Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G045606.69ON48248222490.0
TDEL0H03270singletonON7411992293e-19
SAKL0A08206g6.69ON6451261277e-07
ZYRO0E04708gsingletonON6111111035e-04
Ecym_72314.108ON114683850.084
ZYRO0B01936gsingletonON82446840.12
AGR274C6.69ON37594790.42
Ecym_31196.69ON37892760.95
Skud_14.387na 1ON590110751.4
YOR177C (MPC54)6.69ON46474713.3
YOR216C (RUD3)8.636ON484164705.3
Kpol_1008.29singletonON538186705.3
Smik_8.2425.88ON1168100696.6
KLTH0G15334g6.69ON582175697.0
Kwal_56.243596.278ON1391106698.8
NOTE: 5 genes in the same pillar as TDEL0G04560 were not hit in these BLAST results
LIST: Skud_15.344 Smik_15.362 Suva_8.233 Kwal_56.23256 TPHA0K01150

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G04560
         (482 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G04560 Chr7 (831920..833368) [1449 bp, 482 aa] {ON} Anc_6.6...   870   0.0  
TDEL0H03270 Chr8 complement(546044..548269) [2226 bp, 741 aa] {O...    93   3e-19
SAKL0A08206g Chr1 (729465..731402) [1938 bp, 645 aa] {ON} conser...    54   7e-07
ZYRO0E04708g Chr5 complement(354494..356329) [1836 bp, 611 aa] {...    44   5e-04
Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON...    37   0.084
ZYRO0B01936g Chr2 complement(156676..159150) [2475 bp, 824 aa] {...    37   0.12 
AGR274C Chr7 complement(1252837..1253964) [1128 bp, 375 aa] {ON}...    35   0.42 
Ecym_3119 Chr3 (221707..222843) [1137 bp, 378 aa] {ON} similar t...    34   0.95 
Skud_14.387 Chr14 (693140..694912) [1773 bp, 590 aa] {ON} YKR101...    33   1.4  
YOR177C Chr15 complement(665785..667179) [1395 bp, 464 aa] {ON} ...    32   3.3  
YOR216C Chr15 complement(747525..748979) [1455 bp, 484 aa] {ON} ...    32   5.3  
Kpol_1008.29 s1008 complement(62595..64211) [1617 bp, 538 aa] {O...    32   5.3  
Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {O...    31   6.6  
KLTH0G15334g Chr7 (1343754..1345502) [1749 bp, 582 aa] {ON} cons...    31   7.0  
Kwal_56.24359 s56 complement(966614..970789) [4176 bp, 1391 aa] ...    31   8.8  

>TDEL0G04560 Chr7 (831920..833368) [1449 bp, 482 aa] {ON} Anc_6.69
           YOR177C
          Length = 482

 Score =  870 bits (2249), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/482 (90%), Positives = 436/482 (90%)

Query: 1   MSTSLCTRTTAETDPYYIEESSTKIYQNLYNDENHSNARPQDYITGPLEIKGVNYAVEKA 60
           MSTSLCTRTTAETDPYYIEESSTKIYQNLYNDENHSNARPQDYITGPLEIKGVNYAVEKA
Sbjct: 1   MSTSLCTRTTAETDPYYIEESSTKIYQNLYNDENHSNARPQDYITGPLEIKGVNYAVEKA 60

Query: 61  LRDFEREGRKDRKALRYITNKKIVGISSQTGSLPLTRPATKYVVKKVTFGLSSVVHFEES 120
           LRDFEREGRKDRKALRYITNKKIVGISSQTGSLPLTRPATKYVVKKVTFGLSSVVHFEES
Sbjct: 61  LRDFEREGRKDRKALRYITNKKIVGISSQTGSLPLTRPATKYVVKKVTFGLSSVVHFEES 120

Query: 121 DIVPKKSVGGPIRGKSILKRSSFNSPSTDYEKIGRRELQNAIARIYNLCDLPFTLFRKDD 180
           DIVPKKSVGGPIRGKSILKRSSFNSPSTDYEKIGRRELQNAIARIYNLCDLPFTLFRKDD
Sbjct: 121 DIVPKKSVGGPIRGKSILKRSSFNSPSTDYEKIGRRELQNAIARIYNLCDLPFTLFRKDD 180

Query: 181 PLLSLELLARGVCNAFKSHEICWKKVGXXXXXXXXXXXXXXXXXXXXXXXXXXHFKQELY 240
           PLLSLELLARGVCNAFKSHEICWKKVG                          HFKQELY
Sbjct: 181 PLLSLELLARGVCNAFKSHEICWKKVGEEELLELKEKINNLETENETKERELNHFKQELY 240

Query: 241 NDLNRLIPEEQVLKIPDISYGIVKTGIAKIEHISTKWKLRAASCXXXXXXXXXXXXXXXX 300
           NDLNRLIPEEQVLKIPDISYGIVKTGIAKIEHISTKWKLRAASC                
Sbjct: 241 NDLNRLIPEEQVLKIPDISYGIVKTGIAKIEHISTKWKLRAASCENNDLREENEALREEN 300

Query: 301 XXXXKGLLGQRDISELLVETKISEKKTIIRTRPINSRIKGVNDERSTVNELILKRLLKAS 360
               KGLLGQRDISELLVETKISEKKTIIRTRPINSRIKGVNDERSTVNELILKRLLKAS
Sbjct: 301 AELRKGLLGQRDISELLVETKISEKKTIIRTRPINSRIKGVNDERSTVNELILKRLLKAS 360

Query: 361 QKSNETLAGEYKELKDLQDSLYEKVHSLKVFLGAMKQAFCNSISREKALERVNLKLISEL 420
           QKSNETLAGEYKELKDLQDSLYEKVHSLKVFLGAMKQAFCNSISREKALERVNLKLISEL
Sbjct: 361 QKSNETLAGEYKELKDLQDSLYEKVHSLKVFLGAMKQAFCNSISREKALERVNLKLISEL 420

Query: 421 EGYRFQNDQLKENSVASELELNIRIEQRKNETHGNSTRISVLIRVLEGVIGELQTPSDPE 480
           EGYRFQNDQLKENSVASELELNIRIEQRKNETHGNSTRISVLIRVLEGVIGELQTPSDPE
Sbjct: 421 EGYRFQNDQLKENSVASELELNIRIEQRKNETHGNSTRISVLIRVLEGVIGELQTPSDPE 480

Query: 481 EI 482
           EI
Sbjct: 481 EI 482

>TDEL0H03270 Chr8 complement(546044..548269) [2226 bp, 741 aa] {ON} 
          Length = 741

 Score = 92.8 bits (229), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 96/199 (48%), Gaps = 38/199 (19%)

Query: 42  DYITGPLEIKGVNYAVEKAL-----RDFEREGRKDRKALRYITNKKIVGISSQT--GSLP 94
           DYIT   EIK +N  +E A+     +D ER+G  DR  +     +   G  S+    SL 
Sbjct: 189 DYITDTFEIKRINKRLEDAIEYYNRKDVERKGFGDRSFIEKAFKEFEAGELSEDKLHSLE 248

Query: 95  LT-----RPAT-----------KYVVKKVTFG--------LSSVVHFEESDIVPKKSVGG 130
            T     RP++           +   +K+ FG        +  VV  EE  + PK   G 
Sbjct: 249 KTVAFYNRPSSADRLHFANIRLRRSARKIGFGETRIKTYNVGEVVTKEEHPVKPKH--GA 306

Query: 131 PIRGKSILKRSS---FNSPSTDYEKIGRRELQNAIARIYNLCDLPFTLFRKDDPLLSLEL 187
           P  GKSILK ++   F +P  DY  +G   L NAIAR++NL D+P   F KDDP+ SL  
Sbjct: 307 P--GKSILKNTNVKKFQTPKGDYNLVGTDLLANAIARLFNLSDMPLKFFDKDDPISSLTW 364

Query: 188 LARGVCNAFKSHEICWKKV 206
            A G+ NAF   E+C + V
Sbjct: 365 AAHGIANAFGLKELCMENV 383

>SAKL0A08206g Chr1 (729465..731402) [1938 bp, 645 aa] {ON} conserved
           hypothetical protein
          Length = 645

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 59/126 (46%), Gaps = 24/126 (19%)

Query: 106 KVTFGLSSVVHFEESDIV-------PKKSVGGPIRGKSI--------------LKRSSFN 144
           K+ FG +SV  F    ++       P +   G ++  S+              LK    +
Sbjct: 139 KIRFGENSVKMFYSDSLIGNGLEENPPRKPNGNLKHDSVKSVLVEKNSDNACPLKSKDSD 198

Query: 145 SPSTDYE---KIGRRELQNAIARIYNLCDLPFTLFRKDDPLLSLELLARGVCNAFKSHEI 201
           +   D+E    I       AI R +NLC++P     +DD ++SL+ L+ G+ +AFK+ E+
Sbjct: 199 TADQDWEVNVPIENTVALEAITRCFNLCNVPLEDLDEDDLVMSLQRLSFGIVSAFKTQEM 258

Query: 202 CWKKVG 207
           C+K +G
Sbjct: 259 CYKYLG 264

>ZYRO0E04708g Chr5 complement(354494..356329) [1836 bp, 611 aa] {ON}
           conserved hypothetical protein
          Length = 611

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 51/111 (45%), Gaps = 11/111 (9%)

Query: 107 VTFGLSSVVHFEESDIV-----PKKSVGGPIRGKSILKRSSFNSPSTDY----EKIGRRE 157
           V FG   +V F E + +        SV   I    ILK S   +    Y     K+  ++
Sbjct: 78  VKFGDKEIVIFNEDERIGHSMKANSSVDNVILPLPILKISQKGASDIKYMEPDNKMATQQ 137

Query: 158 --LQNAIARIYNLCDLPFTLFRKDDPLLSLELLARGVCNAFKSHEICWKKV 206
             L     R Y LC+LP + F +++P  SL+ L  G+  +FK+ + C+K +
Sbjct: 138 ERLFEVFRRCYTLCNLPMSQFDENNPFKSLKKLCEGIKKSFKAKDECYKYI 188

>Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON}
            similar to Ashbya gossypii AGR170C
          Length = 1146

 Score = 37.4 bits (85), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 6/83 (7%)

Query: 91   GSLPLTRPATKY----VVKKVTFGLSSVVHFEESDIVPKKSVGGPIRGKSILKRSSF-NS 145
            G +P+ R    +    ++ + TFG   ++  +   I+P +  GGP+ G SI+ +++F N 
Sbjct: 972  GMMPVQRTMGGFPSASIIPQTTFGTGPIMQ-QAGGIMPLQRTGGPLLGTSIIPQTTFSNV 1030

Query: 146  PSTDYEKIGRRELQNAIARIYNL 168
            P       G   LQN    + N+
Sbjct: 1031 PLGQTITGGAMALQNTGGALMNM 1053

>ZYRO0B01936g Chr2 complement(156676..159150) [2475 bp, 824 aa] {ON}
           weakly similar to uniprot|P25386 Saccharomyces
           cerevisiae YDL058W USO1 involved intracellular protein
           transport, coiled-coil protein necessary for protein
           transport from ER to Golgi; Integrin analogue gene
          Length = 824

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 162 IARIYNLCDLPFTLFRKDDPLLSLELLARGVCNAFKSHEICWKKVG 207
           + RI+ L  +P     K+D L +L+ LARGV  +FK  E C+K VG
Sbjct: 157 LQRIFTLHGIPPCEI-KEDLLGTLQRLARGVVASFKQREQCYKYVG 201

>AGR274C Chr7 complement(1252837..1253964) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR177C
           (MPC54)
          Length = 375

 Score = 35.0 bits (79), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 51/94 (54%), Gaps = 6/94 (6%)

Query: 115 VHFEESDIVPKKSVGGPIRG--KSIL-KRSSFNSPSTDYEKIGRRELQNAIARIYNLCDL 171
           V F E  + P+ S    +    KSIL  R +  + ++D E+    E++  + R +N C+L
Sbjct: 54  VKFSELPLGPQPSARSSMTTPRKSILVSRQTTETENSDNEE-DPDEVELLLHRCFNFCNL 112

Query: 172 PFTLFRKDDPLL-SLELLARGVCNAFKSHEICWK 204
             T    + PL+ +LEL++ G+ + F+ HE C+K
Sbjct: 113 D-TDGVAERPLVENLELISYGIISTFRFHECCYK 145

>Ecym_3119 Chr3 (221707..222843) [1137 bp, 378 aa] {ON} similar to
           Ashbya gossypii AGR274C
          Length = 378

 Score = 33.9 bits (76), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 43/92 (46%), Gaps = 2/92 (2%)

Query: 115 VHFEESDIVPK--KSVGGPIRGKSILKRSSFNSPSTDYEKIGRRELQNAIARIYNLCDLP 172
           + F +  + PK  K+    I  KSIL      + +   ++I   E+   + R +N C+L 
Sbjct: 52  IKFNDCPMGPKLTKNEVPAIPKKSILVNRENTTDTPTEQEIPNEEVLLLLRRCFNFCNLD 111

Query: 173 FTLFRKDDPLLSLELLARGVCNAFKSHEICWK 204
                K     +LE ++ G+ + F+ HE C+K
Sbjct: 112 TDGIEKRSIEENLESISYGIISTFRFHECCYK 143

>Skud_14.387 Chr14 (693140..694912) [1773 bp, 590 aa] {ON} YKR101W
           (REAL)
          Length = 590

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 50/110 (45%), Gaps = 18/110 (16%)

Query: 340 GVNDERSTVNELILKRLLKASQKSNETLAGEYK---ELKDLQDSL---YEKVHS------ 387
           GV      V+ ++LKR+L+  Q   E +    K   ELK L   +   YEK+H       
Sbjct: 353 GVQKHVQDVHSMLLKRMLQQGQWKIENIKNLMKYDSELKSLLGPVLPEYEKLHEERICAI 412

Query: 388 LKVFLGAMKQAFCNSISREKALERVNLKLISELEGYRFQNDQLKENSVAS 437
           LK  LG+  +  CN +  +  +   N+K+I      RF  D +KE  V S
Sbjct: 413 LKTGLGSFVERICNKVKNKDGVVLPNIKIIE-----RFLVD-IKERVVVS 456

>YOR177C Chr15 complement(665785..667179) [1395 bp, 464 aa] {ON}
           MPC54Component of the meiotic outer plaque, a
           membrane-organizing center which is assembled on the
           cytoplasmic face of the spindle pole body during meiosis
           II and triggers the formation of the prospore membrane;
           potential Cdc28p substrate
          Length = 464

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 34/74 (45%), Gaps = 3/74 (4%)

Query: 122 IVPKKSVGGPIRGKSILKRSSFNSPSTDYEKIGRRELQNAIARIYNLCDLP---FTLFRK 178
           I P KS     RGK   K S  N    + +    +E+ +A+ R Y LC++P    ++   
Sbjct: 76  ITPNKSSLKSPRGKRASKNSFDNETKLESKNETLKEVNDAVNRCYALCNIPTKHVSINSI 135

Query: 179 DDPLLSLELLARGV 192
            D   + E LA G+
Sbjct: 136 SDLAQTFETLAVGI 149

>YOR216C Chr15 complement(747525..748979) [1455 bp, 484 aa] {ON}
           RUD3Golgi matrix protein involved in the structural
           organization of the cis-Golgi; interacts genetically
           with COG3 and USO1
          Length = 484

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 73/164 (44%), Gaps = 32/164 (19%)

Query: 311 RDISELLVETKISEKKTIIRTRPINSRIKGVNDERSTVNELILKRLLKASQKSN-ETLAG 369
           +D+SE + + K+++  T+    P+  +  G  DE   + E I +  L+ S K + ET   
Sbjct: 61  KDLSEGVDKQKVNDGLTVDTINPLEDKKAG--DEMKELREEIERLKLELSHKKDQETPNE 118

Query: 370 EYK-----------ELKDLQDSLYEKVHSLKVFLGAMKQAFCNSISREKALERV------ 412
           ++K           E K   D+L  K+ S+K     MK+A       +K LE V      
Sbjct: 119 DFKNELANVIKERDEFKTQYDTLLSKISSMKSIFNKMKEA-------QKQLEEVQEQLTE 171

Query: 413 ----NLKLISELEGYRFQNDQLKENSVASELEL-NIRIEQRKNE 451
               NLKL  +LE  + +N +L+   V    EL N+  EQ   E
Sbjct: 172 YESQNLKLKKKLEATKTENSELQSTIVTLNTELENLEKEQESTE 215

>Kpol_1008.29 s1008 complement(62595..64211) [1617 bp, 538 aa] {ON}
           complement(62595..64211) [1617 nt, 539 aa]
          Length = 538

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 74/186 (39%), Gaps = 34/186 (18%)

Query: 31  NDEN----HSNARPQDYITGPL-EIKGVNYAVEKALRDFEREGRKDRKALRYITNKKIVG 85
           NDEN     ++    D I  P+ E+K  N  +E+A  D+       +K+++  +NK +  
Sbjct: 11  NDENIPDSSASLTDNDIIVTPIFEVKKENSDLEEAKADY------IKKSMQRNSNKNL-- 62

Query: 86  ISSQTGSLPLTRPATKYVVK----KVTFGLSSVVHFEESDIVPKKSVGGPIRGKSILKRS 141
                          K VVK    K+ F  + ++ F++   V K  +   +   S  ++S
Sbjct: 63  --------------EKMVVKEKNPKIRFDCNRILIFDQDKEVSKSGIQKILTKSSSSQKS 108

Query: 142 SFNSPSTDYEKI---GRRELQNAIARIYNLCDLPFTLFRKDDPLLSLELLARGVCNAFKS 198
                  D E        E+   + R++ LC +             LE L+  + NAF +
Sbjct: 109 ILKKREDDIEDKLYPQDDEITQIVKRMFTLCGVNLKHIEGISFKEQLERLSVSITNAFNT 168

Query: 199 HEICWK 204
            E+C K
Sbjct: 169 KEMCSK 174

>Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {ON}
            YHR158C (REAL)
          Length = 1168

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 49/100 (49%), Gaps = 17/100 (17%)

Query: 353  LKRLLKASQK---SNETLAGEYKELKDLQDSLYEKV----HSLKVFLGAMKQAFCNSISR 405
            L  LL+ SQ+   S E L+ EY+ LK    SL + V    + +K      K++  +  S 
Sbjct: 994  LDDLLEKSQELTMSKEKLSSEYRALKMEHSSLSQDVLVKENEIKKIQNDYKESINSMDSA 1053

Query: 406  EKAL----------ERVNLKLISELEGYRFQNDQLKENSV 435
             KAL          + +N KLI EL+  +F+ND   ++SV
Sbjct: 1054 SKALMVSQRELEKYKTLNKKLIDELDELKFKNDVSSKDSV 1093

>KLTH0G15334g Chr7 (1343754..1345502) [1749 bp, 582 aa] {ON}
           conserved hypothetical protein
          Length = 582

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 30/175 (17%), Positives = 70/175 (40%), Gaps = 22/175 (12%)

Query: 23  TKIYQNLYNDENHSNARPQDYITGPLEIKGVNYAVEKALRDFEREGRKDRKALRYITNK- 81
           T++  +LY+ +  ++ RP+ Y++   E++  N  VE+ + +  R   +    LR+  N+ 
Sbjct: 57  TEMDFDLYSIDRDNDLRPETYVSDVYEVRNTNPIVEEFVTEQMRVKGRPSSLLRFGCNQT 116

Query: 82  KIVGISSQTGSLPLTRPATKYVVKKVTFGLSSVVHFEESDIVPKKSVGGPIRGKSILKRS 141
           K+  + +  G+  + +P+     + +         + E D         PI    +L+  
Sbjct: 117 KLFDMHASIGNSHIRKPSGAIKPESILIVKDQEPRYLEEDSHSDWDQDIPIDNPVVLE-- 174

Query: 142 SFNSPSTDYEKIGRRELQNAIARIYNLCDLPFTLFRKDDPLLSLELLARGVCNAF 196
                                 R +  C +P   F  +D +++++ L+ G+  A 
Sbjct: 175 -------------------GFLRCWEACGIPDFEFDAEDMIMTVQKLSYGILQAL 210

>Kwal_56.24359 s56 complement(966614..970789) [4176 bp, 1391 aa]
           {ON} YMR190C (SGS1) - has DNA helicase signature motifs
           [contig 163] FULL
          Length = 1391

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 44/106 (41%), Gaps = 15/106 (14%)

Query: 38  ARPQDYITGPLEIKGVNYAVEKALRDFEREGRKDRKALRY----ITNKKIVGISSQTGSL 93
           ++P DY+T  +    VN +V  A      E +  R  + Y    +T    +  S+Q    
Sbjct: 64  SKPSDYVTN-MVASNVNASVSAA-----EENQSQRPGISYSNPTLTRNSRIAESTQYSQK 117

Query: 94  PLTRPATKYVVKKVTFGLSSVVHFEESDIVP-KKSVGGPIRGKSIL 138
           P + PAT YV      G  S  H  +   +P +K+   P+    ++
Sbjct: 118 PASLPATSYVES----GSMSANHISDQSYMPVRKTTNQPVSSTELI 159

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,257,022
Number of extensions: 1823118
Number of successful extensions: 5656
Number of sequences better than 10.0: 124
Number of HSP's gapped: 5913
Number of HSP's successfully gapped: 129
Length of query: 482
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 369
Effective length of database: 40,524,141
Effective search space: 14953408029
Effective search space used: 14953408029
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)