Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G045506.14ON56456425670.0
SAKL0E01012g6.14ON54447317220.0
Skud_5.296.14ON60848316970.0
Suva_5.76.14ON66448616970.0
YEL060C (PRB1)6.14ON63546016940.0
Smik_5.276.14ON60848016860.0
Kwal_56.223876.14ON54348216530.0
KLTH0C11396g6.14ON55047716450.0
KLLA0D00979g6.14ON56148315760.0
TBLA0A073006.14ON57347115770.0
NCAS0F002206.14ON69542115310.0
CAGL0B03619g6.14ON46846814890.0
ZYRO0C07942g6.14ON54847714820.0
NDAI0K028806.14ON70447014940.0
Kpol_1032.56.14ON68048114580.0
KNAG0E009206.14ON53149614400.0
ACR012C6.14ON54147414370.0
Ecym_30186.14ON57548114060.0
KAFR0L003606.14ON50245613620.0
Kpol_1045.756.14ON47747713370.0
TPHA0M002306.14ON58541412271e-162
Suva_15.1786.14ON47641411991e-160
Skud_15.1646.14ON48241611911e-158
YOR003W (YSP3)6.14ON47843711811e-157
Smik_15.1726.14ON47841511671e-155
CAGL0E02651g6.14ON48541310391e-135
KAFR0B065506.14ON4564109921e-129
NCAS0D026306.14ON4514158971e-115
NDAI0I022806.14ON4824628391e-105
KNAG0F02970singletonON4203498141e-103
CAGL0L13266gsingletonON5794377032e-84
NCAS0D043906.313ON4924424823e-53
TDEL0A072806.313ON4364304557e-50
ZYRO0D08822g6.313ON4903684552e-49
Kpol_1028.616.313ON5183214572e-49
Ecym_21056.313ON6103144462e-47
Kpol_1018.56.313ON4654824392e-47
KNAG0I024706.313ON4754254367e-47
Suva_3.846.313ON5273554352e-46
SAKL0A02002g6.313ON4794254313e-46
AAR069W6.313ON7683184424e-46
Smik_3.1496.313ON4913144281e-45
TBLA0F039706.313ON7343004344e-45
KLTH0A06094g6.313ON4963174192e-44
YCR045C (RRT12)6.313ON4913144157e-44
NDAI0I005606.313ON4834554149e-44
CAGL0L10802g6.313ON5173514132e-43
KAFR0J024506.313ON4783194103e-43
Skud_3.1246.313ON5403214072e-42
TPHA0D037606.313ON6073194083e-42
Kwal_23.61836.313ON4933213762e-38
KLLA0F06028g6.313ON5083213552e-35
Kwal_33.133721.78ON3772883085e-30
TBLA0A067006.313ON4973103127e-30
KLTH0F02288g1.78ON3802923042e-29
Kpol_2000.691.78ON3863042892e-27
ZYRO0F16764g1.78ON3863132325e-20
TPHA0B045201.78ON3882702122e-17
TDEL0C062301.78ON3642902112e-17
TBLA0A054101.78ON3822811943e-15
Skud_14.1012.6ON81967790.65
SAKL0G00440g2.6ON83663761.3
TBLA0B001302.6ON84259761.3
YNL238W (KEX2)2.6ON81464751.9
Suva_14.1062.6ON80964742.1
Smik_14.972.6ON81464724.0
ZYRO0F15598g2.6ON79063724.3
KAFR0A080402.6ON76663705.9
TPHA0P017902.6ON79965698.5
KLLA0D19811g2.6ON75658699.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G04550
         (564 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {O...   993   0.0  
SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar ...   667   0.0  
Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON} Y...   658   0.0  
Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YE...   658   0.0  
YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}  PR...   657   0.0  
Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON} Y...   654   0.0  
Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060...   641   0.0  
KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {...   638   0.0  
KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar ...   611   0.0  
TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] ...   612   0.0  
NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14 ...   594   0.0  
CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} simila...   578   0.0  
ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {...   575   0.0  
NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {...   580   0.0  
Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...   566   0.0  
KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {O...   559   0.0  
ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON} S...   558   0.0  
Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to ...   546   0.0  
KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14...   529   0.0  
Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] ...   519   0.0  
TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14...   477   e-162
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...   466   e-160
Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003...   463   e-158
YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putat...   459   e-157
Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...   454   e-155
CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} simila...   404   e-135
KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6...   386   e-129
NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14     350   e-115
NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {O...   327   e-105
KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON}              318   e-103
CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} som...   275   2e-84
NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {O...   190   3e-53
TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] ...   179   7e-50
ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} simila...   179   2e-49
Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON} (1383...   180   2e-49
Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar t...   176   2e-47
Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON} (14365.....   173   2e-47
KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {O...   172   7e-47
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...   172   2e-46
SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} simila...   170   3e-46
AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic ho...   174   4e-46
Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON...   169   1e-45
TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {O...   171   4e-45
KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {...   166   2e-44
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...   164   7e-44
NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313    164   9e-44
CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa...   163   2e-43
KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {...   162   3e-43
Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON...   161   2e-42
TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {O...   161   3e-42
Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] ...   149   2e-38
KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some s...   141   2e-35
Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045...   123   5e-30
TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6...   124   7e-30
KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly...   121   2e-29
Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] ...   115   2e-27
ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]...    94   5e-20
TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] ...    86   2e-17
TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] ...    86   2e-17
TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1...    79   3e-15
Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238...    35   0.65 
SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar ...    34   1.3  
TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6 Y...    34   1.3  
YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}  KEX2Subti...    33   1.9  
Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238...    33   2.1  
Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W...    32   4.0  
ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]...    32   4.3  
KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa] ...    32   5.9  
TPHA0P01790 Chr16 complement(373247..375646) [2400 bp, 799 aa] {...    31   8.5  
KLLA0D19811g Chr4 complement(1672338..1674608) [2271 bp, 756 aa]...    31   9.3  

>TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {ON}
           Anc_6.14 YOR003W
          Length = 564

 Score =  993 bits (2567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/564 (87%), Positives = 495/564 (87%)

Query: 1   MRFEQTXXXXXXXXXXXXXXXIPELKGKVLCHGKDKALDHPKDKALDHXXXXXXXXXXXX 60
           MRFEQT               IPELKGKVLCHGKDKALDHPKDKALDH            
Sbjct: 1   MRFEQTVLPVAALASLGAALVIPELKGKVLCHGKDKALDHPKDKALDHPRERPQHRGPRR 60

Query: 61  XXXXXXXXXXXXXXXXXXSHEGHHDALPEHRGIVHKMGEGVAPLSIPPNAFPHRYIVVLK 120
                             SHEGHHDALPEHRGIVHKMGEGVAPLSIPPNAFPHRYIVVLK
Sbjct: 61  GPRRGPPPPLPEGRHDGPSHEGHHDALPEHRGIVHKMGEGVAPLSIPPNAFPHRYIVVLK 120

Query: 121 HSSPEEIALHMEAITQSQLQSVGELAQDDPFFSAQGVRTTGGIQDSFDVAGLLNGYVGYF 180
           HSSPEEIALHMEAITQSQLQSVGELAQDDPFFSAQGVRTTGGIQDSFDVAGLLNGYVGYF
Sbjct: 121 HSSPEEIALHMEAITQSQLQSVGELAQDDPFFSAQGVRTTGGIQDSFDVAGLLNGYVGYF 180

Query: 181 TDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISHRERLNLGSFNKYLFDDE 240
           TDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISHRERLNLGSFNKYLFDDE
Sbjct: 181 TDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISHRERLNLGSFNKYLFDDE 240

Query: 241 AGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDLDGNGHGTHCAGTIASKHYXXXX 300
           AGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDLDGNGHGTHCAGTIASKHY    
Sbjct: 241 AGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDLDGNGHGTHCAGTIASKHYGVAK 300

Query: 301 XXXXXXXXXLRSNGSGSMSDVIKGVEFAAQSHQXXXXXXXXXXXGSTANMSLGGGKSPAL 360
                    LRSNGSGSMSDVIKGVEFAAQSHQ           GSTANMSLGGGKSPAL
Sbjct: 301 GADVVAVKVLRSNGSGSMSDVIKGVEFAAQSHQKAVKDKKKGFKGSTANMSLGGGKSPAL 360

Query: 361 DLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTLSDDRAYFSNYGKCVDI 420
           DLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTLSDDRAYFSNYGKCVDI
Sbjct: 361 DLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTLSDDRAYFSNYGKCVDI 420

Query: 421 FAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPE 480
           FAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPE
Sbjct: 421 FAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPE 480

Query: 481 QLKKKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGFWDGHDKQEANTRFQDTDLQELS 540
           QLKKKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGFWDGHDKQEANTRFQDTDLQELS
Sbjct: 481 QLKKKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGFWDGHDKQEANTRFQDTDLQELS 540

Query: 541 DNLGAKTDALFDQVRDVLDRLNII 564
           DNLGAKTDALFDQVRDVLDRLNII
Sbjct: 541 DNLGAKTDALFDQVRDVLDRLNII 564

>SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 544

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/473 (69%), Positives = 373/473 (78%), Gaps = 17/473 (3%)

Query: 107 PPNAFPHRYIVVLKH-SSPEEIALHMEAITQSQLQSVGELAQDDPFFSAQ---------- 155
           P N  PHRYI+V K  ++PEEI+ H E I+++  +SV +L   D FF+A           
Sbjct: 74  PANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFFAATKGSADEYGIA 133

Query: 156 GVRTTGGIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAP 215
              + GGIQ+SFD+A +LNGY+GYFTD VV+ IR +  V+F+E DS V ASEFDTQNGAP
Sbjct: 134 AKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVFASEFDTQNGAP 193

Query: 216 WGLSRISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTND 275
           WGLSRISHRERLNLGSFNKYL+DD+AGKGVTSYVIDTGINV H+DF GRA WGKT+P ND
Sbjct: 194 WGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQND 253

Query: 276 EDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAQSHQXX 335
           ED DGNGHGTHCAGTIAS+HY             LRSNGSG+MSDV+KGVEFAAQSHQ  
Sbjct: 254 EDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEA 313

Query: 336 XXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQ 395
                    GSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAE 
Sbjct: 314 SKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEN 373

Query: 396 AVTVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLL 455
           A+TVGASTLSDDRAYFSN+GKCVDIFAPGLN+LSTYIGS+ ATATLSGTSMASPHVAGLL
Sbjct: 374 AITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLL 433

Query: 456 TYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNGGGHGL 515
           TYFLSLQPDSDS+FF A   G+TP QLKKKLIAYSTKD+LY+LPEDTPN LIYNGGG  L
Sbjct: 434 TYFLSLQPDSDSEFFQA--SGITPAQLKKKLIAYSTKDVLYELPEDTPNYLIYNGGGQDL 491

Query: 516 KGFWDGHD---KQEANTR-FQDTDLQELSDNLGAKTDALFDQVRDVLDRLNII 564
             FW   +   K+E + + F+D  L EL ++   KTD LF++VR V D+LNII
Sbjct: 492 SDFWGKSEEQVKEEGSIQDFKDFKLSELIESFDTKTDLLFEEVRSVFDKLNII 544

>Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/483 (66%), Positives = 380/483 (78%), Gaps = 17/483 (3%)

Query: 96  KMGEGVAPL--------SIPPNAFPHRYIVVLKHSSPEEIA-LHMEAITQSQLQSVGELA 146
           +  E +APL        +  P   P+RYI+V K   P+E    H E++ Q+QLQSV  L+
Sbjct: 129 RHNEKLAPLVSTAQFDPAAMPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLS 188

Query: 147 QDDPFF-----SAQGVRTTGGIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDS 201
            +D FF     S+     TGGIQDSF++  + +GY+GYFT  +++LIR++P+VDFVE DS
Sbjct: 189 AEDAFFISTRDSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDS 248

Query: 202 PVHASEFDTQNGAPWGLSRISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDF 261
            V A++FDTQN APWGL+RISHRERLNLGSFNKYL+DD+AG+GVTSYVIDTG+NV H+DF
Sbjct: 249 VVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDF 308

Query: 262 EGRAHWGKTIPTNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDV 321
           E RA WGKTIP NDEDLDGNGHGTHCAGTIASKHY             LRSNGSG+MSDV
Sbjct: 309 EKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDV 368

Query: 322 IKGVEFAAQSHQXXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNE 381
           +KGVE+AA++HQ           GSTANMSLGGGKSPALDLAVNAAV+AGIHFAVAAGNE
Sbjct: 369 VKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNE 428

Query: 382 NQDACNTSPAAAEQAVTVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATL 441
           NQDACNTSPA+A++A+TVGASTLSDDRAYFSN+GKCVDIFAPGLNILSTYIGSDDATATL
Sbjct: 429 NQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATATL 488

Query: 442 SGTSMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPED 501
           SGTSMASPHVAGLLTYFLSLQP SDS+FF+ G   +TP+QLK KLI YSTKDIL+D+PED
Sbjct: 489 SGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPED 548

Query: 502 TPNALIYNGGGHGLKGFWDGHDKQEANTRFQDTDLQELSDNLGAKTDALFDQVRDVLDRL 561
           TPNALIYNGGG  L  FW+   K  ++   Q+ ++ E    +G+KTD +F+QVRDVLD+L
Sbjct: 549 TPNALIYNGGGQDLSAFWNDTKKSHSSRFKQELNMDEF---IGSKTDLIFEQVRDVLDKL 605

Query: 562 NII 564
           NII
Sbjct: 606 NII 608

>Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON}
           YEL060C (REAL)
          Length = 664

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/486 (67%), Positives = 384/486 (79%), Gaps = 17/486 (3%)

Query: 90  HRGIVHKMGEGVAPLSIPPNAF----PHRYIVVLKHS-SPEEIALHMEAITQSQLQSVGE 144
           HRG   K+   V+     P+A     P+RYI+V K    PEE A H E + Q+QLQSV  
Sbjct: 185 HRG---KLAPLVSTEQFNPDAITKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVEN 241

Query: 145 LAQDDPFF-----SAQGVRTTGGIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEM 199
           LA +D FF     +A      GGIQDSF++  L +GY+GYFT  +V+LIR++P+VDFVE 
Sbjct: 242 LAAEDAFFISTRDAALSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEK 301

Query: 200 DSPVHASEFDTQNGAPWGLSRISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQ 259
           DS V A++FDTQN APWGL+R+SHRERLNLGSFNKYL+DD+AG+GVTSYVIDTG+NV H+
Sbjct: 302 DSVVEATDFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHK 361

Query: 260 DFEGRAHWGKTIPTNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMS 319
           DFE RA WGKTIP NDEDLDGNGHGTHCAGTIASKHY             LRSNGSG+MS
Sbjct: 362 DFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMS 421

Query: 320 DVIKGVEFAAQSHQXXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAG 379
           DV+KGVE+AA++HQ           GSTANMSLGGGKSPALDLAVNAAV+AGIHFAVAAG
Sbjct: 422 DVLKGVEYAAKAHQKQAEEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAG 481

Query: 380 NENQDACNTSPAAAEQAVTVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATA 439
           NENQDACNTSPA+A++A+TVGASTLSDDRAYFSNYGKCVD+FAPGLNILSTYIGSD+ATA
Sbjct: 482 NENQDACNTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATA 541

Query: 440 TLSGTSMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLP 499
           TLSGTSMASPHVAGLLTYFLSLQP SDS+FF+ G   +TP+QLKKKLI YSTKDIL+D+P
Sbjct: 542 TLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIP 601

Query: 500 EDTPNALIYNGGGHGLKGFWDGHDKQEANTRF-QDTDLQELSDNLGAKTDALFDQVRDVL 558
           +DTPNALIYNGGG  L  FW+   K  +++ F Q+ +L E    +G+KTD +F+QVRDVL
Sbjct: 602 DDTPNALIYNGGGQDLSAFWNDTKKSHSSSGFKQELNLDEF---IGSKTDLIFEQVRDVL 658

Query: 559 DRLNII 564
           D+LNII
Sbjct: 659 DKLNII 664

>YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}
           PRB1Vacuolar proteinase B (yscB), a serine protease of
           the subtilisin family; involved in protein degradation
           in the vacuole and required for full protein degradation
           during sporulation; activity inhibited by Pbi2p
          Length = 635

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/460 (68%), Positives = 371/460 (80%), Gaps = 9/460 (1%)

Query: 111 FPHRYIVVLKHSSP-EEIALHMEAITQSQLQSVGELAQDDPFF-----SAQGVRTTGGIQ 164
            P+RYI+V K  +P EEI  H E + Q+QLQSV  L+ +D FF     ++      GGIQ
Sbjct: 179 IPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAGGIQ 238

Query: 165 DSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISHR 224
           DSF++  L +GY+GYFT  +V+LIR++P+VDFVE DS V A+EFDTQN APWGL+RISHR
Sbjct: 239 DSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARISHR 298

Query: 225 ERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDLDGNGHG 284
           ERLNLGSFNKYL+DD+AG+GVTSYVIDTG+N+ H+DFE RA WGKTIP NDEDLDGNGHG
Sbjct: 299 ERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGHG 358

Query: 285 THCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAQSHQXXXXXXXXXXX 344
           THCAGTIASKHY             LRSNGSG+MSDV+KGVE+AA++HQ           
Sbjct: 359 THCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKEAQEKKKGFK 418

Query: 345 GSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTL 404
           GSTANMSLGGGKSPALDLAVNAAV+ GIHFAVAAGNENQDACNTSPA+A++A+TVGASTL
Sbjct: 419 GSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVGASTL 478

Query: 405 SDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPD 464
           SDDRAYFSN+GKCVD+FAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQP 
Sbjct: 479 SDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPG 538

Query: 465 SDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGFWDGHDK 524
           SDS+FF+ G   +TP+QLKKKLI YSTKDIL+D+PEDTPN LIYNGGG  L  FW+   K
Sbjct: 539 SDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSAFWNDTKK 598

Query: 525 QEANTRFQDTDLQELSDNLGAKTDALFDQVRDVLDRLNII 564
             ++   Q+ ++ E    +G+KTD +FDQVRD+LD+LNII
Sbjct: 599 SHSSGFKQELNMDEF---IGSKTDLIFDQVRDILDKLNII 635

>Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/480 (66%), Positives = 378/480 (78%), Gaps = 13/480 (2%)

Query: 95  HKMGEGVAPLSIPPNAF----PHRYIVVLKHSSPEE-IALHMEAITQSQLQSVGELAQDD 149
           +K+   V+     P+A     P+RYIVV K   PEE +  H E++ Q+QLQSV  L+ +D
Sbjct: 132 NKLAPLVSTAQFNPDAISKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAED 191

Query: 150 PFFSAQ-----GVRTTGGIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVH 204
            FF++           GGIQDSF++  + +GY+GYFT  +++LIR++P+VDFVE DS V 
Sbjct: 192 AFFTSTRDTYLSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVE 251

Query: 205 ASEFDTQNGAPWGLSRISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGR 264
           A+EFDTQN APWGL+RISHRERLNLGSFNKYL+DD+AG+GVTSYVIDTG+N+ H+DFE R
Sbjct: 252 ATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKR 311

Query: 265 AHWGKTIPTNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDVIKG 324
           A WGKTIP NDEDLDGNGHGTHCAGTIASKHY             LRSNGSG+MSDV+KG
Sbjct: 312 AIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKG 371

Query: 325 VEFAAQSHQXXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQD 384
           VE+AA++HQ           GSTANMSLGGGKSPALDLAVNAAV+AGIHFAVAAGNENQD
Sbjct: 372 VEYAAKAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQD 431

Query: 385 ACNTSPAAAEQAVTVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGT 444
           ACNTSPA+A++A+TVGASTLSDDRAYFSN+GKCVD+FAPGLNILSTYIGSD+ATATLSGT
Sbjct: 432 ACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGT 491

Query: 445 SMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPN 504
           SMASPHVAGLLTYFLSLQP SDS+FF+ G   +TP+QLKKKLI YSTKDIL+D+PEDTPN
Sbjct: 492 SMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPN 551

Query: 505 ALIYNGGGHGLKGFWDGHDKQEANTRFQDTDLQELSDNLGAKTDALFDQVRDVLDRLNII 564
            LIYNGGG  L  FW+   K   +    + ++ E    +G+KTD LF+QVRDVLD+LNII
Sbjct: 552 FLIYNGGGQDLSAFWNDTKKSHPSGSKHELNMDEF---IGSKTDLLFEQVRDVLDKLNII 608

>Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060C
           (PRB1) - vacuolar protease B [contig 185] FULL
          Length = 543

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/482 (67%), Positives = 372/482 (77%), Gaps = 17/482 (3%)

Query: 98  GEGVAPLSIPPN---AFPHRYIVVLK-HSSPEEIALHMEAITQSQLQSVGELAQDDPFFS 153
           G  ++PL    N   A PHRYIVV K    PEE+  HME ++++  QSVG+L  +D FF 
Sbjct: 64  GVTLSPLVTARNMYDAIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFE 123

Query: 154 A-----QGVRTT---GGIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHA 205
           A      G+  T   GGI DSFDV G+L GY+GYFT  +V+ IR +P+V FVE DS V+A
Sbjct: 124 ATMDEEMGIMATSREGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYA 183

Query: 206 SEFDTQNGAPWGLSRISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRA 265
           +EFDTQNGAPWGLSRISHRE+LNLGSFNKYL+DD AGKGVTSYVIDTGIN+ H+DFEGRA
Sbjct: 184 NEFDTQNGAPWGLSRISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRA 243

Query: 266 HWGKTIPTNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDVIKGV 325
            WGKT+PTND D DGNGHGTHCAGTIASKHY             LRSNGSGSMSDV+KGV
Sbjct: 244 AWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGV 303

Query: 326 EFAAQSHQXXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDA 385
           EFAA+SHQ           GSTANMSLGGGKSPALD+AVNAAVKAGIHFAVAAGNENQDA
Sbjct: 304 EFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDA 363

Query: 386 CNTSPAAAEQAVTVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTS 445
           CN+SPAAAE A+TVGASTL+DDRAYFSN+GKCVDIFAPGLN+LSTYIGS+ ATATLSGTS
Sbjct: 364 CNSSPAAAENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTS 423

Query: 446 MASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNA 505
           MASPHVAGLLTYFLSLQPDSDS++F A   G+TP QLKKKLIAYSTK+ L DLPEDT N 
Sbjct: 424 MASPHVAGLLTYFLSLQPDSDSEYFHAAG-GITPSQLKKKLIAYSTKNALGDLPEDTVNY 482

Query: 506 LIYNGGGHGLKGFWDGHDKQEANTRFQD---TDLQELSDNLGAKTDALFDQVRDVLDRLN 562
           LIYNGGG  L  FW   D +E     +D   ++ + + D L  KTD L++++R++ + LN
Sbjct: 483 LIYNGGGQDLDDFW-VKDLEEKVADAKDNTASEFESIIDALEEKTDGLYEEIREIFEGLN 541

Query: 563 II 564
           II
Sbjct: 542 II 543

>KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 550

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/477 (66%), Positives = 366/477 (76%), Gaps = 26/477 (5%)

Query: 110 AFPHRYIVVLKHS-SPEEIALHMEAITQSQLQSVGELAQDDPFFSA-------------- 154
           A PHRYIVV K + SPEE+  H + ++++ LQSV +L     FF++              
Sbjct: 78  AIPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDY 137

Query: 155 ----QGVRTTGGIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDT 210
                     GGIQDSFDV+GLL GY+GYFTD +V+ IR +P+VDFVE DS V A EF T
Sbjct: 138 QRSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGT 197

Query: 211 QNGAPWGLSRISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKT 270
           QNGAPWGLSRISHRE+LNLGSFNKYL+DD+AGKGVTSYVIDTG+NV H+DFEGRA WGKT
Sbjct: 198 QNGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKT 257

Query: 271 IPTNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAQ 330
           IPTND D DGNGHGTHCAGTIASKHY             LRSNGSGSMSDV+KGVEFAA+
Sbjct: 258 IPTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAK 317

Query: 331 SHQXXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSP 390
           SHQ           GSTANMSLGGGKSPALD+AVNAAVKAGIHFAVAAGNENQDACN+SP
Sbjct: 318 SHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSP 377

Query: 391 AAAEQAVTVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPH 450
           A+AE AVTVGASTL+DDRAYFSN+GKCVDIFAPGLN+LSTYIGSD ATATLSGTSMASPH
Sbjct: 378 ASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPH 437

Query: 451 VAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNG 510
           VAGLLTYFLSLQPDSDS++F A   G+TP QLKKKLIAYSTK++L D+P+DT N LI+NG
Sbjct: 438 VAGLLTYFLSLQPDSDSEYFHAAG-GITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNG 496

Query: 511 GGHGLKGFWDGHDKQEANTRFQDT---DLQELSDNLGAKTDALFDQVRDVLDRLNII 564
           GG GL  FW    K+      +DT   +++   D L  KTD L++++R+V D +NII
Sbjct: 497 GGEGLDDFW---GKESVVDEVEDTISSEIESFIDALEEKTDVLYEEIREVFDHMNII 550

>KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 561

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/483 (63%), Positives = 369/483 (76%), Gaps = 24/483 (4%)

Query: 101 VAPLSIP---PNAFPHRYIVVLKH-SSPEEIALHMEAITQSQLQSVGELAQDDPFFSAQ- 155
           +APLS      N  P+RYI+V K  +S +E+  H E ++    +++G LA +DPFF+A  
Sbjct: 84  LAPLSTVNDIANKIPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATS 143

Query: 156 ------GVRT---TGGIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHAS 206
                 GV+     GGIQDSFD+AG L+GYVGYFT  V++ IR+SP+V+FVE DS V ++
Sbjct: 144 GEHSEFGVKAHSLEGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSN 203

Query: 207 EFDTQNGAPWGLSRISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAH 266
            F+TQN APWGL+RISHRE+LNLGSFNKYL+DD+AGKGVT+YV+DTG+NV H+DF+GRA 
Sbjct: 204 SFNTQNSAPWGLARISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAV 263

Query: 267 WGKTIPTNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDVIKGVE 326
           WGKTIP +D D+DGNGHGTHCAGTI S HY             LRSNGSG+MSDV+KGVE
Sbjct: 264 WGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVE 323

Query: 327 FAAQSHQXXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDAC 386
           + A++H+           GSTANMSLGGGKSPALDLAVNAAVKAG+HFAVAAGNENQDAC
Sbjct: 324 YVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDAC 383

Query: 387 NTSPAAAEQAVTVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSM 446
           NTSPAAAE A+TVGASTLSD+RAYFSN+GKCVDIF PGLNILSTYIGSD ATATLSGTSM
Sbjct: 384 NTSPAAAENAITVGASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSM 443

Query: 447 ASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNAL 506
           A+PHV GLLTYFLSLQPD+DS++F A   G+TP QLKKKLI +STK++L DLPEDT N L
Sbjct: 444 ATPHVVGLLTYFLSLQPDADSEYFHAAG-GITPSQLKKKLIDFSTKNVLSDLPEDTVNYL 502

Query: 507 IYNGGGHGLKGFWDGHD-----KQEANTRFQDTDLQELSDNLGAKTDALFDQVRDVLDRL 561
           IYNGGG  L   W G D     +  AN  F    L+ L ++L +KTDA+FD VR +LD+ 
Sbjct: 503 IYNGGGQDLDDLW-GKDYSIGKEPSANPEFS---LESLINSLDSKTDAIFDDVRQLLDQF 558

Query: 562 NII 564
           NII
Sbjct: 559 NII 561

>TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa]
           {ON} Anc_6.14 YOR003W
          Length = 573

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/471 (63%), Positives = 356/471 (75%), Gaps = 13/471 (2%)

Query: 100 GVAPLSI----PPNAFPHRYIVVLKHS-SPEEIALHMEAITQSQLQSVGELAQDDPFF-S 153
            +APL      P N  PHRYI+  K   +PEEI  H ++I + Q QS+ +L  D P+F S
Sbjct: 110 AIAPLYSQSLHPQNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNS 169

Query: 154 AQGVRTTGGIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNG 213
            +G+     I DSF++  LL GY+GYFTD V++ IR +P+V FVE DS V+ +EFDTQNG
Sbjct: 170 VEGLDLQQPIIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNG 229

Query: 214 APWGLSRISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPT 273
           APWGL+RISHRERLNLGSFNKYLFDD+AG+GVT+YVIDTG+NV+H DFEGRA WGKTIP 
Sbjct: 230 APWGLARISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPN 289

Query: 274 NDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAQSHQ 333
           NDEDLDGNGHGTHCAGTIASKHY             LRSNGSGSMSDV+KGVE+A  SH 
Sbjct: 290 NDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVLKGVEYATASHL 349

Query: 334 XXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAA 393
                      GSTANMSLGGGKSP+LDLAVNAAVKAGIHFAVAAGNENQDACNTSPA+A
Sbjct: 350 ADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASA 409

Query: 394 EQAVTVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAG 453
           + A+TVGASTLSDDRAYFSN+GKCVD+FAPGLNILSTYIGSDDATATLSGTSMASPHVAG
Sbjct: 410 KYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAG 469

Query: 454 LLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNGGGH 513
           LL+YFLSLQP+ DS+F  +   G+TP QLKK+LI+Y TKDIL D+PE TPN L++NG G 
Sbjct: 470 LLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQ 529

Query: 514 GLKGFWDGHDKQEANTRFQDTDLQELSDNLGAKTDALFDQVRDVLDRLNII 564
            L  FW+        ++  D +  E+  NL    D L+DQ   +  ++N++
Sbjct: 530 DLSDFWN-------ISKPADLESNEVYKNLDLVGDVLYDQFTGIFKKMNLL 573

>NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14
           YEL060C
          Length = 695

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/421 (70%), Positives = 332/421 (78%), Gaps = 7/421 (1%)

Query: 111 FPHRYIVVLKHSS-PEEIALHMEAITQSQLQSVGELAQDDPFFSAQGVR----TTGGIQD 165
            P+RYIVV K S  PEE+  H E I Q QL+S  +L +DD FFSA  +       GGI  
Sbjct: 99  IPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFFSASAIEDESINQGGILT 158

Query: 166 SFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISHRE 225
           +F+++ LLNGYVGYFTD V+ELIR +P+V++VE DS V A+EFD QN APWGL+RISHRE
Sbjct: 159 TFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHRE 218

Query: 226 RLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDLDGNGHGT 285
           RLNLGSFNKYL+DD+AGKGVT YVIDTGIN +H DF  RA WGKTIP ND+D+DGNGHGT
Sbjct: 219 RLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHGT 278

Query: 286 HCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAQSHQXXXXXXXXXXXG 345
           HCAGTIAS HY             LRSNGSGSMSDVIKGVEFAA+SH            G
Sbjct: 279 HCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAESHIKAAKEKKKGFKG 338

Query: 346 STANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTLS 405
           STANMSLGGGKSP LDLAVNAAV AGIHFAVAAGNENQDACNTSPA+AE+A+TVGASTLS
Sbjct: 339 STANMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTLS 398

Query: 406 DDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPDS 465
           DDRAYFSN+GKCVDIFAPGLNILSTYIG DDATATLSGTSMASPHVAGLLTYFLSLQP S
Sbjct: 399 DDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQPGS 458

Query: 466 DSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGFWDGHDKQ 525
           DS+FFD     +TP Q+KKKLI YS+KD+L+DLPE TPN LI+NG G  L   W+   ++
Sbjct: 459 DSEFFDPTE--LTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLWNKKSQE 516

Query: 526 E 526
           E
Sbjct: 517 E 517

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 29/47 (61%), Gaps = 2/47 (4%)

Query: 520 DGHDKQEANTRFQDTDLQ--ELSDNLGAKTDALFDQVRDVLDRLNII 564
           DG +  + N +     +   +L+ +LG  +D++F Q+RD+ DR++I+
Sbjct: 649 DGEEDHKDNKKHHQEQISPADLAKSLGTSSDSVFQQIRDMFDRMDIL 695

>CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} similar
           to uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
           protease B or uniprot|P25036 Saccharomyces cerevisiae
           YOR003w YSP3
          Length = 468

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/468 (63%), Positives = 357/468 (76%), Gaps = 17/468 (3%)

Query: 112 PHRYIVVLKHS-SPEEIALHMEAITQSQLQSVGELAQDDPFFS---AQGVRTTGGIQDSF 167
           PH+YIVVLK   SPE +A  +  ++ +   ++ +L ++  FF+   A+G+   GGI+D F
Sbjct: 3   PHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEGL-PRGGIKDLF 61

Query: 168 DVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISHRERL 227
           ++  L  G +GYF + VV+L+ KS +V+FVE DS VHAS FDTQN APWGL+RISHR+RL
Sbjct: 62  NINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISHRDRL 121

Query: 228 NLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDLDGNGHGTHC 287
           NLG+FNKYL+D+  G+GVT+YVIDTGINVKH +F+GRA WGKTIP ND D+DGNGHGTHC
Sbjct: 122 NLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGHGTHC 181

Query: 288 AGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAQSHQXXXXXXXXXXXGST 347
           AGTIASKHY             L+S+GSG+MSDVIKGVE+AAQ+H            GST
Sbjct: 182 AGTIASKHYGIAKKANVVAVKVLKSDGSGTMSDVIKGVEYAAQAH-LKESKNNKKFKGST 240

Query: 348 ANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTLSDD 407
           ANMSLGGGKSPALD+AVNAAV AGIHFAVAAGNENQDACNTSPA+AE+A+TVGASTLSDD
Sbjct: 241 ANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGASTLSDD 300

Query: 408 RAYFSNYGKCVDIFAPGLNILSTYIG-SDDATATLSGTSMASPHVAGLLTYFLSLQPDSD 466
           RAYFSN+GKCVDIFAPGLNILSTYIG ++  TA+LSGTSMASPHVAGLLTYFLSLQPDSD
Sbjct: 301 RAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQPDSD 360

Query: 467 SDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPE-DTPNALIYNGGGHGLKGFWDG---- 521
           S+F+DA   GVTP QLKKKLIAYSTK++L DLP+ D+PN LIYNG G  L  FW+     
Sbjct: 361 SEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFWNSTSAD 420

Query: 522 -----HDKQEANTRFQDTDLQELSDNLGAKTDALFDQVRDVLDRLNII 564
                H +Q          L ++  +  A TD+LF QVR++LD++NII
Sbjct: 421 EQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII 468

>ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 548

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/477 (61%), Positives = 353/477 (74%), Gaps = 19/477 (3%)

Query: 102 APLSIPPN---AFPHRYIVVLKHS-SPEEIALHMEAITQSQLQSVGELAQDDPFFSAQGV 157
           APL +P +      +RYI++ K   +P+EI  H E I Q  LQ V +L ++  FF  +G+
Sbjct: 77  APLVVPEDTLGVLENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQLPEEHSFF--EGI 134

Query: 158 RT-------TGGIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDT 210
           R         GGI  +FD+ G+L GY GYF   V+++IR SP+++ VE DS V+  + DT
Sbjct: 135 RLDGVYDSPLGGIDHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVVYTQKADT 194

Query: 211 QNGAPWGLSRISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKT 270
           +NGAPWGL+RISHRERLNLGS+NKYL+D++ G GVTSYVIDTG+NV H  F GRA WGKT
Sbjct: 195 ENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGGRAKWGKT 254

Query: 271 IPTNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAQ 330
           IP  D D DGNGHGTHCAGTI S  Y             LRSNGSGSMSDV+KGVE+AAQ
Sbjct: 255 IPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEWAAQ 314

Query: 331 SHQXXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSP 390
            HQ           GSTANMSLGGGKSP+LD AVNAAV AG++FAVAAGNE+QDACNTSP
Sbjct: 315 DHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQAVNAAVAAGLNFAVAAGNEDQDACNTSP 374

Query: 391 AAAEQAVTVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPH 450
           A+A   +TVGASTLSDDRAYFSNYGKCVD+FAPGLNILSTYIGSD +TATLSGTSMASPH
Sbjct: 375 ASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDSSTATLSGTSMASPH 434

Query: 451 VAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNG 510
           VAGLL YFLSLQP SDS+ FDAGS  ++P+QLKKKL+A+STKD+L D+P  TPN LIYNG
Sbjct: 435 VAGLLAYFLSLQPGSDSE-FDAGSS-ISPDQLKKKLLAFSTKDVLSDIPSGTPNLLIYNG 492

Query: 511 GGHGLKGFWDGHD---KQEANTRFQDTDLQELSDNLGAKTDALFDQVRDVLDRLNII 564
           GG  L GFW   +   + E N +  D +L +L D LG+KTDA+F Q+R ++DRL+II
Sbjct: 493 GGGDLSGFWGSKEVAQELEFNEKV-DLELHDLVDELGSKTDAVFGQIRGLMDRLDII 548

>NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {ON}
           Anc_6.14
          Length = 704

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/470 (63%), Positives = 353/470 (75%), Gaps = 14/470 (2%)

Query: 108 PNAFPHRYIVVLKHS-SPEEIALHMEAITQSQLQSVGELAQDDPFFSAQGVRT-----TG 161
           P   P++YI+V K S + +EI+ H E I++ Q QS   L     FF +           G
Sbjct: 236 PRILPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPHHHFFHSTSEEEEESFRNG 295

Query: 162 GIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRI 221
           GI  SF++  +L+GY GYFT  V++LIR +P+V +VE DS V  +EF+TQN APWGLSRI
Sbjct: 296 GIISSFNINNILSGYSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGLSRI 355

Query: 222 SHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDLDGN 281
           SHRERLNLGSFNKYL+DD+AGKGVT +VIDTGINV H DF  RA WGKTIP+ND+D+DGN
Sbjct: 356 SHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDIDGN 415

Query: 282 GHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAQSHQXXXXXXXX 341
           GHGTHCAGTIAS HY             LRSNGSGSMSDVIKGVEFAA++H         
Sbjct: 416 GHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAETH-LNNEKNKK 474

Query: 342 XXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGA 401
              GSTANMSLGGGKSP LDLAVNAAV+AGIHF+VAAGNENQDACN+SPA+AE A+TVGA
Sbjct: 475 DYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITVGA 534

Query: 402 STLSDDRAYFSNYGKCVDIFAPGLNILSTYIGS-DDATATLSGTSMASPHVAGLLTYFLS 460
           STLSDDRAYFSN+G+CVD+FAPGLNILSTY+G  +D TATLSGTSMASPHVAGLLTYFLS
Sbjct: 535 STLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYFLS 594

Query: 461 LQPDSDSDFFDAGSQG-VTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGFW 519
           LQPDS S FF++ S G +TPEQLKKKLIAYST DILYDLP+ TPN LIYNG G  +   W
Sbjct: 595 LQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYNGAGGDISDLW 654

Query: 520 DGHDKQEANTRFQDTD---LQEL--SDNLGAKTDALFDQVRDVLDRLNII 564
           +G  +++A+      D    + L  SD++  KTD  FDQ+R+V +++NII
Sbjct: 655 NGKVQEQAHEEPAHEDKINFENLVDSDSMSGKTDLFFDQIRNVFEKMNII 704

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
           [2043 nt, 681 aa]
          Length = 680

 Score =  566 bits (1458), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/481 (59%), Positives = 357/481 (74%), Gaps = 19/481 (3%)

Query: 95  HKMGEGV--APLSIPPN------AFPHRYIVVLKHS-SPEEIALHMEAITQSQLQSVGEL 145
            K GE V  APL    N        P++YI+V K   S +++ +H + I ++Q Q     
Sbjct: 208 EKSGEKVKYAPLHSMENTKYENLVIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQYAS-- 265

Query: 146 AQDDPFFSAQGVRTTGGIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHA 205
             D+   S       GGI+++F+VA L +GY+G+F + +V+ IR SP+VDFVE DS VHA
Sbjct: 266 VSDETSSS-----ILGGIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHA 320

Query: 206 SEFDTQNGAPWGLSRISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRA 265
           +E DTQN APWGL+RISHR+ LNLGS+NKYL+DD AG+GVT+YVIDTGIN+KH++F GRA
Sbjct: 321 NEVDTQNNAPWGLARISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRA 380

Query: 266 HWGKTIPTNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDVIKGV 325
            WGKTIP ND+D+DGNGHGTHCAGTIASK+Y             LRS+GSG+MSDV+KGV
Sbjct: 381 VWGKTIPENDQDVDGNGHGTHCAGTIASKNYGVAKNAEVVAVKVLRSDGSGTMSDVLKGV 440

Query: 326 EFAAQSHQXXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDA 385
           E+AA SHQ           GSTANMSLGGGKS +LDLAV+AAVK+GIHFAVAAGNENQDA
Sbjct: 441 EYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDA 500

Query: 386 CNTSPAAAEQAVTVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTS 445
           CN+SPAA+E A+TVGASTLSDDRAYFSN+GKCVD+FAPGLNILSTYIGSD+ATATLSGTS
Sbjct: 501 CNSSPAASENAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTS 560

Query: 446 MASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNA 505
           MASPHVAGLL+YFLS+QPD+DS+FF +GS  ++P QLKKKLIAYSTK++  DLPE TPN 
Sbjct: 561 MASPHVAGLLSYFLSMQPDADSEFFSSGSNSISPAQLKKKLIAYSTKNLFQDLPEKTPNL 620

Query: 506 LIYNGGGHGLKGFW--DGHDKQEANTRFQDTDLQELSDNLGAKTDALFDQVRDVLDRLNI 563
           L+YN  GH +  FW        E N R ++ +L++L D+     D   + ++ V +R+++
Sbjct: 621 LVYN-AGHNISDFWKPKSESSAEPNERAKEFELEDLVDSAQWIADTWLNGIQQVFERMDL 679

Query: 564 I 564
            
Sbjct: 680 F 680

>KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {ON}
           Anc_6.14 YOR003W
          Length = 531

 Score =  559 bits (1440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/496 (59%), Positives = 348/496 (70%), Gaps = 28/496 (5%)

Query: 80  HEGHHDALPEHRGIVHKMG----EGVAPLSIP------PNAFPHRYIVVLKHS-SPEEIA 128
           H G      EHR   H       E +APL  P       ++  ++YI++ K   + E+I+
Sbjct: 53  HHGPKHEKDEHRPCKHGKEAHDEEELAPLYTPGSALSASSSRSNKYIILFKEGVTAEQIS 112

Query: 129 LHMEAITQSQLQSVGELAQDDPFFSAQGVRTTGGIQDSFDVAGLLNGYVGYFTDAVVELI 188
            H + + Q  L++           SAQG+     + DSFD+ G+L+GYV   +  V+EL+
Sbjct: 113 AHKQLLQQVLLETSD--------VSAQGI--VADVLDSFDLEGVLSGYVAELSPMVLELV 162

Query: 189 RKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISHRERLNLGSFNKYLFDDEAGKGVTSY 248
           R+SP V  VE DS VH +EFDTQN APWGL+RISHR+ L+LGSFNKYL+DD AG+GV SY
Sbjct: 163 RRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDPLSLGSFNKYLYDDAAGEGVDSY 222

Query: 249 VIDTGINVKHQDFEGRAHWGKTIPTNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXX 308
           +IDTGINVKH++FEGRA WGKTIP ND D DGNGHGTHCAGTIASKHY            
Sbjct: 223 IIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVK 282

Query: 309 XLRSNGSGSMSDVIKGVEFAAQSHQXXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAV 368
            LRSNGSGSMSDVI GVEFAA+ H            GSTANMSLGGGKSP+LD  V+AAV
Sbjct: 283 VLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAV 342

Query: 369 KAGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTLSDDRAYFSNYGKCVDIFAPGLNIL 428
           K G+HF+VAAGNENQDACNTSPAA+E+A+TVGASTLSDDRAYFSN+G CVDIFAPGLNIL
Sbjct: 343 KLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSDDRAYFSNWGSCVDIFAPGLNIL 402

Query: 429 STYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIA 488
           STY GSDDATATLSGTSMASPHVAGLLTYFLSLQP+  S F    S  +TPEQLKKKL+ 
Sbjct: 403 STYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPEKSSQF--GTSAQITPEQLKKKLLD 460

Query: 489 YSTKDILYDLPEDTPNALIYNGGGHGLKGFWDGHDKQEANTRFQDTDLQELSDNLGAKTD 548
           YSTK +L+DLPEDTPNALIYNGGG  L  FW    K+     F         DN+ A +D
Sbjct: 461 YSTKGVLFDLPEDTPNALIYNGGGADLSDFWGDKGKKSHKPLFAHE-----YDNVWASSD 515

Query: 549 ALFDQVRDVLDRLNII 564
           A+F+QVR +  +LNI 
Sbjct: 516 AMFEQVRAMFGKLNIF 531

>ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL060C
           (PRB1) and YOR003W (YSP3)
          Length = 541

 Score =  558 bits (1437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/474 (60%), Positives = 338/474 (71%), Gaps = 21/474 (4%)

Query: 110 AFPHRYIVVLKHS-SPEEIALHMEAITQSQLQSVGELAQDDPFF-SAQG---------VR 158
           A PH+YIVV +   S EE A HME +  +  +SV  L +   FF S +G          R
Sbjct: 70  AIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGENNEFGIAATR 129

Query: 159 TTGGIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGL 218
             GGI+  F +   L GYVGYFT+ +V L+R +P V FVE DS V AS+F TQNGAPWGL
Sbjct: 130 AEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPWGL 189

Query: 219 SRISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDL 278
           +R+SHRE+LN GSFNKYL+DD +G+GVTSYVIDTGIN+ H DFE RA WGKTIP ND D 
Sbjct: 190 ARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDADY 249

Query: 279 DGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAQSHQXXXXX 338
           DGNGHGTHCAGTIASK Y             LRSNG+GSMSDV++GVE+A ++H+     
Sbjct: 250 DGNGHGTHCAGTIASKTYGVAKKANVVAVKVLRSNGTGSMSDVLRGVEYAVKAHRKAAEK 309

Query: 339 XXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVT 398
                 GSTANMSLGGG+S ALDLAV+AAV AGIHFAVAAGNENQDACNTSPAA+++A+T
Sbjct: 310 ADKGFKGSTANMSLGGGRSQALDLAVDAAVDAGIHFAVAAGNENQDACNTSPAASQKAIT 369

Query: 399 VGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYF 458
           VGASTL+DDRAYFSN+G+CVD+FAPG+NILSTYIGSD A ATLSGTSMASPHVAGLLTYF
Sbjct: 370 VGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPHVAGLLTYF 429

Query: 459 LSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGF 518
           LSLQPD DS+F +   Q ++PE LKKK+I + TKD L  LP  T N LIYNGGG  L  F
Sbjct: 430 LSLQPDGDSEFRN--KQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGGGADLSDF 487

Query: 519 WDGHDKQEANTRF--------QDTDLQELSDNLGAKTDALFDQVRDVLDRLNII 564
           W    K+ +  +F          +DL  L   L + TDA+F   R +LDR+NII
Sbjct: 488 WGNKPKKVSGPKFTYADDEEAMGSDLDRLIHELESSTDAMFSGFRTILDRMNII 541

>Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to
           Ashbya gossypii ACR012C
          Length = 575

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/481 (56%), Positives = 353/481 (73%), Gaps = 21/481 (4%)

Query: 101 VAPLSIPPNAFPHRYIVVLKHSSPE-EIALHMEAITQSQLQSVGELAQDDPFFSA----- 154
           +A LS    A PHRYIV+ K    + ++ +H + +T + ++++ +L     FF A     
Sbjct: 99  LASLSDNSRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMH 158

Query: 155 -QGVR---TTGGIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDT 210
            +G+      GGI++ F++AG L GY GYFTD +++LIR+S +V  +E DS VHAS+F+T
Sbjct: 159 HEGISARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFET 218

Query: 211 QNGAPWGLSRISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKT 270
           Q GAPWGL+R+SHRERLNLGSFNKYL+DD AGKGVT+YVIDTGIN+ H +FEGRA WGKT
Sbjct: 219 QTGAPWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKT 278

Query: 271 IPTNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAQ 330
           IP+ND D DGNGHGTHCAGTIASK Y             LR+NG+G+MSDV++GVE+   
Sbjct: 279 IPSNDADYDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVA 338

Query: 331 SHQXXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSP 390
            H+           GSTANMSLGGGKS AL+LAV+AAV AGIHFAVAAGNENQDACNTSP
Sbjct: 339 EHR--KASGDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSP 396

Query: 391 AAAEQAVTVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPH 450
           A++++ +TV ASTLSDDRAYFSN+G CVDIFAPGLNILSTYIGSD A ATLSGTSMASPH
Sbjct: 397 ASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPH 456

Query: 451 VAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNG 510
           VAGLL YFLSLQPDS S+++   S  ++PE LKKK++AY +K++L ++P  T N LI+NG
Sbjct: 457 VAGLLAYFLSLQPDSGSEYYTGSS--ISPEALKKKIVAYGSKNLLNNVPARTANNLIFNG 514

Query: 511 GGHGLKGFW----DGHDKQEANT---RFQDTDLQELSDNLGAKTDALFDQVRDVLDRLNI 563
           GG  L  FW    DG ++++ ++   +  D + + L D L + + +LF ++R+ LDRL++
Sbjct: 515 GGGSLDSFWNSKCDGCEQEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDL 574

Query: 564 I 564
           I
Sbjct: 575 I 575

>KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14
           YOR003W
          Length = 502

 Score =  529 bits (1362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/456 (58%), Positives = 323/456 (70%), Gaps = 20/456 (4%)

Query: 109 NAFPHRYIVVLKHS-SPEEIALHMEAITQSQLQS-------VGELAQDDPFFSAQGVRTT 160
           N  PHRYI+V K   S E+I  H E IT   LQ          E  Q D        ++ 
Sbjct: 56  NIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDINVPESMRQSL 115

Query: 161 GGIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSR 220
           GGI   FD++ LL+GY+ Y +D ++  IR +P++ F+E D+ VH ++F+TQN APWGL+R
Sbjct: 116 GGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNAPWGLAR 175

Query: 221 ISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDLDG 280
           ISHRE LNL +FNKYL+DD+AGK V +YVIDTG++V H +F  RAHWGKTIP ND+D+DG
Sbjct: 176 ISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLNDQDIDG 235

Query: 281 NGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAQSHQXXXXXXX 340
           NGHGTH AGTI S+HY             LRSNGSGSMSDV+KGVEFA  SH        
Sbjct: 236 NGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSH-LERMKNE 294

Query: 341 XXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVG 400
               GS ANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQ+ACN+SPA+AEQAVTVG
Sbjct: 295 KNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQAVTVG 354

Query: 401 ASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGS-DDATATLSGTSMASPHVAGLLTYFL 459
           AST+SD+RAYFSN+G+CVDIFAPGLNILSTYIG+ DD TATLSGTSMASPHVAGLL Y+L
Sbjct: 355 ASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGLLAYYL 414

Query: 460 SLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGFW 519
           SLQP+  S+F    ++ ++  QLKKKLI Y+TKD+L DLPE TPN LIYNGGG  L  FW
Sbjct: 415 SLQPEKSSEF---STRAISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGGGQDLSDFW 471

Query: 520 DGHDKQEANTRFQDTDLQELSDNLGAKTDALFDQVR 555
           +  + +   + +       +  N  +K   LFD + 
Sbjct: 472 NLQNSKIPGSNY-------IGYNYFSKLKTLFDDLN 500

>Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa]
           {ON} complement(174972..176405) [1434 nt, 478 aa]
          Length = 477

 Score =  519 bits (1337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/477 (56%), Positives = 331/477 (69%), Gaps = 30/477 (6%)

Query: 99  EGVAPLS-IPPNA--FPHRYIVVLKHS-SPEEIALHMEAITQSQLQSVGELAQDDPFFSA 154
           E V P S I PN+   P+ YIVV     +  EI+LH+E ++Q QLQSV +L  D  FF+ 
Sbjct: 20  EEVRPASLITPNSEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTI 79

Query: 155 QGVR------TTGGIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEF 208
                       GG++D F +   L+GY G FTD VVE +R SP+V F+E DS VH +E 
Sbjct: 80  STSSDVNSNGLLGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEA 139

Query: 209 DTQNGAPWGLSRISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWG 268
            TQ  APWGL+RISHR RLNL +FNKYL+DD  GKGV +YVIDTGIN+ + DF GRA+WG
Sbjct: 140 TTQYNAPWGLARISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWG 199

Query: 269 KTIPTNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFA 328
           KTIP  + ++DGNGHGTH AGTIAS HY             LRSNG+GSMSDV+KGVE+ 
Sbjct: 200 KTIPAGEANVDGNGHGTHVAGTIASIHYGVAKQVKVYAVKVLRSNGAGSMSDVLKGVEYV 259

Query: 329 AQSHQXXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNT 388
             +HQ           GS ANMSLGGGKS +LDLAVNAAV AG+HFAVAAGNENQDACNT
Sbjct: 260 VGAHQ--RDVGTAGFKGSVANMSLGGGKSRSLDLAVNAAVGAGVHFAVAAGNENQDACNT 317

Query: 389 SPAAAEQAVTVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMAS 448
           SPAAAE+A+TVGASTLSD RAYFSN+G+CV IFAPGLNILSTYIGS DATATLSGTSMAS
Sbjct: 318 SPAAAERAITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMAS 377

Query: 449 PHVAGLLTYFLSLQPDSDSDFFDAG-SQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALI 507
           PH+AGL+ YFLSLQP   S F+  G +  +TP+QLKKK++A+ TK+ L DLP +TPN + 
Sbjct: 378 PHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIA 437

Query: 508 YNGGGHGLKGFWDGHDKQEANTRFQDTDLQELSDNLGAKTDALFDQVRDVLDRLNII 564
           YNG G  L+ FW+ +D  +        + Q L          + +Q++ +L+++NI 
Sbjct: 438 YNGAGKSLEDFWNANDYVK--------NYQSL---------VITEQLQFILNKMNIF 477

>TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14
           YOR003W
          Length = 585

 Score =  477 bits (1227), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 250/414 (60%), Positives = 306/414 (73%), Gaps = 12/414 (2%)

Query: 114 RYIVVLKHSS-PEEIALHMEAITQSQLQSVGELAQDDPFFSAQGVRT-TGGIQDSFDVAG 171
           RYI+V K     E++  H++ ++ +  + + E  +      A  +R     + D+F+VAG
Sbjct: 135 RYIIVFKKGVFKEQVDQHLKMMS-ALFRRLSEEQRPAAAPGASALRDGFDRVMDTFEVAG 193

Query: 172 LLNGYVGYF-TDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISHRERLNLG 230
             +GY+    +  +V+ IR +P+VD+VE DS VH+ + +TQN APWGL+RISHRE LNLG
Sbjct: 194 AFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPWGLARISHREGLNLG 252

Query: 231 SFNKYLF-DDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDLDGNGHGTHCAG 289
           +FNKYL+  + AGKGVT+YV+DTGI+V H +F  RA WGKTIP ND D+DGNGHGTHCAG
Sbjct: 253 NFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGHGTHCAG 312

Query: 290 TIASKHYXXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAQSH----QXXXXXXXXXXXG 345
           TI S+HY             LRS+GSG+MSDV+KGVE+ A  H    +           G
Sbjct: 313 TIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKNSNYKG 372

Query: 346 STANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTLS 405
           +TANMSLGGGKSPALD AVNAAVKAG+HFAVAAGNENQDACN+SPAAAE A+TVGASTLS
Sbjct: 373 ATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVGASTLS 432

Query: 406 DDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPDS 465
           DDRAYFSNYGKCVDIFAPGLNILSTYIG++DATATLSGTSMASPHVAGLLTY LSLQPD 
Sbjct: 433 DDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYLLSLQPDK 492

Query: 466 DSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGFW 519
            S+F+   S+ +TP Q+KKK+I Y+TK+ L DLP DTPN LIYNGG +    FW
Sbjct: 493 GSEFYVPNSE-LTPLQMKKKIIDYATKNALADLPADTPNKLIYNGGFNSTD-FW 544

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
           (REAL)
          Length = 476

 Score =  466 bits (1199), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 226/414 (54%), Positives = 296/414 (71%), Gaps = 7/414 (1%)

Query: 110 AFPHRYIVVL-KHSSPEEIALHMEAITQSQLQSVGELAQDDPFF---SAQGVRTTGGIQD 165
           + P+RYI+   + SS   I  H   I + Q +SV +LA+DD FF   SA      GGI  
Sbjct: 66  SLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQFGGIDS 125

Query: 166 SFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISHRE 225
            FD+ GL  GY GYFT+ V++ + + P++ F+E +S V  +    Q  APWGL RISHRE
Sbjct: 126 FFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHRE 185

Query: 226 RLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDLDGNGHGT 285
           +   G   +YL++D AG+GVTSYV+DTGI++ H+DFEGRA WG  IP NDE  D NGHGT
Sbjct: 186 KAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDLNGHGT 245

Query: 286 HCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAQSHQXXXXXXXXXXXG 345
           HCAG I S+H+             LRSNG G++SDVIKG+E+  + H            G
Sbjct: 246 HCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDSSKKGGPKFKG 305

Query: 346 STANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTLS 405
           STAN+SLG  KSPA+++AVNAAV++G+HFA+AAGNE++DAC +SPA AE+++TVGAST S
Sbjct: 306 STANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFS 365

Query: 406 DDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPDS 465
           DDRA+FS++G CVD+FAPG+NILSTYIGS +A+ +LSGTSMA+PHVAG+L+YFLSLQP S
Sbjct: 366 DDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSLQPSS 425

Query: 466 DSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGFW 519
           DS+FFD+    V+P+QLK+K+I +ST+ +L D+ EDTPN LIYNGGG  L  FW
Sbjct: 426 DSEFFDS---TVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476

>Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003W
           (REAL)
          Length = 482

 Score =  463 bits (1191), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 222/416 (53%), Positives = 290/416 (69%), Gaps = 9/416 (2%)

Query: 110 AFPHRYIVVLKHS-SPEEIALHMEAITQSQLQSVGELAQDDPFFSAQGVRTT-----GGI 163
           + P+RYI+V     +   I  H + I ++Q  SV ++ +DD F        +     GGI
Sbjct: 68  SLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGGI 127

Query: 164 QDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISH 223
             SFD+ GL  GY GYFTD V+E++ + P+V F+E +S V  S    Q  APWGL RISH
Sbjct: 128 DISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISH 187

Query: 224 RERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDLDGNGH 283
           RER   G   +YL++D AG GVTSYV+DTGI+ +H+DFEGRA WG  IP NDE  D NGH
Sbjct: 188 RERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGH 247

Query: 284 GTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAQSHQXXXXXXXXXX 343
           GTHCAG I S+H+             LRSNG G++SDVIKG+E+ A++H           
Sbjct: 248 GTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIASSKKRGSKF 307

Query: 344 XGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGAST 403
            GSTAN+SLG  KSPA+++AVNAAV  G+HFA+AAGNE++DAC +SPA AE+++TVGAST
Sbjct: 308 KGSTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGAST 367

Query: 404 LSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQP 463
            SDDRA+FSN+G CVD+FAPG+NI+STYIGS +AT +LSGTSMA+PHVAG+L+Y LSLQP
Sbjct: 368 FSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQP 427

Query: 464 DSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGFW 519
             DS+FF      V+P+QLK+K++ +ST+ +L D+ E+TPN L+YNGGG  L  FW
Sbjct: 428 AQDSEFF---YDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480

>YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putative
           precursor to the subtilisin-like protease III
          Length = 478

 Score =  459 bits (1181), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 223/437 (51%), Positives = 298/437 (68%), Gaps = 20/437 (4%)

Query: 89  EHRGIVHKMGEGVAPLSIPPNAFPHRYIVVLKHS-SPEEIALHMEAITQSQLQSVGELAQ 147
           EH+ + HK               P+RY++V     S ++I  HM+ + +    SVG+L +
Sbjct: 56  EHQHVAHKT-----------EFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTE 104

Query: 148 DDPFFSA-----QGVRTTGGIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSP 202
           +D F+             GGI + FD+ GL  GY GYFTD ++++I + P++ FVE ++ 
Sbjct: 105 NDAFWRVISSSVSSKSQFGGIDNFFDINGLFRGYTGYFTDEIIKIISQDPIIKFVEQETT 164

Query: 203 VHASEFDTQNGAPWGLSRISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFE 262
           V  S    Q  APWGL R+SHRE+   G   +YL++D AGKGVTSYV+DTGI+ +H+DFE
Sbjct: 165 VKISNSSLQEEAPWGLHRVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFE 224

Query: 263 GRAHWGKTIPTNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDVI 322
           GRA WG  IP NDE  D NGHGTHCAG I SKH+             LRSNG G++SDVI
Sbjct: 225 GRAEWGAVIPANDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVI 284

Query: 323 KGVEFAAQSHQXXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNEN 382
           KG+E+  + H            GSTAN+SLG  KS A+++AVNAAV +G+HFA+AAGNE+
Sbjct: 285 KGIEYVTKEHIESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNED 344

Query: 383 QDACNTSPAAAEQAVTVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLS 442
           +DAC +SPA AE+++TVGAST SDDRA+FSN+G CVD+FAPG+NI+STYIGS +AT +LS
Sbjct: 345 EDACLSSPAGAEKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLS 404

Query: 443 GTSMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDT 502
           GTSMASPHVAG+L+YFLSLQP  DS+FF+      +P++LK+K++ +ST+ +L D+ +DT
Sbjct: 405 GTSMASPHVAGILSYFLSLQPAPDSEFFN---DAPSPQELKEKVLKFSTQGVLGDIGDDT 461

Query: 503 PNALIYNGGGHGLKGFW 519
           PN LIYNGGG  L GFW
Sbjct: 462 PNKLIYNGGGKKLDGFW 478

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
           (REAL)
          Length = 478

 Score =  454 bits (1167), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 219/415 (52%), Positives = 288/415 (69%), Gaps = 9/415 (2%)

Query: 111 FPHRYIVVLKHS-SPEEIALHMEAITQSQLQSVGELAQDDPFFSAQGVRTT-----GGIQ 164
            P+RYIVV     S + I  H + + ++   SV +LA+DD F              GGI 
Sbjct: 67  IPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDLQLGGID 126

Query: 165 DSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISHR 224
            SFD+ GL  GY GYFTD ++ L+ + P++ F+E +S V  S    Q  APWGL RISHR
Sbjct: 127 SSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLHRISHR 186

Query: 225 ERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDLDGNGHG 284
           E+   G   +YL++D AG+GVTSYV+DTGI+ +H+DFEGRA WG  IP NDE  D NGHG
Sbjct: 187 EKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASDLNGHG 246

Query: 285 THCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAQSHQXXXXXXXXXXX 344
           THCAG I SKHY             LRSNG G++SDVIKG+E+ A+ H            
Sbjct: 247 THCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSKEFK 306

Query: 345 GSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTL 404
           GSTAN+SLG  KS A+++AV+AAV +G+HFA+AAGNEN+DAC +SPA A++++TVGAST 
Sbjct: 307 GSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSITVGASTF 366

Query: 405 SDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPD 464
           SDDRA+FSN+G CVD+FAPG+NI+STYIGS +AT +LSGTSMA+PHVAG+L+YFLSLQP 
Sbjct: 367 SDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYFLSLQPA 426

Query: 465 SDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGFW 519
            DS++FD     ++P++LK+K++ +ST  +L D+ ++TPN LIYNGGG  L   W
Sbjct: 427 PDSEYFD---NALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478

>CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} similar
           to uniprot|P25036 Saccharomyces cerevisiae YOR003w YSP3
           or uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
          Length = 485

 Score =  404 bits (1039), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 215/413 (52%), Positives = 271/413 (65%), Gaps = 9/413 (2%)

Query: 112 PHRYIVVLK-HSSPEEIALHMEAITQSQLQSVGELAQDDPFFSA---QGVRTTG-GIQDS 166
           P+RYIV+ K   + +EI  H+ AI +    S+    QD  F  A     + T G G+Q  
Sbjct: 75  PNRYIVLFKDFVTDKEIQSHLSAIEEINSSSI--FLQDSDFGKATQYNDISTRGIGLQHE 132

Query: 167 FDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISHRER 226
           F +   + GY+GYFT+   + I  SP+V+ VE DS V  + +  Q   PWGL RIS RE+
Sbjct: 133 FSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRISQREK 192

Query: 227 LNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDLDGNGHGTH 286
           L +     Y +DD  GK   ++VIDTGI V H+DFEGRA WGKTI  ND D D NGHGTH
Sbjct: 193 LPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYDLNGHGTH 252

Query: 287 CAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAQSHQXXXXXXXXXXXGS 346
           CAGTIASKHY             LRS+GSGSMSDVI+GVE+  +++            G+
Sbjct: 253 CAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYN-DLKKTKSNLKGA 311

Query: 347 TANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTLSD 406
             NMSLG  KS AL+ A++AA  AGI FAVAAGNE+ DACN+SPA+A   +TVG STLSD
Sbjct: 312 AGNMSLGAWKSYALNRAMDAAAAAGISFAVAAGNESDDACNSSPASAWSPITVGGSTLSD 371

Query: 407 DRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPDSD 466
           D A+FSNYG+CVDIFAPG+NI+STYIGS +AT +LSGTSM+SPHVAG+L Y+LSLQPD  
Sbjct: 372 DVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLSLQPDHK 431

Query: 467 SDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGFW 519
           S F+   S  ++P+ LKKK++ Y+T   L  LP +T N L+YNGGG  L  FW
Sbjct: 432 SQFYHEHS-AISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFW 483

>KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6.14
           YOR003W
          Length = 456

 Score =  386 bits (992), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 196/410 (47%), Positives = 259/410 (63%), Gaps = 17/410 (4%)

Query: 114 RYIVVLKHSSP-EEIALHMEAITQSQLQSVGELAQDDPFFSAQGVRTTGGIQDSFDVAGL 172
           +YIV+ K+S+   E  LH + +         E  + D   S   +         F +   
Sbjct: 63  QYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDDHKSNLNI---------FKIGTT 113

Query: 173 LNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISHRERLNLGSF 232
           L+GY+       ++L+R+ P+V  +E DS VHA +   Q   PWGLSRIS R R+ +G  
Sbjct: 114 LSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQRPRVRIGQD 173

Query: 233 NKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDLDGNGHGTHCAGTIA 292
             Y +DD     VT+YV+DTGI + H+ F GRA WGKTI  ND D D +GHGTH AG IA
Sbjct: 174 QLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHGTHVAGIIA 233

Query: 293 SKHYXXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAQSHQXXXXXXXXXXXGSTANMSL 352
           S  +             LRSNG G MSDV+KG+EF    H            GS  N+SL
Sbjct: 234 SDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSKNKNYSK----GSVVNLSL 289

Query: 353 GGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTLSDDRAYFS 412
           G  KSPAL LA++AA+   IHFAVAAGNEN DAC TSPA A +A+TVGAS  SD+RA+FS
Sbjct: 290 GASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIFSDERAFFS 349

Query: 413 NYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPDSDSDFFDA 472
           N+G+CVD+FAPG+N++STYIGSD+AT +LSGTS A+P+ AGL+ Y+LSLQPD DS +F  
Sbjct: 350 NWGECVDVFAPGMNVMSTYIGSDNATLSLSGTSAAAPYTAGLIAYYLSLQPDKDSGYF-- 407

Query: 473 GSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGFWDGH 522
            +  +TP +LK+K++A+ +KD+LY+LPE+TPN +IYNG G  L  FW  +
Sbjct: 408 -TGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFWKDY 456

>NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14
          Length = 451

 Score =  350 bits (897), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 187/415 (45%), Positives = 249/415 (60%), Gaps = 22/415 (5%)

Query: 111 FPHRYIVVLKHSSPE-EIALHMEAITQSQLQSVGELAQDDPFFSAQGVRTTGGIQDSFDV 169
            P++YIV+ K  + + +   H+  +    L +       DP ++         I  SF +
Sbjct: 53  IPNQYIVLFKSDTTDIQRETHLATLNSWLLNT-------DPQYT---------ILHSFQL 96

Query: 170 AGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISHRERLNL 229
           A  L GY     + ++  +   P++  +E DS VHA     Q  +PWGL+RIS RERL L
Sbjct: 97  AHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQRERLKL 156

Query: 230 GSFNKYLFDDE-AGKGVTSYVIDTGINVKHQDFEGRAHWGKTI-PTNDEDLDGNGHGTHC 287
                Y +DD  A      Y++DTGIN  H +F+GRA WG    P      D NGHGTHC
Sbjct: 157 LQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENGHGTHC 216

Query: 288 AGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAQSH-QXXXXXXXXXXXGS 346
           AG I S  Y             L + G G MS VI+G+E+  Q H Q           GS
Sbjct: 217 AGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQTGFKGS 276

Query: 347 TANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTLSD 406
             N+SLG GKSPAL   + AAVK G+HFAVAAGNE+ DAC+TSPA +  A+TVGAS+ SD
Sbjct: 277 VINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGASSFSD 336

Query: 407 DRAYFSNYGKCVDIFAPGLNILSTYIGS-DDATATLSGTSMASPHVAGLLTYFLSLQPDS 465
           DR +FSN+G CVD+FAPG+NI+STYIG  ++ T +LSGTSM++P V GL+ YFLSLQPD+
Sbjct: 337 DRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLSLQPDT 396

Query: 466 DSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGFWD 520
            S F+  G    TP QLK K+I++ST+ +L+++PE TPN ++YNGGGH LK FW+
Sbjct: 397 KSQFY-TGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKDFWN 450

>NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {ON} 
          Length = 482

 Score =  327 bits (839), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 195/462 (42%), Positives = 263/462 (56%), Gaps = 23/462 (4%)

Query: 80  HEGHHDALPEHRGIVHKMGEGVAPLSIP-----PNAFPHRYIVVLKHSSPEEIALHMEAI 134
           H G++DA          + +   P  IP      N  P +YIV+ ++ + +      E  
Sbjct: 27  HSGNNDASHAKLNERDTLDKNQIPFIIPTHGPQKNFIPDQYIVLFENDTTDLQISRFEQF 86

Query: 135 TQSQLQSVGELAQDDPFFSAQGVRTTGGIQDSFDVAGLL--NGYVGYFTDAVVELIRKSP 192
             S ++   +    +  +S    +     Q S D  G++       +  D    +     
Sbjct: 87  LSSLIEEDNQKYNVNDNYS----KVLSRFQISNDTKGMIIRAPIDDFLEDVKNNIFNYQK 142

Query: 193 MVDFVEMDSPVHASEFDTQNGAPWGLSRISHRERLNLGSFNKYLFDDE-AGKGVTSYVID 251
           ++  +E DS VH ++F TQ  + WGLSRIS R  L L     Y +DD  +GKGV  Y++D
Sbjct: 143 IIKIIERDSYVHMNKFTTQIDSSWGLSRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILD 202

Query: 252 TGINVKHQDFEGRAHWGKTIPTNDEDL-DGNGHGTHCAGTIASKHYXXXXXXXXXXXXXL 310
           TGIN  H +FEGRA WG ++P  +  L D NGHGTHCAG I SK Y             L
Sbjct: 203 TGINSNHIEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVL 262

Query: 311 RSNGSGSMSDVIKGVEFAAQSHQXXXXXXX------XXXXGSTANMSLGGGKSPALDLAV 364
              G GSMSDVI G+EF A SH                  GS  N+SLG  KSP+LD+A+
Sbjct: 263 DFKGDGSMSDVILGLEFVANSHTNKTNNISSSSSVHSEFKGSVVNLSLGAPKSPSLDIAL 322

Query: 365 NAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTLSDDRAYFSNYGKCVDIFAPG 424
            +A K GIH  VAAGNE++DAC TSPA +   +TVGAS+ SDDRA+FSN+G CVD+FAPG
Sbjct: 323 ESAKKIGIHITVAAGNEDEDACMTSPADSPAVITVGASSFSDDRAFFSNWGPCVDVFAPG 382

Query: 425 LNILSTYIG-SDDATATLSGTSMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLK 483
           +NI STYIG +++ T +LSG+SM+SP V+GL  Y+LSLQPD  S F D+    +TP+QLK
Sbjct: 383 INIKSTYIGPNNNETLSLSGSSMSSPFVSGLTAYYLSLQPDVSSQFHDS---LMTPDQLK 439

Query: 484 KKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGFWDGHDKQ 525
           +K+I +ST  +L +LP DT N L+YNGGG  L GFW+   K+
Sbjct: 440 RKIIDFSTNGMLKELPLDTANKLVYNGGGKDLSGFWNATRKE 481

>KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score =  318 bits (814), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 163/349 (46%), Positives = 220/349 (63%), Gaps = 9/349 (2%)

Query: 165 DSFDVAGLLNGY-VGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISH 223
           + F +A  L G+ V  F    V  + + P V+ VE +S V+A     Q   PWGL R+S 
Sbjct: 75  EQFHIADELIGFTVKNFPFHNVYFLLQIPFVEMVETNSKVYALNVTVQEDVPWGLMRLSQ 134

Query: 224 RERLNLGSFNKYLFDDE-AGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDLDGNG 282
           R+R+ +G    Y +D   + K V  Y++DTGI V H++FEGRA WGKTI  ND D D NG
Sbjct: 135 RDRVRIGDEQVYRYDTRGSAKDVNVYILDTGIQVDHEEFEGRARWGKTIAWNDPDRDDNG 194

Query: 283 HGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAQSHQXXXXXXXXX 342
           HGTHCAG +    Y             L + G G MSDVI+G+EFA   H          
Sbjct: 195 HGTHCAGIVGGATYGVAKEANLIAVKVLHATGDGEMSDVIRGIEFAVNEH---LTRNQDE 251

Query: 343 XXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGAS 402
             GS  N+SLG G+SPAL   V AA+  G+HFAVAAGNE+ +AC +SPA  +  VTVG S
Sbjct: 252 VRGSIINLSLGAGESPALQRVVTAALNKGVHFAVAAGNEDDNACYSSPANIDGVVTVGGS 311

Query: 403 TLSDDRAYFSNYGKCVDIFAPGLNILSTYIG-SDDATATLSGTSMASPHVAGLLTYFLSL 461
           T SDDRA+FSN+G C+D+FAPG+N+ S+Y+G + + T +LSGTS ++PHVAGL+ Y LSL
Sbjct: 312 TFSDDRAFFSNWGPCIDVFAPGVNVKSSYVGAAKNKTLSLSGTSTSAPHVAGLMAYLLSL 371

Query: 462 QPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNG 510
           +PD+ S F  A S    P QLK+KL++ +T+  L+++P+DT N +I+NG
Sbjct: 372 EPDTKSQFHTAWSN---PAQLKQKLVSLATEGKLFEVPDDTANLMIFNG 417

>CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} some
           similarities with uniprot|P09232 Saccharomyces
           cerevisiae YEL060c or uniprot|P25036 Saccharomyces
           cerevisiae YOR003w YSP3
          Length = 579

 Score =  275 bits (703), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 160/437 (36%), Positives = 239/437 (54%), Gaps = 26/437 (5%)

Query: 101 VAPL----SIPPNAFPHRYIVVLKH-SSPEEIALHMEAITQSQLQSVGELAQDDPFF--- 152
           VAPL     I  N  P+RYIV+ K+ +   EI LH++ + + QL+    LA +DPFF   
Sbjct: 55  VAPLGENDEIQNNIVPYRYIVMFKNFAYTNEIKLHIQTVAKLQLRGSISLAPNDPFFHHT 114

Query: 153 --SAQGVRTTGGIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDT 210
                     GG+  +FD+    NGYVGYFTD VVE IRK  +VD+VEMDS +   + +T
Sbjct: 115 RDKEFSTEELGGVLYTFDIGSGFNGYVGYFTDEVVEFIRKQSIVDYVEMDSILTIDDKET 174

Query: 211 QNGAPWGLSRISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKT 270
            + + W L+RISHR +L L +FN+Y FD   G+ + +Y++DTG+   H  +  R   G  
Sbjct: 175 DSNSHWHLARISHRPKLGLSNFNEYKFDPNGGQNIDAYILDTGVYQTHAYYIERTIRGIV 234

Query: 271 IPTNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAQ 330
           I  N+++ D NGHGT  AG +  +               L   G G++S++IKG+ F   
Sbjct: 235 ITPNEDERDMNGHGTEMAGLVGGREVGVARKATLIDVKVLNWQGRGTVSNIIKGLSFV-- 292

Query: 331 SHQXXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSP 390
           +H            G+    S+ G KS +L+ A +  V +GIH  V AG +  +ACN+SP
Sbjct: 293 NHHHPQRIEKNGVLGAVVLFSISGAKSRSLNTAFDKMVSSGIHVVVGAGTKGINACNSSP 352

Query: 391 AAAEQAVTVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATAT----LSGTSM 446
           A++ + +TV   +++D+     N+G CVDI+ PG  + +TY   +    T    ++G+S 
Sbjct: 353 ASSSKPITVAGMSITDEPIDRGNWGSCVDIYGPGDRVRTTYPNLERNQFTNEISVTGSSA 412

Query: 447 ASPHVAGLLTYFLSLQPDSDSDFFDAGSQGV---TPEQLKKKLIAYSTKDILYDLPEDTP 503
           A+  VAGLL YF SLQP         G+  V   TPE+LK++LI + TK  L +L   +P
Sbjct: 413 AAAQVAGLLAYFASLQP-------GLGTPDVIPLTPEELKERLIDFGTKGKLTNLERMSP 465

Query: 504 NALIYNGGGHGLKGFWD 520
           N + +NG G  L  F++
Sbjct: 466 NIIAFNGAGGNLDSFFN 482

>NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {ON}
           Anc_6.313
          Length = 492

 Score =  190 bits (482), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 151/442 (34%), Positives = 216/442 (48%), Gaps = 83/442 (18%)

Query: 111 FPHRYIVVLKHSSPEEIALHMEAITQSQLQSVGELAQDDPFFSAQGVRTTGGIQDSFDVA 170
           +   Y+V LK +  + I   M++ T ++ +SV E  +D              I  +F + 
Sbjct: 22  YGREYLVSLKQN--DSIQSFMDS-TITRGRSVKEYLRDK-------------IGKTFSI- 64

Query: 171 GLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASE-------------FD-------- 209
           G   G+    TD ++E I+K+P+V  V  +  VHA E             FD        
Sbjct: 65  GSFKGFTVDLTDDLLEAIKKNPLVSDVVPNLRVHAFEDVKDEEGDDDGGQFDNKMQKGKC 124

Query: 210 ---TQNGAPWGLSRISHRERL---------NLGSFNKYLFDDEA-GKGVTSYVIDTGINV 256
               Q GAP  L+R+S R++L          L S  KY +D  + G  V +Y+ID+GI +
Sbjct: 125 SVKVQYGAPRHLARLSRRKQLPYDFEDKEAYLDSL-KYFYDKRSQGASVNAYIIDSGIYL 183

Query: 257 KHQDFEGRAHWGKTIPTNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSG 316
           +H++F GRA  G  + T +   D NGHGTH AG + SK Y             L   G G
Sbjct: 184 EHEEFNGRAIPGIDL-TGEGSGDYNGHGTHVAGIVGSKSYGVAKKVKLIEIKVLNRLGQG 242

Query: 317 SMSDVIKGVEFAAQSHQXXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAV 376
           S++ V+ G+EFA +  Q              AN+SLG  ++  L+ A+ AA+ AG+   V
Sbjct: 243 SLAMVLGGIEFAVKHCQETSKKGR-----CVANLSLGSMRTAILNKAIKAAIDAGLVVVV 297

Query: 377 AAGNENQDACNTSPAAAEQAVTVGASTLSDDR----AYFSNYGKCVDIFAPGLNILSTYI 432
           AAGN N +AC  SPA+A +A+TVGA    DDR    A FSN+G+C+DIFAPG+ I S  I
Sbjct: 298 AAGNNNLNACWYSPASAPEAITVGA---FDDRIDAIAKFSNWGQCLDIFAPGVVIKSLSI 354

Query: 433 GSDDATATLSGTSMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTK 492
             D    T SGTSMASP VAGL    L               QGV+ E++K  ++   T 
Sbjct: 355 FKDKEDVTYSGTSMASPTVAGLAALTL--------------DQGVSAEEVKDYILEMGTD 400

Query: 493 DILYD----LPEDTPNALIYNG 510
           ++ +         TPN + +NG
Sbjct: 401 NVFHRRSLLFKPGTPNKICFNG 422

>TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa]
           {ON} Anc_6.313 YCR045C
          Length = 436

 Score =  179 bits (455), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 139/430 (32%), Positives = 200/430 (46%), Gaps = 66/430 (15%)

Query: 109 NAFPHRYIVVLKHSSPEEIALHMEAITQSQLQSVGELAQDDPFFSAQGVRTTGGIQDSFD 168
           ++F   Y++  K  +P+   L M     ++LQS+        FF  +  RT       F 
Sbjct: 16  SSFAEEYLIRFK--TPDAFKLFMN-FKSARLQSIKS------FFDCKVRRT-------FS 59

Query: 169 VAGLLNGYVGYFTDAVVELIRKSPMV-------DFVEMDS------PVHASEFDTQNGAP 215
                   +    D +V+ IR+SP+V        FV  D         ++     Q GAP
Sbjct: 60  FGSFRALSIDVPRD-LVDRIRRSPLVAEVVPNIQFVAYDEHDFEGWNFNSRFIRRQRGAP 118

Query: 216 WGLSRISHRERLNL----------GSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRA 265
             LSR+S R +L            GSFN Y  +   G G+ +Y+IDTGI  +H +F GRA
Sbjct: 119 RHLSRLSRRSQLPYDFEEEDDNYEGSFNYYYDNKHRGDGINAYIIDTGIYKEHAEFGGRA 178

Query: 266 HWGKTIPTNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDVIKGV 325
            +G+ + T +   DGNGHGTH AG + S  Y             L + G G+++ VI  +
Sbjct: 179 VFGEDL-TGEGPGDGNGHGTHVAGIVGSSKYGVAKDITLVEVKALTAKGQGNLTTVISAM 237

Query: 326 EFAAQSHQXXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDA 385
           EFA    +           G   N+SLG  ++  ++ AV AA +AGI   VAAGN N +A
Sbjct: 238 EFAVNHCRSSEGK------GCVINLSLGAIRNSVINQAVKAAHEAGIVVVVAAGNSNINA 291

Query: 386 CNTSPAAAEQAVTVGA-STLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGT 444
           C  SPA+A +A+TVGA    +D  A FSN+G CVDIFAPG+ + S            SGT
Sbjct: 292 CLNSPASAPEAITVGAFDDRTDSIAKFSNWGSCVDIFAPGVRVKSLASAPHLKPILFSGT 351

Query: 445 SMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYD----LPE 500
           SMASP + GL    L               +GV  +++K  ++  +T D+          
Sbjct: 352 SMASPSITGLAAILL--------------DEGVPYDKIKDYILKMATNDVFQRRTLVFKP 397

Query: 501 DTPNALIYNG 510
            TPN + +NG
Sbjct: 398 GTPNRVAFNG 407

>ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 490

 Score =  179 bits (455), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 127/368 (34%), Positives = 176/368 (47%), Gaps = 62/368 (16%)

Query: 184 VVELIRKSPMV-DFV---------------EMDSPVHASEFDTQNG-----------APW 216
           VVE IR +P+V D V               E+    H    D ++G           AP 
Sbjct: 72  VVEKIRNNPLVADLVPNIQFKAFDDVLGVQELQQNYHGDNLDDEDGFNPFKVKVQGEAPR 131

Query: 217 GLSRISHRERLNLG---------SFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHW 267
            L+R+S R  L            SFN Y +    G+ + +Y+IDTGI  +H+DF GRA +
Sbjct: 132 HLARLSRRAPLPYEFDDELRYEESFNYYYYKWHKGRNINAYIIDTGIYKEHKDFCGRAIF 191

Query: 268 GKTIPTNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDVIKGVEF 327
           G+   T +   D NGHGTH AG + S ++             L + G G+++ VI  VEF
Sbjct: 192 GRDF-TGEGPGDRNGHGTHVAGIVGSSNFGVAKKVNLIEVKALNNRGQGNLTTVISAVEF 250

Query: 328 AAQSHQXXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACN 387
           A    +           G  AN+SLG  ++  ++ A+ AA +AG+   VAAGN N +AC 
Sbjct: 251 AVNHCKSSGKK------GCVANLSLGAVRNSVINQAIKAAHEAGLIIVVAAGNSNINACW 304

Query: 388 TSPAAAEQAVTVGA-STLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSM 446
            SPA+A +A+TVGA    +D  A FSN+G CVDIFA G+ + S            SGTSM
Sbjct: 305 NSPASAPEAITVGAFDDRTDTIAKFSNWGPCVDIFASGVKVKSLSAFPPHKPIAFSGTSM 364

Query: 447 ASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYD----LPEDT 502
           ASP V GL+   L               +GV PE +K KL+  +T D+L          T
Sbjct: 365 ASPSVTGLVAILL--------------DKGVEPENIKAKLVELATHDLLQRRTLFFKPGT 410

Query: 503 PNALIYNG 510
           PN + +NG
Sbjct: 411 PNRIAFNG 418

>Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON}
           (138312..139868) [1557 nt, 519 aa]
          Length = 518

 Score =  180 bits (457), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 126/321 (39%), Positives = 164/321 (51%), Gaps = 40/321 (12%)

Query: 209 DTQNGAPWGLSRISHRERL--------NLGSFNKYLFDDE-AGKGVTSYVIDTGINVKHQ 259
           + Q GAP  L RIS R +L            F  Y ++D+  G  + +Y++DTGI  +H 
Sbjct: 152 NVQYGAPRHLGRISSRGQLPFDIRNENEFKEFIHYYYEDQFKGSNIAAYILDTGIYAEHP 211

Query: 260 DFEGRAHWGKTIPTNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMS 319
           DFE R   G  + T +   D NGHGTH AG + SK +             L   GSG+++
Sbjct: 212 DFENRVIVGADM-TGEGPGDSNGHGTHVAGILGSKTFGVAKNVTLVEVKVLTGRGSGNLT 270

Query: 320 DVIKGVEFAAQSHQXXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAG 379
            V+ G++FA    +              ANMSLG  ++  ++ A++ A KAG+   VAAG
Sbjct: 271 TVLSGIQFAVDHCRLMRETQGKQ---CVANMSLGTVRNNIINAAIHEAFKAGLIMVVAAG 327

Query: 380 NENQDACNTSPAAAEQAVTVGASTLSDDR----AYFSNYGKCVDIFAPGLNI--LSTYIG 433
           N N  AC TSPA+A+ A+TVGA    DDR    AYFSN+G CVDIFAPG+ I  LS    
Sbjct: 328 NSNVSACWTSPASAKNAITVGA---FDDRTETIAYFSNWGACVDIFAPGVKIRSLSNSPE 384

Query: 434 SDDATATLSGTSMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKD 493
           S     T SGTSMASP VAGL    L               +GV P  +K KL+  STKD
Sbjct: 385 SHHKHVTHSGTSMASPVVAGLAAILL--------------DKGVEPFDVKDKLLHLSTKD 430

Query: 494 ILYDL----PEDTPNALIYNG 510
           +   L       TPN + YNG
Sbjct: 431 VFNKLTLFFKYGTPNKIAYNG 451

>Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar to
           Ashbya gossypii AAR069W
          Length = 610

 Score =  176 bits (446), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 123/314 (39%), Positives = 164/314 (52%), Gaps = 37/314 (11%)

Query: 211 QNGAPWGLSRISHRERLNLGS-------FNKYLFDDEAGKGVTSYVIDTGINVKHQDFEG 263
           Q+GAP  L+R   R  L   +       FN Y   +  G+ V  Y++D+GI+  H +FEG
Sbjct: 270 QSGAPRHLARNCRRSGLPFDTSGSKDYEFNYYYDAEHLGETVNVYILDSGIHKSHPEFEG 329

Query: 264 RAHWGKTIPTNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDVIK 323
           RA +G    TN+   D NGHGTH AG + SK Y             +  +G GS S++I 
Sbjct: 330 RAVFGIDT-TNEGPGDLNGHGTHVAGLVGSKTYGAAKKATIYEVKVMTVDGRGSTSNIIA 388

Query: 324 GVEFAAQSHQXXXXXXXXXXXGSTANMSLGG---GKSPALDLAVNAAVKAGIHFAVAAGN 380
           GVEFA +  Q              ANMSLGG   G S ALD AV AA++ G+ F VAAGN
Sbjct: 389 GVEFAVKHCQQSGKK-------CVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVVAAGN 440

Query: 381 ENQDACNTSPAAAEQAVTVGA-STLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATA 439
             + AC  SPA  + A+TVGA    SD  A FSNYGKCVDIFAPG+ + S      +   
Sbjct: 441 SKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVSSLSNSPYNTVR 500

Query: 440 TLSGTSMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYD-- 497
            L+GTSM++P  AG++   L               QGV  E +K++LI  STK + +   
Sbjct: 501 VLNGTSMSAPITAGVVAVLL--------------DQGVKHEDVKERLIDLSTKGVFHRRR 546

Query: 498 -LPEDTPNALIYNG 510
            +   TP+  ++NG
Sbjct: 547 LVSSRTPDRTLFNG 560

>Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON}
           (14365..15762) [1398 nt, 466 aa]
          Length = 465

 Score =  173 bits (439), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 149/482 (30%), Positives = 221/482 (45%), Gaps = 84/482 (17%)

Query: 104 LSIPPNAFPHRYIVVLKHSSPEEIALHMEAITQSQLQSVGELAQDDPFFSAQGVRTTGGI 163
           L I P      Y++ LK S  E I   +++     LQ      +DD             I
Sbjct: 11  LYICPLIVGEEYLIKLKKS--ESIQSFLKSTKSQSLQ-----IKDD---------IKNHI 54

Query: 164 QDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHA-------SEFDT------ 210
           ++ F   G     V    + ++E ++K+P +  +  +  V+A       SE  T      
Sbjct: 55  RERFTF-GAFRALVIDLPNDMIEKLKKNPTISEIIPNLKVNAFANSSTYSELLTYSDKII 113

Query: 211 -QNGAPWGLSRISHRERL-----NLGSFNK---YLFDDE-AGKGVTSYVIDTGINVKHQD 260
            Q  AP  LSR+S R +L     N+  ++    Y FD +  G  V +Y+IDTGI  +H +
Sbjct: 114 IQREAPRHLSRLSRRGQLPYDINNIDRYDNAFDYYFDAKYQGSSVNAYIIDTGIYKEHPE 173

Query: 261 FEGRAHWGKTIPTNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSD 320
           FEGR  +   + T +   D NGHGTH AG + SK +             L   G G +S 
Sbjct: 174 FEGRVKFAIDL-TQEGPGDENGHGTHIAGIVGSKTFGVAKKVNIIDVKALDKKGQGQLST 232

Query: 321 VIKGVEFAAQSHQXXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGN 380
           ++K +EF  +  +              AN+S G  ++  +D A+  A  AGI   VAAGN
Sbjct: 233 ILKALEFTIRHCKESVDKK------CVANLSFGAIRTAIIDEAIKEAHNAGIVLVVAAGN 286

Query: 381 ENQDACNTSPAAAEQAVTVGASTLSDDR----AYFSNYGKCVDIFAPGLNI--LSTYIGS 434
            N DAC  SPA+++  +TVGA    DDR    A FSN+G CVD+FAPG+ +  LS   GS
Sbjct: 287 SNIDACWNSPASSKDVITVGA---FDDRTETIARFSNWGSCVDVFAPGVKVKSLSHINGS 343

Query: 435 DDATATLSGTSMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDI 494
           D     LSGTSMASP V+G+    L               +G+ P+ +K K+I  STK+I
Sbjct: 344 D--VLLLSGTSMASPSVSGIAAILL--------------DKGLNPKFVKSKIIESSTKNI 387

Query: 495 LYD----LPEDTPNALIYNGGGHGLKGFWDGHDKQEANTRFQDTDLQELSDNLGAKTDAL 550
            +     +  +TPN +++NG         +  D      RF   D + L + L +   ++
Sbjct: 388 FHQGTIMIKPNTPNLIVFNG--------IEKMDDSFEGARFPRIDFEGLINELKSYRVSV 439

Query: 551 FD 552
            D
Sbjct: 440 LD 441

>KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {ON}
           Anc_6.313 YCR045C
          Length = 475

 Score =  172 bits (436), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 139/425 (32%), Positives = 198/425 (46%), Gaps = 60/425 (14%)

Query: 115 YIVVLKHSSPEEIALHMEAITQSQLQSVGELAQDDPFFSAQGVRTTGGIQDSFDVAGLLN 174
           ++  L  ++ EE  + +   ++S+      L++D  +F        G I   F + G L 
Sbjct: 10  FLSSLGGAAAEEFLVTLNDDSRSERFMNSVLSKDLKWFMG------GKINKRFQI-GELK 62

Query: 175 GYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDT------------QNGAPWGLSRIS 222
           G     +  V++ I++ P V  V  +  V A E D             Q GAP  L+RIS
Sbjct: 63  GLTMNLSHDVLDKIKRHPFVKEVVPNIMVKAFEGDAVEDESWLPKMKRQRGAPRHLARIS 122

Query: 223 HRERLNLGSFNK--------YLFDDEA-GKGVTSYVIDTGINVKHQDFEGRAHWGKTIPT 273
            R +L     NK        Y +D  A G    +Y++DTG+   H++FE R  +G T  T
Sbjct: 123 RRMQLPYDMNNKTRYRDSFNYYYDRWAQGATTRAYILDTGVMRDHKEFEDRVEFG-TDCT 181

Query: 274 NDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAQSHQ 333
            + + D NGHGTH AG + SK +             L + G+G++  ++  +EFA Q  Q
Sbjct: 182 GEGEGDLNGHGTHVAGLVGSKTFGVAKHVQLVDVKCLDALGAGTLVSILSALEFAVQDCQ 241

Query: 334 XXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAA 393
                          NMSLG  KS  L+ A+N   K GI   VAAGN N +AC TSP++A
Sbjct: 242 EHEDSQ------CVLNMSLGSVKSNILNQAINEVEKKGIVVVVAAGNFNMNACWTSPSSA 295

Query: 394 EQAVTVGASTLSDDR----AYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASP 449
             A+TVGA    DDR    A FSN+G CVDIFAPG+N+ S       +    SGTSMASP
Sbjct: 296 TGAITVGA---FDDRFDTIAKFSNWGPCVDIFAPGVNVASLVNRDWPSFVKYSGTSMASP 352

Query: 450 HVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYD----LPEDTPNA 505
            V G++   L                GV PE ++  L   +T  +           TPN+
Sbjct: 353 IVCGMVALLL--------------DDGVPPEDIRDYLQELATDGVFKKRTLVFKPGTPNS 398

Query: 506 LIYNG 510
           ++YNG
Sbjct: 399 VLYNG 403

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
           YCR045C (REAL)
          Length = 527

 Score =  172 bits (435), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 123/355 (34%), Positives = 177/355 (49%), Gaps = 34/355 (9%)

Query: 211 QNGAPWGLSRISHRERLNL---------GSFNKYLFDDEAGKGVTSYVIDTGINVKHQDF 261
           Q  AP  L+RIS   +L             FN Y  D+  G+GV +Y++DTGI+ +H +F
Sbjct: 161 QPDAPRHLARISRHHQLPFDLEDKDRYKSWFNYYYEDEYQGQGVNAYIMDTGIHAEHPEF 220

Query: 262 EGRAHWGKTIPTNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDV 321
           E R   G  + T +   D NGHGTH AG + S+ +             L  +GSG  S+V
Sbjct: 221 EDRVIQGVDL-TKEGFGDENGHGTHVAGLVGSRTFGAAKKVSLVEVKVLGKDGSGEASNV 279

Query: 322 IKGVEFAAQSHQXXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNE 381
           + G+EF  +                 AN+SLG  +SP +++AV  A++ GI F  AAGN 
Sbjct: 280 LSGLEFIVEH---CTKVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGNF 336

Query: 382 NQDACNTSPAAAEQAVTVGA-STLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATAT 440
           N DA   SPA+AE  +TVGA     D  A FSN+G CV+IFAPG+ I S    +D+ +  
Sbjct: 337 NLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNDNESLV 396

Query: 441 LSGTSMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYD--- 497
           LSGTSM++P V G+    L              S+G+ PE + +++   ST+++ +    
Sbjct: 397 LSGTSMSTPIVTGVAAVLL--------------SKGIEPELIAQEIEYLSTRNVFHRRTL 442

Query: 498 -LPEDTPNALIYNGGGHGLKGFWDGHDKQEANTRFQDTDLQELSDNL-GAKTDAL 550
                TPN ++YNG    L   +D       N      +L+E +  L GA TD L
Sbjct: 443 FFKPSTPNQILYNGVDK-LDDPYDDETFPRLNVEAIAKELEEYNATLQGAMTDDL 496

>SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 479

 Score =  170 bits (431), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 133/425 (31%), Positives = 197/425 (46%), Gaps = 70/425 (16%)

Query: 113 HRYIVVLKHSSPEEIALHMEAITQSQLQSVGELAQDDPFFSAQGVRTTGGIQDSFDVAGL 172
             Y+V LK  SP+ +   ME+        +G+++    F S +       I  +F   G 
Sbjct: 19  EEYLVRLK--SPKSLTKFMES-------KIGDMSLKS-FVSTR-------ISKTFSF-GK 60

Query: 173 LNGYVGYFTDAVVELIRKSPMV------------DFVEMDSPVHASEFDTQNGAPWGLSR 220
             G+   F    VE ++K+P+V            D  E  +  ++  +  Q  AP  L+R
Sbjct: 61  FEGFTADFPKDFVEKLKKNPLVADVVPNSVFNVFDQKEQIAEEYSRRYKVQEDAPRHLAR 120

Query: 221 ISHRERLNLGS-------FNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPT 273
           +S R  L           FN Y      G  V +Y+IDTGI  +H+D  GRA++G  +  
Sbjct: 121 LSRRGPLPYSEEDGWYQEFNYYYDRKHRGDSVNAYIIDTGIYKQHKDLGGRAYFGADM-V 179

Query: 274 NDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAQSHQ 333
            +   D NGHGTH AG + S+ +             L + G G+++ VI  +EF+    +
Sbjct: 180 GEGPGDYNGHGTHVAGIVGSRTFGVAKKVNLVEVKALNAKGQGNLTSVISSIEFSVNHCK 239

Query: 334 XXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAA 393
                         AN+SLG  ++  L+ AV AAV++G+   VAAGN N +AC  SPA+A
Sbjct: 240 KSGML-------CVANLSLGSLRNTVLNQAVEAAVESGLVVVVAAGNSNVNACWNSPASA 292

Query: 394 EQAVTVGASTLSDDR----AYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASP 449
             A+TVGA    DDR    A FSN+G CVD+FA G+ ++S            SGTSMASP
Sbjct: 293 ISAITVGA---FDDRTDTIAKFSNWGMCVDVFASGVKVMSLSNMPPFKPVAYSGTSMASP 349

Query: 450 HVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYD----LPEDTPNA 505
            VAGL    L                G+ P  +K+K+I  +T+++           TPN 
Sbjct: 350 SVAGLAAVLL--------------DSGIDPPDIKQKIIDLATENVFQKRTLVFKPGTPNR 395

Query: 506 LIYNG 510
           + +NG
Sbjct: 396 IAFNG 400

>AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR045C
          Length = 768

 Score =  174 bits (442), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 118/318 (37%), Positives = 164/318 (51%), Gaps = 37/318 (11%)

Query: 207 EFDTQNGAPWGLSRISHRERLNLG-------SFNKYLFDDEAGKGVTSYVIDTGINVKHQ 259
           ++  Q  AP  L+R   R  L          +FN Y  ++  G+GV  YV+D+GI   H 
Sbjct: 424 QYAIQVDAPRHLARTCRRTGLPFDPSGDKEYTFNYYYDEEHLGEGVNVYVLDSGIYKSHP 483

Query: 260 DFEGRAHWGKTIPTNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMS 319
           +F+GRAH+G    T +   D NGHGTH AG + S+ +             +  +G GS S
Sbjct: 484 EFDGRAHFGIDT-TKEGPGDLNGHGTHVAGLVGSRTFGIAKKANIYEIKVMTVDGRGSTS 542

Query: 320 DVIKGVEFAAQSHQXXXXXXXXXXXGSTANMSLGG---GKSPALDLAVNAAVKAGIHFAV 376
           ++I GVEFA +  Q              ANMSLGG   G S ALD AV AA++ G+ F V
Sbjct: 543 NIIAGVEFAVKHCQQSGKR-------CVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVV 594

Query: 377 AAGNENQDACNTSPAAAEQAVTVGA-STLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSD 435
           AAGN  + AC  SPA  + A+TVGA    SD  A FSNYGKCVDIFAPG+ + S      
Sbjct: 595 AAGNSKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVASLSNSPS 654

Query: 436 DATATLSGTSMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDIL 495
           +    L+GTSM++P  AG++   L               QG+ P ++K  L++ STK + 
Sbjct: 655 NTMRVLNGTSMSAPITAGVVAVLL--------------DQGIEPHEVKDHLLSISTKGLF 700

Query: 496 YD---LPEDTPNALIYNG 510
           +    +   TP+  ++ G
Sbjct: 701 HKRRLVSSRTPDRALFTG 718

>Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON}
           YCR045C (REAL)
          Length = 491

 Score =  169 bits (428), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 115/314 (36%), Positives = 159/314 (50%), Gaps = 32/314 (10%)

Query: 211 QNGAPWGLSRISHRERLNL---------GSFNKYLFDDEAGKGVTSYVIDTGINVKHQDF 261
           Q+ AP  L+RIS   +L             FN Y  DD  G+ V +Y++DTGI   H +F
Sbjct: 125 QSDAPRHLARISRHYQLPFDIEDKERYKSWFNYYYEDDYQGQDVNAYIMDTGIFADHPEF 184

Query: 262 EGRAHWGKTIPTNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDV 321
           E R   G  + T +   D NGHGTH AG + SK Y             L  +GSG  S+V
Sbjct: 185 EDRVIQGIDL-TKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGSGEASNV 243

Query: 322 IKGVEFAAQSHQXXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNE 381
           + G+EF  +                 AN+SLG  +SP +++AV  A++ GI F  AAGN 
Sbjct: 244 LSGLEFIVEH---CTRVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGNF 300

Query: 382 NQDACNTSPAAAEQAVTVGA-STLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATAT 440
           N DA   SPA+AE  +TVGA     D  A FSN+G CV+IFAPG+ I S    + + T  
Sbjct: 301 NLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNFNDTLV 360

Query: 441 LSGTSMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYD--- 497
           LSGTSM++P V G+    L              S+G+ PE + ++L   ST+++ +    
Sbjct: 361 LSGTSMSTPIVTGVAAVLL--------------SKGIEPEMIAQELEYLSTRNVFHRRTL 406

Query: 498 -LPEDTPNALIYNG 510
                TPN ++YNG
Sbjct: 407 FFKPSTPNQILYNG 420

>TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {ON}
           Anc_6.313 YCR045C
          Length = 734

 Score =  171 bits (434), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 113/300 (37%), Positives = 154/300 (51%), Gaps = 36/300 (12%)

Query: 206 SEFDTQNGAPWGLSRISHRERL-----NLGSF----NKYLFDDEAGKGVTSYVIDTGINV 256
           S+F  Q GAP  L+RIS R++L     N   F    N Y  D++ G+GV +YVIDTGI  
Sbjct: 282 SKFKVQRGAPRHLARISTRDKLPFNFRNANQFEEQLNYYYDDNDKGEGVLAYVIDTGILK 341

Query: 257 KHQDFEGRAHWGKTIPTNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSG 316
           +H+DFE R  +G  + T +   D NGHGTH AG I SK Y             +   GS 
Sbjct: 342 EHKDFEDRVEFGTDL-TGEGAGDLNGHGTHVAGLIGSKTYGVDKKVKIIDVKAVSLTGST 400

Query: 317 SMSDVIKGVEFAAQSHQXXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAV 376
            +S +I+ +E+                     NMSLG      ++ AV +A+  G+ F V
Sbjct: 401 QLSHIIEAIEYTVND-----CNSRVDKKACVVNMSLGSFYVKVINEAVESAIAEGVVFVV 455

Query: 377 AAGNENQDACNTSPAAAEQAVTVGASTLSDDR----AYFSNYGKCVDIFAPGLNILSTYI 432
           AAGN N DAC +SP +++ A+TVGA    DDR    A FSN+G+CVDIFA G+ + S   
Sbjct: 456 AAGNNNIDACWSSPGSSKNAITVGA---FDDRLDVIAKFSNWGECVDIFASGVEVKSLSS 512

Query: 433 GSDDATATLSGTSMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTK 492
                    SGTSMASP V G ++  L              SQGV P  ++++++  STK
Sbjct: 513 QVPYKYIKYSGTSMASPIVCGFVSILL--------------SQGVKPNDVQEEMVKLSTK 558

>KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {ON}
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 496

 Score =  166 bits (419), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 115/317 (36%), Positives = 160/317 (50%), Gaps = 42/317 (13%)

Query: 211 QNGAPWGLSRISHR-------ERLNLGSFN-KYLFDDE-AGKGVTSYVIDTGINVKHQDF 261
           Q  AP  L+RIS R       E +++ + N  Y +DDE +G  V +YVIDTGI  +H   
Sbjct: 135 QKKAPRHLARISRRTALPYDPENISVPATNFSYYYDDEFSGTCVNAYVIDTGIYKEHPQL 194

Query: 262 EGRAHWGKTIPTNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDV 321
           EGRA +G  +   +   D NGHGTH AG I S+ +             L + G G+++ V
Sbjct: 195 EGRAKFGADL-VGEGPGDFNGHGTHVAGLIGSRKFGVAKDVSLIEVKALNAKGQGNLTSV 253

Query: 322 IKGVEFAAQSHQXXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNE 381
           I  +EF     +           G  AN+SLG  ++  L+ AV AA++AG+   VAAGN 
Sbjct: 254 ISAIEFTVNHCRKSRR-------GCVANLSLGSFRNTVLNQAVEAALEAGVVIVVAAGNS 306

Query: 382 NQDACNTSPAAAEQAVTVGASTLSDDR----AYFSNYGKCVDIFAPGLNILSTYIGSDDA 437
           N +AC +SPA++  A+TVGA    DDR    A FSN+G CVDIFAPG+ I S        
Sbjct: 307 NANACWSSPASSLSAITVGA---FDDRTDTIARFSNWGNCVDIFAPGVKIESLSNVPPFK 363

Query: 438 TATLSGTSMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYD 497
               SGTSMASP V+G++   L                G+ P  +K +LI  +T  + + 
Sbjct: 364 PVAFSGTSMASPIVSGMVANLL--------------DSGIHPFDIKTELIDLATDSVFHK 409

Query: 498 ----LPEDTPNALIYNG 510
                   TPN + + G
Sbjct: 410 RTLLFKPGTPNRVAFTG 426

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
           RRT12Probable subtilisin-family protease with a role in
           formation of the dityrosine layer of spore walls;
           localizes to the spore wall and also the nuclear
           envelope and ER region in mature spores
          Length = 491

 Score =  164 bits (415), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 113/314 (35%), Positives = 157/314 (50%), Gaps = 32/314 (10%)

Query: 211 QNGAPWGLSRISHRERLNL---------GSFNKYLFDDEAGKGVTSYVIDTGINVKHQDF 261
           Q  AP  L+RIS   +L             FN Y   D  G+ V +Y++DTGI   H +F
Sbjct: 125 QPDAPRHLARISRHYQLPFDVGDKDRYKSWFNYYYEHDYQGQDVNAYIMDTGIFADHPEF 184

Query: 262 EGRAHWGKTIPTNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDV 321
           E R   G  + T +   D NGHGTH AG + SK Y             L  +GSG  S+V
Sbjct: 185 EDRVIQGIDL-TKEGFGDQNGHGTHVAGLVGSKTYGAAKRVNLVEVKVLGKDGSGEASNV 243

Query: 322 IKGVEFAAQSHQXXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNE 381
           + G+EF  +                 AN+SLG  +SP +++AV  A++ GI F  AAGN 
Sbjct: 244 LSGLEFIVEH---CTKVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGNF 300

Query: 382 NQDACNTSPAAAEQAVTVGA-STLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATAT 440
           N DA   SPA+AE  +TVGA     D  A FSN+G CV+IFAPG+ I S    + + T  
Sbjct: 301 NLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNYNDTLI 360

Query: 441 LSGTSMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYD--- 497
           LSGTSM++P V G+    L              S+G+ PE + +++   ST+++ +    
Sbjct: 361 LSGTSMSTPIVTGVAAILL--------------SKGIEPEMIAQEIEYLSTRNVFHRRTL 406

Query: 498 -LPEDTPNALIYNG 510
                TPN ++YNG
Sbjct: 407 FFKPSTPNQILYNG 420

>NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313
          Length = 483

 Score =  164 bits (414), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 148/455 (32%), Positives = 201/455 (44%), Gaps = 90/455 (19%)

Query: 113 HRYIVVLKHSSPEEIALHMEAITQSQLQSV---GELAQDDPFFSAQGVRTTGGIQDSFDV 169
           H Y+V LK+S             QS + S    G+L +D            G I  +F  
Sbjct: 22  HEYLVSLKNSDS----------IQSFMDSTYAHGQLMKD---------YLHGKISKTFSF 62

Query: 170 AGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFD-------------------- 209
            G   G     T  VV  I+++P+V  V  +  +HA ++D                    
Sbjct: 63  -GSFRGLTVNLTKDVVSAIKENPLVVDVVPNMKIHAFDYDDFENNDGYDDIKQPEELFDK 121

Query: 210 ------TQNGAPWGLSRISHRERLNLGSFNKYLFDDE---------AGKGVTSYVIDTGI 254
                  QNGAP  L+R+S R  L     +K  ++D           G  V +Y+ID+GI
Sbjct: 122 NSYLVKVQNGAPRHLARLSRRMPLPYDFDDKDAYNDSLSYYYSKWHQGTDVNAYIIDSGI 181

Query: 255 NVKHQDFEGRAHWGKTIPTNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNG 314
           ++  ++FEGRA  G  + T +   D NGHGTH AG + SK Y             L   G
Sbjct: 182 DINQEEFEGRATHGLDL-TGEGPGDRNGHGTHVAGLVGSKTYGVAKNVTLVEVKALDRQG 240

Query: 315 SGSMSDVIKGVEFAAQSHQXXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHF 374
           SGS+  VI  +EF                    AN+SLG    P L+ A+ A V +G+  
Sbjct: 241 SGSLITVISALEFVVNH------CGKSKSKKCVANLSLGAFMMPLLNEAIKATVDSGVVV 294

Query: 375 AVAAGNENQDACNTSPAAAEQAVTVGASTLSDDR----AYFSNYGKCVDIFAPGLNILST 430
            VAAGN N DAC  SPA+ + A+TVGA    DDR    A FSN+G CVDIFAPG+ I S 
Sbjct: 295 VVAAGNGNIDACWCSPASEKSAITVGAF---DDRIDTIAKFSNWGSCVDIFAPGVAISSL 351

Query: 431 YIGSDDATATLSGTSMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYS 490
            I  +  +   SGTSMASP VAG+++  L               QGV  E ++  L   +
Sbjct: 352 SIKDNQKSVEFSGTSMASPQVAGIVSILL--------------DQGVENEDIRDYLFELA 397

Query: 491 TKDILYD----LPEDTPNALIYNGGGHGLKGFWDG 521
           T D+           TPN + +NG     + F DG
Sbjct: 398 TDDVFQKRTLLFKPRTPNRITFNGISKKDEDFEDG 432

>CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa]
           {ON} similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045c
          Length = 517

 Score =  163 bits (413), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 114/351 (32%), Positives = 160/351 (45%), Gaps = 52/351 (14%)

Query: 195 DFVEMDSPVHASEFDTQNGAPWGLSRISHRERLNL---------GSFNKYLFDDEAGKGV 245
           D  +++  + +    TQ+ AP  L+R+S R +L             FN Y +    G+ V
Sbjct: 144 DMPQVNGKLLSRYIKTQSEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQGRSV 203

Query: 246 TSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXX 305
            +YV+D+G+ + H DFEGRA++G     +    D NGHGTH AG I SK Y         
Sbjct: 204 NAYVLDSGVMIDHCDFEGRAYYGADFIRSGNSGDQNGHGTHVAGLIGSKTYGVSKKVNII 263

Query: 306 XXXXLRSNGSGSMSDVIKGVEFAAQSHQXXXXXXX------------------XXXXGST 347
               L S GSG++  V+ G+EF +                                    
Sbjct: 264 DVKVLDSVGSGTLDTVMSGLEFVSNHCNYKGKQGKQGKQGKPVWGSEDSHDDDVESKRCV 323

Query: 348 ANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTLSDD 407
            N+SLG  +S  ++ A+   +K GI   VAAGN N +AC TSPA+    +TVGA    DD
Sbjct: 324 INLSLGTFRSTIINEAIEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGA---FDD 380

Query: 408 R----AYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQP 463
           R    A FSN+G CVDIFAPG+ + S            +GTSMA+P V GL+   L    
Sbjct: 381 RIDSIAKFSNWGNCVDIFAPGVLVKSLSNKFPYYPIEQTGTSMATPIVTGLVALLL---- 436

Query: 464 DSDSDFFDAGSQGVTPEQLKKKLIAYSTKDIL----YDLPEDTPNALIYNG 510
                       G+ P Q+KK+L   +T +I           TPN + +NG
Sbjct: 437 ----------DSGIKPTQIKKRLNELATDNIFPRRTLLFKPGTPNRIAFNG 477

>KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {ON}
           Anc_6.313 YCR045C
          Length = 478

 Score =  162 bits (410), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 114/319 (35%), Positives = 161/319 (50%), Gaps = 43/319 (13%)

Query: 210 TQNGAPWGLSRISHRERL-----NLGS----FNKYLFDDEAGKGVTSYVIDTGINVKHQD 260
            Q+ AP  L+RIS R++L     N+ S    FN Y   +  G  V +Y++D+G++    D
Sbjct: 118 VQSEAPRHLARISRRDKLPYDFTNVSSYKKSFNYYYGKEHKGADVRAYILDSGVSRNLTD 177

Query: 261 FEGRAHWGKTIPTNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSD 320
           FEGR  +G    T D + D NGHGTH AG + SK Y             L   G G++  
Sbjct: 178 FEGRVEFGFDF-TGDGEGDSNGHGTHVAGLVGSKTYGVAKGVTMVDVKCLDEIGFGTLIT 236

Query: 321 VIKGVEFAAQ-SHQXXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAG 379
           V+  +EFA    H+              AN+SLG  K+  ++ A+ AA + G+   VAAG
Sbjct: 237 VLSAIEFAVNDCHEHPEKR-------CVANLSLGSFKNAIINKAIQAATEDGVVMVVAAG 289

Query: 380 NENQDACNTSPAAAEQAVTVGASTLSDDR----AYFSNYGKCVDIFAPGLNILSTYIGSD 435
           N N +AC TSPA+AE+A+TVGA    DDR    A FSN+G CVDI+APG+ + S      
Sbjct: 290 NFNINACWTSPASAEEAITVGA---FDDRIDTIAKFSNWGPCVDIYAPGVAVESLANFPM 346

Query: 436 DATATLSGTSMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDIL 495
               + SGTSMASP V G +   L               +G+  + +K  LI  +T D+ 
Sbjct: 347 VKNISYSGTSMASPIVCGQVAILL--------------DKGIPNDDIKSTLIKMATDDVF 392

Query: 496 YD----LPEDTPNALIYNG 510
                    +TPN +++NG
Sbjct: 393 QKRTLLFKPNTPNRVLFNG 411

>Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON}
           YCR045C (REAL)
          Length = 540

 Score =  161 bits (407), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 113/321 (35%), Positives = 158/321 (49%), Gaps = 32/321 (9%)

Query: 204 HASEFDTQNGAPWGLSRISHRERLNL---------GSFNKYLFDDEAGKGVTSYVIDTGI 254
            A     Q+ AP  L+RIS   +L             FN Y  DD  G+ V +Y++DTGI
Sbjct: 167 EAQNITYQSDAPRHLARISRHYQLPFDIEDKNRYKSWFNYYYEDDYLGQDVNAYIMDTGI 226

Query: 255 NVKHQDFEGRAHWGKTIPTNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNG 314
              H +FE R   G  + T +   D NGHGTH AG + SK Y             L  +G
Sbjct: 227 FSDHPEFEDRVIQGIDL-TKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDG 285

Query: 315 SGSMSDVIKGVEFAAQSHQXXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHF 374
           SG  S+V+ G+EF  +                 AN+SLG  +SP +++AV  A++ GI F
Sbjct: 286 SGEASNVLSGLEFIVEH---CTRVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGIVF 342

Query: 375 AVAAGNENQDACNTSPAAAEQAVTVGA-STLSDDRAYFSNYGKCVDIFAPGLNILSTYIG 433
             AAGN N DA   SPA+AE  +TVGA     D  A FSN+G CV+IFAPG+ I S    
Sbjct: 343 VAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHL 402

Query: 434 SDDATATLSGTSMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKD 493
           + + T  LSGTSM++P V G+    L              S+G+ P  + +++   ST++
Sbjct: 403 NYEDTLILSGTSMSTPIVTGVAAVLL--------------SKGIEPALIAQEIEYLSTRN 448

Query: 494 ILYD----LPEDTPNALIYNG 510
           + +         T N ++YNG
Sbjct: 449 VFHRRTLFFKPSTANQILYNG 469

>TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {ON}
           Anc_6.313 YCR045C
          Length = 607

 Score =  161 bits (408), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 116/319 (36%), Positives = 158/319 (49%), Gaps = 38/319 (11%)

Query: 209 DTQNGAPWGLSRISHRERL--------NLGSFNKYLFDDE-AGKGVTSYVIDTGINVKHQ 259
           D Q GAP  L ++S R +L            F  Y +D    G     Y+IDTG+  +H+
Sbjct: 148 DIQFGAPRHLGKLSSRHQLPYNVKDEKEFKEFIHYYYDRYYQGTNSVVYIIDTGVYKEHK 207

Query: 260 DFEGRAHWGKTIPTNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMS 319
           +F  R H+G      +   D NGHGTH AG I SK +             L   G G+++
Sbjct: 208 EFGNRVHFGGDF-IGEGKGDYNGHGTHVAGLIGSKTFGVAKNVTLFDVKVLDQKGFGNLT 266

Query: 320 DVIKGVEFAAQSHQXXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAG 379
            V++G+EFA  + +               NMSLG  ++P ++ A+  A  +GI   VAAG
Sbjct: 267 SVLEGIEFAVNNCKLKQQPMGK---NCVINMSLGTIRNPIINEAIKEAFLSGITPVVAAG 323

Query: 380 NENQDACNTSPAAAEQAVTVGASTLSDDR----AYFSNYGKCVDIFAPGLNILSTYIGSD 435
           N N  AC TSPA++  A+TVGA    DDR    A FSN+G+CVDIFAPG+ I S      
Sbjct: 324 NNNFSACWTSPASSNFAITVGA---MDDRTDTIAVFSNWGQCVDIFAPGVRIKSLSNRML 380

Query: 436 DATATLSGTSMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDIL 495
           +     SGTSMASP VAGL+   +               +G   +++K+KLI  S+K I 
Sbjct: 381 ENGVIHSGTSMASPIVAGLVAILM--------------EKGYKCDEIKQKLIDDSSKSIF 426

Query: 496 YDL----PEDTPNALIYNG 510
             L       TPN +IYNG
Sbjct: 427 SKLTLFFKYGTPNRVIYNG 445

>Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa]
           {ON} YCR045C - Hypothetical ORF [contig 15] FULL
          Length = 493

 Score =  149 bits (376), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 113/321 (35%), Positives = 159/321 (49%), Gaps = 42/321 (13%)

Query: 207 EFDTQNGAPWGLSRISHRERL---------NLGSFNKYLFDDEAGKGVTSYVIDTGINVK 257
           +F  Q  AP  L+RIS R  L            +F+ Y  D   G  V +YVIDTGI  +
Sbjct: 129 DFVAQKNAPRHLARISRRSALPYNPENIAPKTSNFSYYYDDSFPGTCVNAYVIDTGIFKE 188

Query: 258 HQDFEGRAHWGKTIPTNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGS 317
           H+ F+GRA +G  +   +   D NGHGTH AG I S+ Y             L + G G+
Sbjct: 189 HRQFQGRAKFGADL-VGEGPGDLNGHGTHVAGLIGSQKYGVAKDVSLIEVKALNAKGQGN 247

Query: 318 MSDVIKGVEFAAQSHQXXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVA 377
           ++ VI  +EF     +           G  AN+SLG  ++  L+ AV AA++AG+   VA
Sbjct: 248 LTSVISAIEFTVNHCRKSKR-------GCVANLSLGSFRNSVLNQAVEAALEAGVVVVVA 300

Query: 378 AGNENQDACNTSPAAAEQAVTVGASTLSDDR----AYFSNYGKCVDIFAPGLNILSTYIG 433
           AGN N +AC +SPA++  A++VGA    DDR    A FSN+G CVD+FAPG+ I S    
Sbjct: 301 AGNSNANACWSSPASSLSAISVGA---FDDRTDTIARFSNWGNCVDLFAPGVKIASLSNI 357

Query: 434 SDDATATLSGTSMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKD 493
               +   SGTSMASP V G++   L                G+ P  +K++LI  +T  
Sbjct: 358 PPFKSVAYSGTSMASPLVTGMVAVLL--------------DSGIHPFDIKEELINTATDS 403

Query: 494 ILYD----LPEDTPNALIYNG 510
           + +         TPN + + G
Sbjct: 404 VFHKRALLFKPGTPNRVAFTG 424

>KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some
           similarities with uniprot|P25036 Saccharomyces
           cerevisiae YOR003W YSP3 subtilisin-like protease III
          Length = 508

 Score =  141 bits (355), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 118/321 (36%), Positives = 160/321 (49%), Gaps = 44/321 (13%)

Query: 207 EFDTQNGAPWGLSRISHRERL------NLGSFNKYLFDDE-AGKGVTSYVIDTGINVKHQ 259
           +F +Q+ AP  L+RIS R +L      +  S  KY + +E  G+GV  YV+D+G+N  H 
Sbjct: 150 DFISQSRAPRHLARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNHDHP 209

Query: 260 DFEGRAHWGKTIPTNDEDL-DGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSM 318
           DFEGRA  G  I T  E   D  GHGTH AG I SK Y             L S G G++
Sbjct: 210 DFEGRAMKG--IDTTGEGSGDLVGHGTHVAGLIGSKTYGVAKKVNIVEVKVLDSMGKGTV 267

Query: 319 SDVIKGVEFAAQSHQXXXXXXXXXXXGSTANMSLGG-GKSPALDLAVNAAVKAGIHFAVA 377
           +++I+G+E+                     NMSLG  G    LD AV+A ++ G+   VA
Sbjct: 268 TNIIEGLEYVVNQ-------CIGKKRKCVINMSLGAPGTHSILDKAVSAVIEEGVVVVVA 320

Query: 378 AGNENQDACNTSPAAAEQAVTVGASTLSDDR----AYFSNYGKCVDIFAPGLNILSTYIG 433
            GN   +AC  SPA   +A+TV A    DDR    A FSN+G C+DI+APG+N+ S    
Sbjct: 321 GGNSGLNACWYSPAKVRKAITVAA---MDDRTDLMAPFSNWGACIDIWAPGVNVKSLS-N 376

Query: 434 SDDATATLSGTSMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKD 493
               T  LSGTSMASP VAG    +L               QG  P +++K L   +T+ 
Sbjct: 377 KGRGTFVLSGTSMASPIVAGAAAIYL--------------DQGADPAEVRKILSKTATRG 422

Query: 494 ILYD----LPEDTPNALIYNG 510
           +       +   TPN ++Y G
Sbjct: 423 VFKKRAIAVRPRTPNKVLYTG 443

>Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045C -
           Hypothetical ORF [contig 118] FULL
          Length = 377

 Score =  123 bits (308), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 88/288 (30%), Positives = 143/288 (49%), Gaps = 12/288 (4%)

Query: 178 GYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISHRERLNLGSFNKYLF 237
           G F   ++E +     +  + MD  +  +E+  Q  AP  L+R+S +  L  GS   Y++
Sbjct: 60  GDFPQRLLENLYYDGRITAMSMDHILTPAEYIVQEHAPAHLARLSQKSTLR-GSDGTYIY 118

Query: 238 DDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDL-DGNGHGTHCAGTIASKHY 296
               G GV  Y++DTGI+  H + EGR      + +N     D +GHGT  AG I S  +
Sbjct: 119 HSNGGNGVDVYLLDTGIDDLHPELEGRVQKIADLTSNPVSHGDPHGHGTAVAGVIGSATF 178

Query: 297 XXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAQSHQXXXXXXXXXXXGSTANMSLGGGK 356
                          S G+ ++  VI+ +E A++               S   +     K
Sbjct: 179 GSAKKCNLFDVRVADSTGNATLIGVIRALEHASK-------LASVTQRPSVVVIPFTMRK 231

Query: 357 SPALDLAVNAAVK-AGIHFAVAAGNENQDACNTSPAAAEQAVTVGA--STLSDDRAYFSN 413
           +  L+ A+ A ++   +   VA GN NQ+AC++SPA+A  A+T+G+   T  D  A F+N
Sbjct: 232 NVILNSAIEAVIRDQSLPVVVAGGNFNQNACDSSPASAYGALTIGSIDVTKGDSLAPFTN 291

Query: 414 YGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSL 461
           YG C+D FA G+NI S   G  ++    SGTS+++   +G++ Y++SL
Sbjct: 292 YGDCIDTFAAGVNITSLTTGDYESNTQYSGTSISAGIASGVVAYYMSL 339

>TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON}
           Anc_6.313 YCR045C
          Length = 497

 Score =  124 bits (312), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 97/310 (31%), Positives = 142/310 (45%), Gaps = 31/310 (10%)

Query: 207 EFDTQNGAPWGLSRISHRERLNLGS---FNKYLFDDEAGKGVTSYVIDTGINVKHQDFEG 263
           ++ TQ  AP  LSR S   +L   S   +N Y   D  G  VT YV+D+GI + H +FEG
Sbjct: 141 KYSTQFNAPRHLSRASRITKLPTASNFTYNYYYPRDYQGANVTVYVLDSGIRMDHPEFEG 200

Query: 264 RAHWGKTIPTNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDVIK 323
           R        T+    D  GHGT  AG I SK Y             L + G G++  +++
Sbjct: 201 RILEAYDF-TDSGVGDNYGHGTSVAGIIGSKTYGVAKNVNLIDIKVLNNKGKGNVFSILQ 259

Query: 324 GVEFAAQSHQXXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQ 383
           G++F  +  +               N SLG      L+ A      AGI    AAGN   
Sbjct: 260 GLQFITKHCEENTNG------NCIINASLGAINIQILNKAFEEVHNAGIPVICAAGNNAV 313

Query: 384 DACNTSPAAAEQAVTVGASTLSDDR-AYFSNYGKCVDIFAPGLNILSTYIGSDDATATLS 442
           +AC  +PA ++   TVG+    DD  A FSN+G+CVD+ APG+ + +    +   +   S
Sbjct: 314 NACWITPAGSKGVFTVGSFDDRDDTIATFSNWGRCVDMMAPGVYVRTLLYTNQKGSRESS 373

Query: 443 GTSMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYD----- 497
           GTS+++P V GL    L              S+GV  E L  ++    ++D+L +     
Sbjct: 374 GTSVSTPIVTGLAAILL--------------SKGVPKENLYDEIRKMGSRDLLRNKEFSR 419

Query: 498 LPEDTPNALI 507
           LP  TPN ++
Sbjct: 420 LP-GTPNLIV 428

>KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 380

 Score =  121 bits (304), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 90/292 (30%), Positives = 149/292 (51%), Gaps = 17/292 (5%)

Query: 178 GYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISHRERLNLGSFN---K 234
           G F   ++E   +S  +  + MD P+  +E+  Q  AP  L+R+S +  L  G+ +    
Sbjct: 60  GEFPQQLLEDFYRSGQIVAMSMDRPLGVAEYMVQQHAPNHLARLSQKSSLRGGNGSDNGA 119

Query: 235 YLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDL-DGNGHGTHCAGTIAS 293
           Y++   AG GV  Y++DTGI+  H  FEGR        ++     D +GHGT  AG I S
Sbjct: 120 YIYHSNAGNGVDVYLLDTGIDGTHPAFEGRVQKAADFSSDPVATGDPHGHGTAVAGVIGS 179

Query: 294 KHYXXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAQSHQXXXXXXXXXXXGSTANMSLG 353
             +               S G  S+  V++ +E A++               S   + L 
Sbjct: 180 SVFGVAKKCNLFDVRVANSTGHASLIGVLRALEHASK-------LAAVTKRPSLITIPLE 232

Query: 354 GGKSPALDLAVNAAVK-AGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTLS--DDRAY 410
             ++  L+ AV A V+   I   VAAGNEN+ AC+ SPA A  A+T+G+  ++  D  A 
Sbjct: 233 MPRNTILNSAVEAVVRDLSIPVVVAAGNENRSACSVSPAGAYGALTIGSIDVARNDALAP 292

Query: 411 FSNYGKCVDIFAPGLNILSTYIGSDDATA-TLSGTSMASPHVAGLLTYFLSL 461
           F+N+ +CVD+F  G+++ +  +G D ++   LSGTS+++   +GL+ Y++S+
Sbjct: 293 FTNFAECVDLFTAGVDVAT--LGLDHSSEHHLSGTSISAGVASGLVAYYMSI 342

>Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa]
           {ON} complement(151054..152214) [1161 nt, 387 aa]
          Length = 386

 Score =  115 bits (289), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 91/304 (29%), Positives = 150/304 (49%), Gaps = 24/304 (7%)

Query: 173 LNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISH---RERLNL 229
            +G+ G F D V+  +   P V  + +D  ++  E+  QN AP  L+R+S+     R++ 
Sbjct: 61  FHGFSGEFEDEVMSELYGDPRVASISIDRMLYLQEYLRQNDAPEHLARLSNGVSNSRVSA 120

Query: 230 GSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDL---DGNGHGTH 286
            + N ++F   AG GV  Y++D+GI+ +H  F  R H  K I   D  +   D +GHGT 
Sbjct: 121 KNENAFIFHSHAGIGVDVYIVDSGIDSQHPAFMNR-HISKLIDLTDNPIPVGDPHGHGTA 179

Query: 287 CAGTIASKHYXXXXXXXXXXXXXLRSNGSG-SMSDVIKGVEFAAQSHQXXXXXXXXXXXG 345
            AG + S  +             + +  +G  +S ++K +EF  ++H             
Sbjct: 180 IAGLVTSDTFGVMKKANLFDVRVVDAESNGVKLSKLLKSLEF-IENHSRATMRP------ 232

Query: 346 STANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTLS 405
           S A +     K+  L+ A+  ++   I   V AGN++  ACN SPA+A  + ++ +    
Sbjct: 233 SVAVLPFSMSKNAILNSAIE-SMPNSIAIVVPAGNQHHMACNFSPASARNSQSILSVGSL 291

Query: 406 DDR-----AYFSNYGKCVDIFAPGLNI--LSTYIGSDD-ATATLSGTSMASPHVAGLLTY 457
           D R     A FSNYG+CVD+F  G+ +  L     SD+   + +SGTSM+    AG + Y
Sbjct: 292 DYRSSIEIASFSNYGECVDVFTSGVQMDTLHATTNSDENYISKVSGTSMSCAIAAGTVGY 351

Query: 458 FLSL 461
           ++SL
Sbjct: 352 YMSL 355

>ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]
           {ON} conserved hypothetical protein
          Length = 386

 Score = 94.0 bits (232), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 84/313 (26%), Positives = 135/313 (43%), Gaps = 24/313 (7%)

Query: 163 IQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRIS 222
           I D F++ G    + G F+  +++ +   P V  +  D  +   E   QN AP  L  +S
Sbjct: 45  ITDIFEL-GSFRAFTGDFSGPILQKLYNDPNVLAISRDGSLKLQEIVLQNNAPSHLVGLS 103

Query: 223 HRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTND---EDLD 279
               L   S   +++    G GV  Y++DTGI++KH +            T     +  D
Sbjct: 104 SISPL---SHQPFIYRSNGGNGVDVYLLDTGIDIKHPNLSKLNILRMADLTQSPVPQGTD 160

Query: 280 GNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAQSHQXXXXXX 339
             GHGT  AG IAS+ +               SNG   +S +++ +    Q H       
Sbjct: 161 PQGHGTAMAGIIASETFGVLKKCNLVDVRVADSNGDVKLSTILQALTL-TQRHIEGTKRP 219

Query: 340 XXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAA----EQ 395
                     + +  G +P L  A+ A+    +   + AGN  QDA N SPA      + 
Sbjct: 220 SVV----VIPLEVEDGNNPILTEAI-ASFDQSVPIIIPAGNNAQDALNFSPANVNPKPKN 274

Query: 396 AVTVGASTLSDDRAYFSNYGKCVDIFAPGLNI-------LSTYIGSDDATATLSGTSMAS 448
            + VG+  ++++   F+NYG  VD+F  G  I       L +   S+  T  +SGTS +S
Sbjct: 275 IIVVGSVDVNNNPTKFTNYGSNVDVFTVGEQITTLQSTDLDSQGLSNSLTRQVSGTSASS 334

Query: 449 PHVAGLLTYFLSL 461
              AG++ Y++SL
Sbjct: 335 AITAGVIGYYMSL 347

>TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa]
           {ON} Anc_1.78
          Length = 388

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/270 (27%), Positives = 126/270 (46%), Gaps = 31/270 (11%)

Query: 211 QNGAPWGLSRISHRERLNLGSF----NKYLFDDEAGKGVTSYVIDTGINVKHQDF-EGRA 265
           Q  AP  L R++ ++ +    +    N+Y+F D +G GV  Y++DTGI+++H  + +   
Sbjct: 97  QTDAPKHLGRLT-KDSIKSSQYHYANNQYIFSDTSGNGVDIYIVDTGIDIQHPIYLQNNI 155

Query: 266 HWGKTIPTNDEDL---DGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLRSNGS-GSMSDV 321
           H  K I      +   D NGHGT  AG I S  +             + +N    +MS V
Sbjct: 156 H--KLIDLTTSPIPSGDFNGHGTAMAGIINSDPFGVLKSANLVDVRVVDANTKHATMSRV 213

Query: 322 IKGVEFAAQSHQXXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNE 381
           +  +    +  Q            S   +     K+  L+ A+    K  I   + AGN+
Sbjct: 214 LSALSLIEKHEQKTMRP-------SIIVLPFQTEKNTILESAIENISKK-IPVIIPAGNK 265

Query: 382 NQDACNTSPAAAEQ---AVTVGASTLSDDRAY-----FSNYGKCVDIFAPGLNILSTYIG 433
           +Q+AC  SP   ++    + VG+   S+++ Y     FSNYG CVDI+  G++I +    
Sbjct: 266 HQNACKLSPMGIKKLSNVLVVGSLEYSEEQNYLDIAKFSNYGSCVDIYTSGVDISTLKTS 325

Query: 434 SD---DATATLSGTSMASPHVAGLLTYFLS 460
           S+   +    ++GTS +   VAG++ Y++S
Sbjct: 326 SNGGKELIHNVTGTSYSCGIVAGVVGYYMS 355

>TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa]
           {ON} Anc_1.78
          Length = 364

 Score = 85.9 bits (211), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 84/290 (28%), Positives = 127/290 (43%), Gaps = 21/290 (7%)

Query: 178 GYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISHRERLNLGSFNKYLF 237
           G F+   +E +     V  +  D  +   E+  Q G+P  LS++S       GSF    F
Sbjct: 58  GEFSVEDLEYLYHDERVVAISRDRDLKLQEYKVQYGSPRHLSQLSSG-----GSFT---F 109

Query: 238 DDEAGKGVTSYVIDTGINVKH---QDFEGRAHWGKTIPTNDEDLDGNGHGTHCAGTIASK 294
           D  +G  V  YV DTGI+ KH   Q+         T        D +GHGT  AG IAS+
Sbjct: 110 DPVSGNLVDVYVFDTGIDFKHPGLQNVNPHKLADFTSSPVPRGADPHGHGTMMAGLIASE 169

Query: 295 HYXXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAQSHQXXXXXXXXXXXGSTANMSLGG 354
            +                +G   +S ++KG+  A+ +H              T      G
Sbjct: 170 TFGVLKSCSLVDVRVADKDGEVKLSTLMKGIS-ASVAHARFTKRPSVFVLPMTI-----G 223

Query: 355 GKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTLSDDRAYFSNY 414
            K+  LD  + A  K  I   + AGN+  DAC+ SP      + +G+    +  A FSNY
Sbjct: 224 KKNHILDNFLQAIPK-DIAIVLPAGNQQTDACDLSPPNDHNILVIGSLDRDNRLADFSNY 282

Query: 415 GKCVDIFAPGLNIL---STYIGSDDATATLSGTSMASPHVAGLLTYFLSL 461
           G CVD++  G +IL   ST  G++    + +GTS +    AG++ Y +S+
Sbjct: 283 GNCVDVYTSGTDILTLRSTDSGNEVLLQSSNGTSASCAIGAGIVGYHMSM 332

>TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1.78
          Length = 382

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 78/281 (27%), Positives = 120/281 (42%), Gaps = 32/281 (11%)

Query: 197 VEMDSPVHASEFDTQNGAPWGLSRISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINV 256
           + +D  +   E   Q  AP  L+++   E       N++++D  AG GV  Y+ DTGI  
Sbjct: 83  ISIDRQLEPQEMIVQKDAPRHLTKLLETE----AGDNEFVYDSTAGNGVDIYIFDTGIAR 138

Query: 257 KHQDFEG-RAHWGKTIP----TNDEDLDGNGHGTHCAGTIASKHYXXXXXXXXXXXXXLR 311
                   R H    +P     + E L+   HGT  +G I S  +               
Sbjct: 139 NSPGLSASRIHDMPGMPGPPIRDQEILE---HGTAMSGLIGSPAFGVLKKCNLIDVNVGD 195

Query: 312 SNGSGSMSDVIKGVEFAAQSHQXXXXXXXXXXXGSTANMSLGGGKSPALDLAVNAAVKAG 371
            NG   MS V+KG+    Q  +            S  N S    K+  L+ A +   +  
Sbjct: 196 ENGKVFMSKVLKGLNLVQQHVKHTNRP-------SVINFSYCTLKNAILNSAFDNFPR-D 247

Query: 372 IHFAVAAGNENQDACNTSPAAAEQ---AVTVGASTLSDD---RAYFSNYGKCVDIFAPGL 425
           +  AVAAGN  Q  C+ SP   ++    +  G+  ++DD    + FSNYG CV  +APG 
Sbjct: 248 VPIAVAAGNYKQPGCSFSPVGCQRNKSLLAFGSLLMNDDGITLSDFSNYGSCVGSYAPGE 307

Query: 426 NILSTYI------GSDDATATLSGTSMASPHVAGLLTYFLS 460
            +L+  I       S D    +SGTS +S   AG++ Y+++
Sbjct: 308 GLLTFGIPDTSRPNSRDTVIIISGTSGSSALGAGVIGYYMA 348

>Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238W
           (REAL)
          Length = 819

 Score = 35.0 bits (79), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 6/67 (8%)

Query: 234 KYLFDDEAGKGVTSYVIDTGINVKHQD----FEGRAHWGKTIPTN--DEDLDGNGHGTHC 287
           K  +++  G GV + ++D G++ +++D    F     W     TN     L  + HGT C
Sbjct: 158 KLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDYHGTRC 217

Query: 288 AGTIASK 294
           AG IA+K
Sbjct: 218 AGEIAAK 224

>SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 836

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 6/63 (9%)

Query: 237 FDDEAGKGVTSYVIDTGINVKHQDF------EGRAHWGKTIPTNDEDLDGNGHGTHCAGT 290
           +++  G GV + ++D G++ +++D       EG   +    P     L  + HGT CAG 
Sbjct: 185 YENITGHGVVAAIVDDGLDYENRDLKDNFCAEGSWDFNDNTPLPKPRLRDDYHGTRCAGE 244

Query: 291 IAS 293
           IA+
Sbjct: 245 IAA 247

>TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6
           YNL238W
          Length = 842

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 6/59 (10%)

Query: 241 AGKGVTSYVIDTGINVKHQD------FEGRAHWGKTIPTNDEDLDGNGHGTHCAGTIAS 293
            GK VT  ++D G++ +++D      FEG   +          L  + HGT CAG IA+
Sbjct: 166 TGKNVTVAIVDDGVDYENEDLKDKFCFEGSWDFNDNTAKPKPRLSDDYHGTRCAGEIAA 224

>YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}
           KEX2Subtilisin-like protease (proprotein convertase), a
           calcium-dependent serine protease involved in the
           activation of proproteins of the secretory pathway
          Length = 814

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 6/64 (9%)

Query: 237 FDDEAGKGVTSYVIDTGINVKHQD----FEGRAHWGKTIPTN--DEDLDGNGHGTHCAGT 290
           +++  G GV + ++D G++ +++D    F     W     TN     L  + HGT CAG 
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDYHGTRCAGE 220

Query: 291 IASK 294
           IA+K
Sbjct: 221 IAAK 224

>Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238W
           (REAL)
          Length = 809

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 6/64 (9%)

Query: 237 FDDEAGKGVTSYVIDTGINVKHQD----FEGRAHWGKTIPTN--DEDLDGNGHGTHCAGT 290
           +++  G GV + ++D G++ +++D    F     W     TN     L  + HGT CAG 
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDYHGTRCAGE 220

Query: 291 IASK 294
           IA+K
Sbjct: 221 IAAK 224

>Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W
           (REAL)
          Length = 814

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 6/64 (9%)

Query: 237 FDDEAGKGVTSYVIDTGINVKHQD----FEGRAHWGKTIPTN--DEDLDGNGHGTHCAGT 290
           +++  G GV + ++D G++ +++D    F     W     TN     L  + HGT CAG 
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLLDDYHGTRCAGE 220

Query: 291 IASK 294
           IA+K
Sbjct: 221 IAAK 224

>ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]
           {ON} similar to uniprot|P13134 YNL238W Saccharomyces
           cerevisiae KEX2 Subtilisin-like protease (proprotein
           convertase)
          Length = 790

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 6/63 (9%)

Query: 237 FDDEAGKGVTSYVIDTGINVKHQDF------EGRAHWGKTIPTNDEDLDGNGHGTHCAGT 290
           +++  G GV + ++D G++ + +D       EG   +          LD + HGT CAG 
Sbjct: 154 YENITGHGVVAAIVDDGLDYESEDLKDNFCKEGSWDFNDNTKLPKPRLDDDYHGTRCAGE 213

Query: 291 IAS 293
           IA+
Sbjct: 214 IAA 216

>KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa]
           {ON} Anc_2.6 YNL238W
          Length = 766

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 6/63 (9%)

Query: 237 FDDEAGKGVTSYVIDTGINVKHQD----FEGRAHWGKTIPTN--DEDLDGNGHGTHCAGT 290
           + +  GKGV + V+D G++ ++ D    F     W     TN     L  + HGT CAG 
Sbjct: 152 YQNITGKGVVAAVVDDGLDYENPDIKDNFCKEGSWDFNANTNLPKPTLADDYHGTRCAGE 211

Query: 291 IAS 293
           IA+
Sbjct: 212 IAA 214

>TPHA0P01790 Chr16 complement(373247..375646) [2400 bp, 799 aa] {ON}
           Anc_2.6 YNL238W
          Length = 799

 Score = 31.2 bits (69), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 10/65 (15%)

Query: 237 FDDEAGKGVTSYVIDTGINVKHQD----FEGRAHW----GKTIPTNDEDLDGNGHGTHCA 288
           F    GKGV + ++D G++   +D    F     W     K +PT    L  + HGT CA
Sbjct: 158 FSGITGKGVVAAIVDDGLDHNSEDLKDNFCEEGSWDFNENKKLPT--PKLIDDYHGTRCA 215

Query: 289 GTIAS 293
           G IA+
Sbjct: 216 GEIAA 220

>KLLA0D19811g Chr4 complement(1672338..1674608) [2271 bp, 756 aa]
           {ON} uniprot|P09231 Kluyveromyces lactis KLLA0D19811g
           KEX1 protease precursor
          Length = 756

 Score = 31.2 bits (69), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 6/58 (10%)

Query: 242 GKGVTSYVIDTGINVKHQDF------EGRAHWGKTIPTNDEDLDGNGHGTHCAGTIAS 293
           G GV + ++D G++ +++D       EG   +    P     L  + HGT CAG IA+
Sbjct: 155 GYGVVAALVDDGLDYENEDLKDNFCVEGSWDFNDNNPLPKPRLKDDYHGTRCAGEIAA 212

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.134    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,201,491
Number of extensions: 2314650
Number of successful extensions: 4293
Number of sequences better than 10.0: 77
Number of HSP's gapped: 4183
Number of HSP's successfully gapped: 78
Length of query: 564
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 449
Effective length of database: 40,294,809
Effective search space: 18092369241
Effective search space used: 18092369241
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)