Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G04570singletonON20920911261e-158
TDEL0B05510singletonON2072081371e-09
TPHA0N012803.561ON95757701.7
Kwal_56.229103.237ON37051647.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G04570
         (209 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G04570 Chr7 (835369..835998) [630 bp, 209 aa] {ON}               438   e-158
TDEL0B05510 Chr2 complement(979250..979873) [624 bp, 207 aa] {ON}      57   1e-09
TPHA0N01280 Chr14 complement(277121..279994) [2874 bp, 957 aa] {...    32   1.7  
Kwal_56.22910 s56 complement(327093..328205) [1113 bp, 370 aa] {...    29   7.8  

>TDEL0G04570 Chr7 (835369..835998) [630 bp, 209 aa] {ON} 
          Length = 209

 Score =  438 bits (1126), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%)

Query: 1   MYYPIFAILALICKVILCEEYPFDECNALKRDTLSASTQIPGTTFQLIDAPTVESISNRS 60
           MYYPIFAILALICKVILCEEYPFDECNALKRDTLSASTQIPGTTFQLIDAPTVESISNRS
Sbjct: 1   MYYPIFAILALICKVILCEEYPFDECNALKRDTLSASTQIPGTTFQLIDAPTVESISNRS 60

Query: 61  TEDAAAMNSTAIGTTDISKHYDIGPSRRDTLWGGPILQWSCNARHSIGGGIASFKSTVLS 120
           TEDAAAMNSTAIGTTDISKHYDIGPSRRDTLWGGPILQWSCNARHSIGGGIASFKSTVLS
Sbjct: 61  TEDAAAMNSTAIGTTDISKHYDIGPSRRDTLWGGPILQWSCNARHSIGGGIASFKSTVLS 120

Query: 121 FYNRIGPNSPRFICLQSQGNNLCVSWAIYNPNQLPDGFFAHKIKFASECLAAGRRAQVKV 180
           FYNRIGPNSPRFICLQSQGNNLCVSWAIYNPNQLPDGFFAHKIKFASECLAAGRRAQVKV
Sbjct: 121 FYNRIGPNSPRFICLQSQGNNLCVSWAIYNPNQLPDGFFAHKIKFASECLAAGRRAQVKV 180

Query: 181 STSDYLEYACVSDRCAKKLTTMTRPHLTK 209
           STSDYLEYACVSDRCAKKLTTMTRPHLTK
Sbjct: 181 STSDYLEYACVSDRCAKKLTTMTRPHLTK 209

>TDEL0B05510 Chr2 complement(979250..979873) [624 bp, 207 aa] {ON} 
          Length = 207

 Score = 57.4 bits (137), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 85/208 (40%), Gaps = 28/208 (13%)

Query: 5   IFAILALICKVILCEEYPFDECNALKRDTLSASTQIPGTTFQLIDAPTVESISNRSTEDA 64
           IFA L  + K    E Y F+         L+      G  ++L+     ++ +++   D 
Sbjct: 11  IFAALNGLLKAN--ELYDFEHHCTEDDGRLTCIDPFTGFDYELLTPNDGKTYTSKELFDT 68

Query: 65  AAMNSTAIGTTDISKHYDIGPSRRDTLWGGPILQWSCNARHSIGGGIASFKSTVLSFYNR 124
              N        +++   I    R TL  G I+    N RH I               NR
Sbjct: 69  YIDNQIRARNERVARASSINRISRWTLKKGNIV--FSNMRHWISN-------------NR 113

Query: 125 IGPNSPRFICLQSQGNNLCVSWAIYNPNQLPDGFFAHKIKFASECLAAGRRAQVKVSTSD 184
            GP   R IC      +LC+SWA+Y+ N LP+G  A    FAS C+ AG    V  +T +
Sbjct: 114 KGP---RAIC-HVPWKDLCLSWALYDGNLLPNGANADTAGFASRCVQAGMTVDVVAATYN 169

Query: 185 YLEYACVSD-------RCAKKLTTMTRP 205
           Y  + CV++       RC     +M+RP
Sbjct: 170 YSHFTCVTESESAKQVRCNGPSQSMSRP 197

>TPHA0N01280 Chr14 complement(277121..279994) [2874 bp, 957 aa] {ON}
           Anc_3.561 YGL238W
          Length = 957

 Score = 31.6 bits (70), Expect = 1.7,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 27/57 (47%), Gaps = 2/57 (3%)

Query: 37  STQIPGTTFQLIDAPTVESISNRSTEDAAAMNSTAIGT--TDISKHYDIGPSRRDTL 91
           ST IPGT   +IDA   ESI+N  T+     N   I T  +  SK + I     D L
Sbjct: 851 STIIPGTVTSIIDATLSESIANLKTDHIDLDNLEEISTFGSSFSKLFSISEKPFDPL 907

>Kwal_56.22910 s56 complement(327093..328205) [1113 bp, 370 aa] {ON}
           YPL279C - Hypothetical ORF [contig 184] FULL
          Length = 370

 Score = 29.3 bits (64), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 4/51 (7%)

Query: 5   IFAILALICKVILCEEYPFDECNALKRDTLSASTQIPGTTFQLIDAPTVES 55
           + AI  LI +V+L   +     N+ +R TLSAS   PGT  + I + T+ S
Sbjct: 219 MLAIPLLIVQVVLAAVFS----NSSRRWTLSASFAFPGTALRYILSKTLNS 265

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.134    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,580,366
Number of extensions: 837204
Number of successful extensions: 1911
Number of sequences better than 10.0: 4
Number of HSP's gapped: 1943
Number of HSP's successfully gapped: 4
Length of query: 209
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 104
Effective length of database: 41,441,469
Effective search space: 4309912776
Effective search space used: 4309912776
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 63 (28.9 bits)