 174
           F    G +    ANE    R  E+IG  +  K        +  +S ND   + M I    
Sbjct: 81  FVEKDGDEDIHTANE---RRLGEIIGRHIAGK-------VHTGRSRNDQVATDMRIYC-R 129

Query: 175 EITRHLLPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDR 234
           E   +L   L  L  ++  +S++  D +  G THLQ A P+      + Y    +    R
Sbjct: 130 EALDNLAKILEDLIGAILQRSEQEIDALMPGYTHLQRAQPIRWSHWLNLYATYFTEDFKR 189

Query: 235 VEGSLHRLKYLAQGGTAVG--------TGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFE 286
           ++    RL     G  A+           L  ++GF++ I                N  +
Sbjct: 190 LKQIRERLNVSPLGCGALAGHPYGIDREFLAERLGFSDVIG---------------NSLQ 234

Query: 287 ALAAHDAVVEASGALNTVACSLF-----KIAQDIRYLGSGPRCGYGELSLPENEPGSSIM 341
           A++  D VVE         CSLF     + ++D+  + S     + +LS      GSS+M
Sbjct: 235 AVSDRDFVVEI-----MFWCSLFMNHISRFSEDL-IIYSTAEFNFVKLS-DAYSTGSSLM 287

Query: 342 PGKVNPTQNEALTQVCVQVMGNNAAITFA 370
           P K NP   E L     +V G+ A    +
Sbjct: 288 PQKKNPDSLELLRGKSGRVFGSLAGFMMS 316

>Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359W
           (ADE13) - Adenylosuccinate Lyase [contig 198] FULL
          Length = 482

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 83/189 (43%), Gaps = 25/189 (13%)

Query: 180 LLPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSL 239
           L+P+L ++ D L   + E+ D+  +G TH Q A   TLG+  + ++Q++   +     + 
Sbjct: 128 LIPKLVNVIDRLSKFAMEWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 240 HRLKYLAQGGTAVGTG-----LNTKIGFAEKIAEQVSKETGLDF------KTAPNKFEAL 288
           + +      GT    G      ++     E + ++V++  G D       +T   K +  
Sbjct: 188 NDIGLRGVKGTTGTQGSFLALFHSDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 289 AAHDAVVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPT 348
                 ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVLAPLSSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPM 296

Query: 349 QNEALTQVC 357
           + E   +VC
Sbjct: 297 RCE---RVC 302

>Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 86/186 (46%), Gaps = 19/186 (10%)

Query: 180 LLPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSL 239
           ++P+L ++ + L   + E+ D+  +G TH Q A   TLG+  + ++Q++   +   E + 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 240 HRLKYLAQGGT--------AVGTGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAH 291
           + +      GT        A+  G + K+   E +  +V++  G D K  P   +   + 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDARVTELLGFD-KVYPVTGQTY-SR 242

Query: 292 DAVVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 351
              ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243 KIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 352 ALTQVC 357
              +VC
Sbjct: 300 ---RVC 302

>KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 86/192 (44%), Gaps = 31/192 (16%)

Query: 180 LLPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSL 239
           L+P+L ++ + L   +    D+  +G TH Q A   TLG+  + ++Q++   +   E + 
Sbjct: 128 LIPKLVNVINRLCKFAMANKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 240 HRLKYLAQGGT--------AVGTGLNTKIGFAEKIAEQVSKETGLDF------KTAPNKF 285
           + +      GT        A+  G + K+   EK+ E+V +  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHNKV---EKLDERVVELLGFDTVYPVTGQTYSRKI 244

Query: 286 EALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 345
           +        ++A   L++ A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDAFAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 346 NPTQNEALTQVC 357
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]
           {ON} highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 465

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 64/261 (24%), Positives = 102/261 (39%), Gaps = 47/261 (18%)

Query: 133 NRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVM---HIAAVTEITRHLLPELA---- 185
           +R +E+I GE  S      +      ++N+     +   HIA      R    ++A    
Sbjct: 66  HRGLEIIRGEWASNSFVEKDGDEDIHTANERRLGEIIGRHIAGKVHTGRSRNDQVATDMR 125

Query: 186 -HLRDSLDAKSKEFSDIVKI--------------GRTHLQDATPLTLGQEFSGYVQQVSN 230
            + R++LD  +K   D+V                G THLQ A P+      + Y    + 
Sbjct: 126 IYCREALDNMAKILKDLVGAILQRAEQEIDALMPGYTHLQRAQPIRWSHWLNLYATYFTE 185

Query: 231 GIDRVEGSLHRLKYLAQGGTAVG---TGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEA 287
              R++    RL     G  A+     G++      E IAE++    G D     N  +A
Sbjct: 186 DFKRLKQIRERLNVSPLGCGALAGHPYGIDR-----EHIAERL----GFD-GVIGNSLQA 235

Query: 288 LAAHDAVVEASGALNTVACSLF-----KIAQDIRYLGSGPRCGYGELSLPENEPGSSIMP 342
           ++  D VVE         CSLF     + ++D+  + S     + +LS      GSS+MP
Sbjct: 236 VSDRDFVVEI-----LFWCSLFMNHISRFSEDL-IIYSTAEFNFVKLS-DAYSTGSSLMP 288

Query: 343 GKVNPTQNEALTQVCVQVMGN 363
            K NP   E L     +V G+
Sbjct: 289 QKKNPDSLELLRGKSGRVFGS 309

>NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 88/194 (45%), Gaps = 35/194 (18%)

Query: 180 LLPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSL 239
           ++P+L ++ D L   + E+ D+  +G TH Q A   TLG+  + ++Q++   +     + 
Sbjct: 128 VIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 240 HRLKYLAQGGT--------AVGTGLNTKIGFAEKIAEQVSKETGLDF------KTAPNKF 285
           + +      GT        A+  G + K+   E + ++V++  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRKI 244

Query: 286 EALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLP--ENEPGSSIMPG 343
           +        ++    L++ A +  K+A DIR L +       EL  P  +++ GSS M  
Sbjct: 245 D--------IDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAY 291

Query: 344 KVNPTQNEALTQVC 357
           K NP + E   +VC
Sbjct: 292 KRNPMRCE---RVC 302

>NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 85/192 (44%), Gaps = 31/192 (16%)

Query: 180 LLPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSL 239
           ++P+L ++ D L   + E+ D+  +G TH Q A   TLG+  + ++Q++   +     + 
Sbjct: 128 IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 240 HRLKYLAQGGT--------AVGTGLNTKIGFAEKIAEQVSKETGLDF------KTAPNKF 285
           + +      GT        A+  G + K+   E + ++V++  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRKI 244

Query: 286 EALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 345
           +        ++    L + A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLASFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKR 293

Query: 346 NPTQNEALTQVC 357
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 96/213 (45%), Gaps = 33/213 (15%)

Query: 180 LLPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSL 239
           ++P+L ++ + L   + E+ D+  +G TH Q A   TLG+  + ++Q++   +   E + 
Sbjct: 128 VIPKLVNVINRLANFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 240 HRLKYLAQGGT--------AVGTGLNTKIGFAEKIAEQVSKETGLDF------KTAPNKF 285
           + +      GT        A+  G + K+   E++ E+V +  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EELDERVVELLGFDTVYPVTGQTYSRKI 244

Query: 286 EALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 345
           +        ++    L + A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVVSPLVSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 346 NPTQNEALTQVC--VQVMGNNAAITFAGASGQF 376
           NP + E   +VC   + +G+  + T   AS Q+
Sbjct: 294 NPMRCE---RVCSLARHLGSLLSDTVQTASVQW 323

>KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 86/192 (44%), Gaps = 31/192 (16%)

Query: 180 LLPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSL 239
           ++P+L ++ D L   + ++ D+  +G TH Q A   TLG+  + ++Q++   +     + 
Sbjct: 128 VIPKLVNVIDRLSKFALQYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFVRAR 187

Query: 240 HRLKYLAQGGT--------AVGTGLNTKIGFAEKIAEQVSKETGLDF------KTAPNKF 285
           + +      GT        A+  G + K+   E + ++V++  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRKI 244

Query: 286 EALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 345
           +        ++    L++ A S  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 346 NPTQNEALTQVC 357
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 86/192 (44%), Gaps = 31/192 (16%)

Query: 180 LLPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSL 239
           L+P+L ++ + L   + E+ D+  +G TH Q A   TLG+  + ++Q++   +     + 
Sbjct: 128 LIPKLVNVINRLSQFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 240 HRLKYLAQGGT--------AVGTGLNTKIGFAEKIAEQVSKETGLDF------KTAPNKF 285
           + +      GT        A+  G + K+   E + ++V++  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRKI 244

Query: 286 EALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 345
           +        ++    L++ A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLSSFAATAHKMATDIRLLANLKEM---EEPFEKSQIGSSAMAYKR 293

Query: 346 NPTQNEALTQVC 357
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 81/186 (43%), Gaps = 19/186 (10%)

Query: 180 LLPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQV---SNGIDRVE 236
           ++P+L ++ D L   +  + D+  +G TH Q A   TLG+  + ++Q +       DR  
Sbjct: 128 IIPKLINVIDRLSKFALNYKDVPVLGWTHFQPAQLTTLGKRVTLWIQDLLWDLRNFDRAR 187

Query: 237 GSLHRLKYLAQGGT-----AVGTGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAH 291
             +         GT     A+  G + K+   E++ ++V++  G  F+T         + 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EELDQRVTELLG--FETVYPVTGQTYSR 242

Query: 292 DAVVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 351
              ++    L + A +  K+A DIR L +       E    + + GSS M  K NP + E
Sbjct: 243 KIDIDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPMRCE 299

Query: 352 ALTQVC 357
              +VC
Sbjct: 300 ---RVC 302

>KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]
           {ON} highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 84/186 (45%), Gaps = 19/186 (10%)

Query: 180 LLPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSL 239
           L+P+L ++ + L   + E+ D+  +G TH Q A   TLG+  + ++Q++   +     + 
Sbjct: 128 LIPKLVNVINRLSKFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 240 HRLKYLAQGGTAVGTGLNTKIGF------AEKIAEQVSKETGLDFKTAPNKFEALAAHDA 293
           + +      GT  GT  +    F       E + ++V++  G  F T         +   
Sbjct: 188 NDIGLRGVKGTT-GTQASFLTLFHGDHDKVEALDKRVAELLG--FSTVYPVTGQTYSRKI 244

Query: 294 VVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKVNPTQNE 351
            ++    L++ A +  K+A DIR L +       EL  P  +++ GSS M  K NP + E
Sbjct: 245 DIDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 352 ALTQVC 357
              +VC
Sbjct: 300 ---RVC 302

>Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON}
           (40749..42197) [1449 nt, 483 aa]
          Length = 482

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 85/192 (44%), Gaps = 31/192 (16%)

Query: 180 LLPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSL 239
           ++P+L ++ D L   + E+ D+  +G TH Q A   T+G+  + ++Q++   +     + 
Sbjct: 128 IIPKLVNVIDRLAKFASEYKDLPVLGWTHFQPAQLTTMGKRATLWIQELLWDLRNFVRAR 187

Query: 240 HRLKYLAQGGT--------AVGTGLNTKIGFAEKIAEQVSKETGLDF------KTAPNKF 285
           + +      GT        A+  G + K+   E + ++V +  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDDDKV---EALDKRVVELLGFDTVYPVTGQTYSRKI 244

Query: 286 EALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 345
           +        ++    L++ A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 346 NPTQNEALTQVC 357
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 85/192 (44%), Gaps = 31/192 (16%)

Query: 180 LLPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSL 239
           L+P+L ++ + L   + ++ D+  +G TH Q A   TLG+  + ++Q++   +     + 
Sbjct: 128 LIPKLVNVINRLSQFALQWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 240 HRLKYLAQGGT--------AVGTGLNTKIGFAEKIAEQVSKETGLDF------KTAPNKF 285
           + +      GT        A+  G + K+   E + ++V++  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRKI 244

Query: 286 EALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 345
           +        ++    L + A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLCSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKR 293

Query: 346 NPTQNEALTQVC 357
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR359W
           (ADE13)
          Length = 482

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 83/190 (43%), Gaps = 27/190 (14%)

Query: 180 LLPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSL 239
           ++P+L ++ + L   + E+ D+  +G TH Q A   TLG+  + ++Q++   +     + 
Sbjct: 128 IIPKLVNVINRLSKFACEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 240 HRLKYLAQGGTAVGTGLNTKIGF------AEKIAEQVSKETGLDF------KTAPNKFEA 287
           + +      GT  GT  +    F       E + ++V++  G D       +T   K + 
Sbjct: 188 NDIGLRGVKGT-TGTQASFLALFHGDHDRVEALDKRVTELLGFDIVYPVTGQTYSRKID- 245

Query: 288 LAAHDAVVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNP 347
                  ++  G+ ++   +  K+A DIR L +       E    + + GSS M  K NP
Sbjct: 246 -------IDILGSGSSFEATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNP 295

Query: 348 TQNEALTQVC 357
            + E   +VC
Sbjct: 296 MRCE---RVC 302

>KLLA0D15081g Chr4 (1271696..1274728) [3033 bp, 1010 aa] {ON} some
           similarities with Saccharomyces cerevisiae YPR115W
           Hypothetical ORF and to YGR097W uniprot|P48361
           Saccharomyces cerevisiae YGR097W ASK10 Component of the
           RNA polymerase II holoenzyme phosphorylated in response
           to oxidative stress has a role in destruction of Ssn8p
           which relieves repression of stress-response genes
          Length = 1010

 Score = 34.7 bits (78), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 53/116 (45%), Gaps = 21/116 (18%)

Query: 130 VISNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAV---------------- 173
            ++N +I+L G EL   Q+ PN+ C+ A   N    S+  I  +                
Sbjct: 218 TLNNSSIDL-GQEL---QLEPNDSCSGAGFMNFGSGSIQDIQVILKKYHLSLASQQVKSS 273

Query: 174 TEITRHLLPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVS 229
            EIT  ++P+L  LR  L  K KE  ++    +T++Q+   LT GQ    Y+  V+
Sbjct: 274 KEITLQIIPKLEDLRKDLSHKIKEIKELNADFKTNIQEHVALT-GQLLHKYIAAVN 328

>Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W
           (REAL)
          Length = 850

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 41/92 (44%), Gaps = 6/92 (6%)

Query: 75  SAAVVNESLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISNR 134
           S A+ ++ L   DP   + + + +D+   G     F L     G G ++  +  E   N+
Sbjct: 641 SKAMRDDELKASDPLQTKELHEMSDKFESGMKKGKFRLSKGFGGKGLENIKSKREEAQNK 700

Query: 135 AIELIGGELGSKQIH------PNNHCNQAQSS 160
            +E   G+  + Q+       PN H N+A+SS
Sbjct: 701 ELEHKKGQKNNDQLENKSDHSPNEHANEAESS 732

>Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON}
           (138268..141444) [3177 nt, 1059 aa]
          Length = 1058

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 67/150 (44%), Gaps = 22/150 (14%)

Query: 61  MPEPIVRAFGVLKKSAAVVNESLGTLDPKV-AEPIKQAADEVAQGK-LTAHFPLVVFQTG 118
           +PE  + A G         N +L +  P V ++ + + + E ++ + +++  P  V  T 
Sbjct: 434 VPESFIGALGQ--------NRTLASPAPNVESDAVTELSKESSKVEDISSQSPKYV-ATE 484

Query: 119 SGTQSNMNANEVISNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITR 178
            G+Q+  N+N+VI    IE+   EL       NN  N+ +        V +++  TEI  
Sbjct: 485 LGSQTEENSNDVIHEEIIEIYNDEL-------NNTINKTEEPEK--DEVKYVSLDTEIDI 535

Query: 179 HLLPELAHLRDSL--DAKSKEFSDIVKIGR 206
             +      RD L  D + K   DIVK G+
Sbjct: 536 QTVQSPTKSRDDLKSDEQIKHSKDIVKQGK 565

>ZYRO0C12606g Chr3 (995841..999233) [3393 bp, 1130 aa] {ON} similar
           to uniprot|P48361 Saccharomyces cerevisiae YGR097W ASK10
           Component of the RNA polymerase II
          Length = 1130

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 1/63 (1%)

Query: 166 SVMHIAAVTEITRHLLPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYV 225
           +V  +    EI  +LLP +  LR  L +K KE  ++    RT++ +   +T GQ  + Y+
Sbjct: 277 AVQQLKISKEINMNLLPRIEDLRRDLQSKIKEIKELSGDFRTNINEHVAIT-GQLLNRYI 335

Query: 226 QQV 228
             V
Sbjct: 336 SSV 338

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,053,085
Number of extensions: 1854298
Number of successful extensions: 4828
Number of sequences better than 10.0: 65
Number of HSP's gapped: 4939
Number of HSP's successfully gapped: 65
Length of query: 484
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 371
Effective length of database: 40,524,141
Effective search space: 15034456311
Effective search space used: 15034456311
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)