Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G045406.15ON24524510781e-150
NDAI0I022506.15ON2712207472e-99
KAFR0A050606.15ON2692317446e-99
KLTH0C11352g6.15ON2682377376e-98
NCAS0D026606.15ON2612177332e-97
SAKL0E01056g6.15ON2692287245e-96
KLLA0D01023g6.15ON2682207245e-96
Kpol_1045.746.15ON2572137226e-96
Kwal_56.223996.15ON2742287238e-96
Suva_15.1796.15ON2592117201e-95
Skud_15.1656.15ON2572257175e-95
Smik_15.1736.15ON2512267113e-94
KNAG0F028806.15ON2692267021e-92
ZYRO0C07920g6.15ON2932157013e-92
ACR011C6.15ON2532146852e-90
YOR004W (UTP23)6.15ON2542066828e-90
CAGL0E02673g6.15ON2632106515e-85
Ecym_30196.15ON2662156501e-84
TPHA0J002806.15ON2712156213e-80
TBLA0A072906.15ON2591775318e-67
KLTH0E02860g5.392ON1891431381e-09
Kwal_55.200895.392ON1891461372e-09
ZYRO0A06754g5.392ON1891431335e-09
Kpol_1055.185.392ON1891431329e-09
AEL102W5.392ON1891431302e-08
KLLA0A07018g5.392ON1891431302e-08
NDAI0C045505.392ON1891431283e-08
SAKL0G07766g5.392ON1891431265e-08
TPHA0D023105.392ON1891431266e-08
NCAS0F030905.392ON1891431266e-08
Ecym_74695.392ON1891431266e-08
TDEL0E023305.392ON1891431257e-08
KNAG0C052705.392ON1891461258e-08
CAGL0M01056g5.392ON1891431241e-07
Suva_2.5095.392ON1891431241e-07
Skud_4.6065.392ON1891431231e-07
Smik_4.5995.392ON1891431231e-07
YDR339C (FCF1)5.392ON1891431231e-07
KAFR0D042805.392ON1891461212e-07
TBLA0H017505.392ON1891431186e-07
TPHA0F024306.31ON79856750.46
Kwal_23.45752.48ON78521674.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G04540
         (245 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON...   419   e-150
NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15...   292   2e-99
KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {...   291   6e-99
KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {O...   288   6e-98
NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON...   286   2e-97
SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar t...   283   5e-96
KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar t...   283   5e-96
Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {...   282   6e-96
Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W...   283   8e-96
Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W...   281   1e-95
Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W...   280   5e-95
Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W...   278   3e-94
KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON...   275   1e-92
ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {O...   274   3e-92
ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON} Sy...   268   2e-90
YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}  UTP23Compo...   267   8e-90
CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar...   255   5e-85
Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to A...   254   1e-84
TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15 ...   243   3e-80
TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6....   209   8e-67
KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly ...    58   1e-09
Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C...    57   2e-09
ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly ...    56   5e-09
Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON...    55   9e-09
AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic hom...    55   2e-08
KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {O...    55   2e-08
NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {...    54   3e-08
SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly ...    53   5e-08
TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON...    53   6e-08
NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON...    53   6e-08
Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON} ...    53   6e-08
TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.39...    53   7e-08
KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5....    53   8e-08
CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly...    52   1e-07
Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}...    52   1e-07
Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {O...    52   1e-07
Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {O...    52   1e-07
YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON} ...    52   1e-07
KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.39...    51   2e-07
TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.39...    50   6e-07
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    33   0.46 
Kwal_23.4575 s23 complement(773675..776032) [2358 bp, 785 aa] {O...    30   4.5  

>TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON}
           Anc_6.15 YOR004W
          Length = 245

 Score =  419 bits (1078), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 215/245 (87%), Positives = 215/245 (87%)

Query: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60
           MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM
Sbjct: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60

Query: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120
           ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA
Sbjct: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120

Query: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLXXXXXXXXXXXXXXXLHKGLNDPRNAGIK 180
           SQDIDTRRILRRTPGVPLVHTVRSVMVMEPL               LHKGLNDPRNAGIK
Sbjct: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLSDASAKVSSAAEAEKLHKGLNDPRNAGIK 180

Query: 181 TENPQTSIKKRTKQPNPLSVKKRKTESKGEPKAAQDTEPVAXXXXXXXXXXXXXXXEPQG 240
           TENPQTSIKKRTKQPNPLSVKKRKTESKGEPKAAQDTEPVA               EPQG
Sbjct: 181 TENPQTSIKKRTKQPNPLSVKKRKTESKGEPKAAQDTEPVASNTKKRRRKHKSSTTEPQG 240

Query: 241 QEEST 245
           QEEST
Sbjct: 241 QEEST 245

>NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  292 bits (747), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 139/220 (63%), Positives = 164/220 (74%), Gaps = 13/220 (5%)

Query: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60
           MRQKRAK+YRKQ+LVYNHTFKFR PYQVLVDNQIVLDC  SN+DL KGL+ TLQ+EVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60

Query: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120
           ITQCCMQALYE N Q AIELA+ FERRRCNH PKEPK  IEC+ES+V +NG NKHRYVVA
Sbjct: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120

Query: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLXXXXXXXXXXXXXXXLHKGLNDPRNAGIK 180
           SQD+ TRR LR+ PGVPL+H  R+VM+MEPL               L+KGLNDP+  G+K
Sbjct: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180

Query: 181 TENPQTSIKKRT-------------KQPNPLSVKKRKTES 207
           +   + ++K++              K PNPLS+KK+KT S
Sbjct: 181 SAVDKETVKEKESTDQQKKKRKIGPKGPNPLSMKKKKTAS 220

>KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  291 bits (744), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 149/231 (64%), Positives = 169/231 (73%), Gaps = 12/231 (5%)

Query: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60
           MRQKRAK+YRKQ+LVY+HTFKFREPYQVLVDN+IV     SNFDLVKGL+RTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120
           ITQCCMQALYET  Q AI++AK FERRRCNHPPKEPK PIEC+ S+V VNG NKHRYVVA
Sbjct: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120

Query: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLXXXXXXXXXXXXXXXLHKGLNDPRNAGIK 180
           SQDID RR LRR PGVPLVH  RSVM+MEPL               L+KGLNDP+ AG+K
Sbjct: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180

Query: 181 TENPQ----------TSIKKRT-KQPNPLSVKKRKTESKGEPKAAQDTEPV 220
            +  +          T+ KKR  K PNPLSV+K K ++  EPK     + V
Sbjct: 181 LDEEEATETQGSGEKTAKKKRGPKGPNPLSVRK-KVKTLNEPKQTDKNDDV 230

>KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 268

 Score =  288 bits (737), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 152/237 (64%), Positives = 174/237 (73%), Gaps = 17/237 (7%)

Query: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60
           MRQKRAK+YRKQMLVYNH FKFREPYQVLVD+QIV D H ++FDLVKGLQRTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60

Query: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120
           ITQCC+QA+YET  Q AIELAK+FERRRCNHPPKE KPPIECL+S+V VNG+NKHRYVVA
Sbjct: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120

Query: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLXXXXXXXXXXXXXXXLHKGLNDPRNAGI- 179
           SQD   R+ LR+ PGVPL++  RSVMVMEPL               L KGLNDP+ AG+ 
Sbjct: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGLP 180

Query: 180 ------KTEN-PQTSIKKRT--KQPNPLSVKKRKT--ESKGEPK-----AAQDTEPV 220
                 KT+N  + S  KR   K PNPLS+KK+KT  +SK E       +  D EPV
Sbjct: 181 AEEEGGKTDNGTEVSKNKRKGPKGPNPLSIKKKKTVPDSKDESPPSDKISVTDAEPV 237

>NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON}
           Anc_6.15
          Length = 261

 Score =  286 bits (733), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 160/217 (73%), Gaps = 9/217 (4%)

Query: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60
           MRQKRAK+YRKQ+LVYNHTF+FREPYQ+LVDNQIV DC  SN+DL KGL RTLQAEVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60

Query: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120
           ITQCCMQALYE N Q AIELA+ FERRRCNH PK+PK PIEC+ES+V +NG NKHRYVVA
Sbjct: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120

Query: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLXXXXXXXXXXXXXXXLHKGLNDPRNAGIK 180
           +QD+  RR LR+ PGVPLVH  R+VM+MEPL               L+KGLNDP+  G+K
Sbjct: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGVK 180

Query: 181 T---------ENPQTSIKKRTKQPNPLSVKKRKTESK 208
           T         +      K   K PNPLS+KK+K E K
Sbjct: 181 TAAEDVKIDDKPKPKKSKYGPKSPNPLSMKKKKQEPK 217

>SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 269

 Score =  283 bits (724), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 167/228 (73%), Gaps = 11/228 (4%)

Query: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60
           MRQKRAK+YRKQMLVYNHTFKFREPYQVLVD+QIV+  + S+FDL KGL+RTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120
           ITQCCMQALY T  QGAIE+AKT+ERRRCNHPPKE K  +EC+ES+V  NG NKHRYVVA
Sbjct: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120

Query: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLXXXXXXXXXXXXXXXLHKGLNDPRNAGI- 179
           +QDID RR LRR PGVPL++  RSVMVMEPL               L KGLNDP++AG+ 
Sbjct: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGLA 180

Query: 180 ---------KTENPQTSIKKRT-KQPNPLSVKKRKTESKGEPKAAQDT 217
                      +  Q S KK   K+PNPLSVK+++ + +   KA  +T
Sbjct: 181 HDESVDLVDSVKQKQPSKKKGGPKEPNPLSVKRKRDQREENTKAPAET 228

>KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 268

 Score =  283 bits (724), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 143/220 (65%), Positives = 165/220 (75%), Gaps = 11/220 (5%)

Query: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60
           MRQKRAK+YRKQMLVYNHTFKFR+PYQVLVD+Q+VL+   S+FD VKGLQRTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60

Query: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120
           ITQCCMQ+LY+TN QGAI+  K FERRRCNH PKEPK  +ECL S+V VNG NKHRYVVA
Sbjct: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120

Query: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLXXXXXXXXXXXXXXXLHKGLNDPRNAGIK 180
           +QD++ RR LR+ PGVPLV+  RSVMVMEPL               L+KGLNDP+ AGI 
Sbjct: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA 180

Query: 181 --------TENPQTSIKKRT--KQPNPLSVKKRK-TESKG 209
                    EN +   KKR   K+PNPLS+KK+K TES G
Sbjct: 181 RDENDEAGAENQENKPKKRKGPKEPNPLSMKKKKTTESTG 220

>Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {ON}
           complement(173726..174499) [774 nt, 258 aa]
          Length = 257

 Score =  282 bits (722), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 136/213 (63%), Positives = 165/213 (77%), Gaps = 8/213 (3%)

Query: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60
           MRQ+RAK+YRKQMLVYNHTFKFREPYQ +VD+Q+VLDC  S FD++KGL+RTLQAEVKVM
Sbjct: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60

Query: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120
           ITQCCMQALY+T+ Q AI +AK FERRRCNHPPK+PK P+EC+ESIV + G NKHRYVVA
Sbjct: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120

Query: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLXXXXXXXXXXXXXXXLHKGLNDPRN-AGI 179
           SQD+D RR LR+ PGVP+VH  R+VM++EPL               L+KGLND ++ AG+
Sbjct: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 180

Query: 180 ------KTENPQTSIKKRT-KQPNPLSVKKRKT 205
                 K+E    S K +  KQPNPLS+KKRK+
Sbjct: 181 DEPKSEKSEKTSESKKNKGPKQPNPLSMKKRKS 213

>Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W -
           Protein required for cell viability [contig 185] FULL
          Length = 274

 Score =  283 bits (723), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 167/228 (73%), Gaps = 17/228 (7%)

Query: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60
           MRQKRAK+YRKQMLVYNH FKFREPYQVLVD+QIV D H + FDLVKGL+RTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120
           ITQCC+QA+YETN Q AIELAK+FERRRCNHPPKE KPP+ECL+S+V VNG NKHRYVVA
Sbjct: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120

Query: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLXXXXXXXXXXXXXXXLHKGLNDPRNAGIK 180
           +Q+ + R  LR+ PGVPLV   RSVMVMEPL               L KGLNDP+ AG+ 
Sbjct: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGLP 180

Query: 181 -TENPQTSI---------------KKRTKQPNPLSVKKRKT-ESKGEP 211
            TE P T+                +K  K PNPLS+KK+KT ES+ EP
Sbjct: 181 LTEQPATATAATVDKEGAGAPAKKRKGPKGPNPLSIKKKKTSESRKEP 228

>Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W
           (REAL)
          Length = 259

 Score =  281 bits (720), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 138/211 (65%), Positives = 159/211 (75%), Gaps = 7/211 (3%)

Query: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60
           MRQKRAK+YRKQ+LVY+HTFKFREPYQVLVDNQ+V +C GSNFDL  GL+RTLQA+VKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120
           ITQCC+QALYET  +GAI+LAK FERRRCNH  K+PK P EC+ES+V VNG NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120

Query: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLXXXXXXXXXXXXXXXLHKGLNDPR----N 176
           SQDID RR LR  PGVPL+H  RSVM+MEPL               L+KGLNDP      
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKAE 180

Query: 177 AGIKTENPQTSIKKRT---KQPNPLSVKKRK 204
           A  K    +++ KKR    K PNPLS+KK+K
Sbjct: 181 AISKGSEKESTPKKRKAGPKAPNPLSMKKKK 211

>Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W
           (REAL)
          Length = 257

 Score =  280 bits (717), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 141/225 (62%), Positives = 165/225 (73%), Gaps = 12/225 (5%)

Query: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60
           MRQKRAK+YRKQ+LVY+HTFKFREPYQVLVDNQ+V +C GSNF+L  GL+RTLQA+VKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120
           ITQCC+QALYET  +GAI+LAK FERRRCNH  K+PK P EC+ES+V VNG NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120

Query: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLXXXXXXXXXXXXXXXLHKGLNDP---RNA 177
           SQDI  RR LR  PGVPL+H  RSVM+MEPL               L KGLNDP   +  
Sbjct: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTE 180

Query: 178 GIKTENPQTSIKKRT----KQPNPLSVKKRKT-----ESKGEPKA 213
            + +E+ + S  K+     K PNPLSVKK+KT     E+KGE  A
Sbjct: 181 KVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQPSNETKGEDDA 225

>Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W
           (REAL)
          Length = 251

 Score =  278 bits (711), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 165/226 (73%), Gaps = 9/226 (3%)

Query: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60
           MRQKRAK+YRKQ+LVY+HTFKFREPYQVLVDNQ+VL+C+GSNF+L  GL+RTLQA+VKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120
           ITQCC+QALYET  +GAI+LAK FERRRCNH  K+PK P +C+ES+V +NG NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120

Query: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLXXXXXXXXXXXXXXXLHKGLNDPRNAGIK 180
           SQDI  RR LR  PGVPL+H  RSVMVMEPL               L+KGLNDP    ++
Sbjct: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNVDKVQ 180

Query: 181 ----TENPQTSIKKRT---KQPNPLSVKKRKT--ESKGEPKAAQDT 217
                   ++  KKR    K PNPLSVKK+K    +  E +  +DT
Sbjct: 181 EISEGSGKESVTKKRKFGPKAPNPLSVKKKKKAYSTSDEARGKEDT 226

>KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  275 bits (702), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 133/226 (58%), Positives = 160/226 (70%), Gaps = 14/226 (6%)

Query: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60
           MRQKRAK+YRKQ+LVYNHTF+FREPYQV++D++IVL    S FDL K LQRT+QAEVK+M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQVILDDEIVLQATESKFDLYKALQRTVQAEVKLM 60

Query: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120
           ITQCCMQALY TN + AI++AK +ERRRCNHPPK+PK P EC+ES+V + G NKHRY+VA
Sbjct: 61  ITQCCMQALYATNNRQAIDMAKRYERRRCNHPPKDPKSPFECIESVVDIKGENKHRYIVA 120

Query: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLXXXXXXXXXXXXXXXLHKGLNDPRNAGIK 180
            Q+ID RR LRR PGVPL+H  R+VM+MEPL               L  GLND + AGIK
Sbjct: 121 CQNIDLRRKLRRVPGVPLIHVSRAVMIMEPLSDASARISKRMEQQKLFSGLNDAKAAGIK 180

Query: 181 T-----------ENPQTSIKKRT---KQPNPLSVKKRKTESKGEPK 212
                       E P+   KKR    KQPNPLS+KK+K +   E K
Sbjct: 181 AAETEKVEDKGKEAPEAKPKKRKLGPKQPNPLSMKKKKKDGNSEQK 226

>ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 293

 Score =  274 bits (701), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 159/215 (73%), Gaps = 11/215 (5%)

Query: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60
           MRQKRAK+Y+KQMLVYN+ F+FREPYQVL+D+Q+V DC  S++DLV GL+RTLQAEVK M
Sbjct: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120
           ITQCCMQALY T  Q AIEL K+FERRRCNHPPKE KPP EC++S+V VNG NKHRYVVA
Sbjct: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120

Query: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLXXXXXXXXXXXXXXXLHKGLNDPRNAGIK 180
           SQD+  RR LR+ PGVPL+H  RSVMVMEPL               L KGLNDP+ AG+K
Sbjct: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGLK 180

Query: 181 T----EN-------PQTSIKKRTKQPNPLSVKKRK 204
           T    EN       P    +K  K PNPLSV+K++
Sbjct: 181 TTPSVENELESESQPPAKKRKGPKGPNPLSVRKKQ 215

>ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR004W
          Length = 253

 Score =  268 bits (685), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 154/214 (71%), Gaps = 11/214 (5%)

Query: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60
           MRQKRAKAY+KQMLVYNHTFKFREPYQVLVD+QIVL+ + S+FDL+KGL+RTLQAEVK M
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120
           ITQCCMQ LY+T  Q AI   K +ERRRCNH  KEPK PIECL+S+V VNG N+HRY+VA
Sbjct: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYIVA 119

Query: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLXXXXXXXXXXXXXXXLHKGLNDPRNAGIK 180
           SQDI  RR LR+ PGVPLV+  R+VMVMEPL               L KGLNDP+  GI 
Sbjct: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIA 179

Query: 181 ----------TENPQTSIKKRTKQPNPLSVKKRK 204
                      E   T  +K  K PNPLS+KKRK
Sbjct: 180 ENSAPAGAQPAEGAPTLKRKGPKAPNPLSMKKRK 213

>YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}
           UTP23Component of the small subunit processome, involved
           in 40S ribosomal subunit biogenesis; interacts with
           snR30 and is required for dissociation of snR30 from
           large pre-ribosomal particles; has homology to PINc
           domain protein Fcf1p, although the PINc domain of Utp23p
           is not required for function; essential protein
          Length = 254

 Score =  267 bits (682), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 131/206 (63%), Positives = 152/206 (73%), Gaps = 7/206 (3%)

Query: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60
           MRQKRAK+YRKQ+LVY+HTFKFREPYQVLVDNQ+VL+C+ SNF+L  GL+RTLQA+VKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120
           ITQCC+QALYET   GAI LAK FERRRCNH  K+PK P EC+ES+V ++G NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120

Query: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLXXXXXXXXXXXXXXXLHKGLNDPRNAGIK 180
           SQDID RR LR  PGVPL+H  RSVMVMEPL               L+KGLNDP    ++
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKLQ 180

Query: 181 TENP----QTSIKKRT---KQPNPLS 199
                   ++  KKR    K PNPLS
Sbjct: 181 ESGDGSGKESITKKRKLGPKAPNPLS 206

>CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004w
          Length = 263

 Score =  255 bits (651), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 149/210 (70%), Gaps = 10/210 (4%)

Query: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60
           MRQKRAK+YRKQ+LVYNHTFKFREPYQVL+D+QIV+D   S +DLVK L+RTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60

Query: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120
           ITQCCMQALYET  + AI+L K FERRRC H P E   P EC+ ++V V G NKHRYVVA
Sbjct: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120

Query: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLXXXXXXXXXXXXXXXLHKGLNDPRNAGIK 180
            QD++ RR+LR+ PGVPL+H  RSVM+MEPL               L +GLNDP+ AG+K
Sbjct: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180

Query: 181 T-------ENPQTSIKKRT---KQPNPLSV 200
                      QT  KKR    KQPNPLS+
Sbjct: 181 GEHEEEEQSKEQTVAKKRKIGPKQPNPLSM 210

>Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to
           Ashbya gossypii ACR011C
          Length = 266

 Score =  254 bits (650), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 154/215 (71%), Gaps = 14/215 (6%)

Query: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60
           MRQKRAKAY+KQMLVYNHTFKFR+PYQVLVD+Q+VL+ + S+FDL+KGL+RTLQAEVK M
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120
           ITQCC+Q LYE+  QGAI  AK +ERRRCNH  KEPK P EC+ S+V +NG N HRYVVA
Sbjct: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYVVA 119

Query: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLXXXXXXXXXXXXXXXLHKGLNDPRNAGIK 180
           +QDI+ RRILRR PGVPL++  RSVMVMEPL               L KGLNDP+ AG  
Sbjct: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLSSNSQQVSQQVENEKLVKGLNDPKYAGTP 179

Query: 181 TENPQTSIKKRT-------------KQPNPLSVKK 202
                 S+  ++             K+PNPLS+KK
Sbjct: 180 NNTEDASVDPKSPDANQLKRKIKGPKEPNPLSIKK 214

>TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  243 bits (621), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 122/215 (56%), Positives = 153/215 (71%), Gaps = 12/215 (5%)

Query: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAE-VKV 59
           MRQKRAK+Y+KQM+VYNHTFKFREPYQ+LVD QIV D   SN++L + L++TLQAE +KV
Sbjct: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60

Query: 60  MITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVV 119
           MITQCCMQ LY T+ Q  I+ AK FERRRCNH  K+PK P+EC+ESIV ++G NKHRYVV
Sbjct: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120

Query: 120 ASQDIDTRRILRRTPGVPLVHTVRSVMVMEPLXXXXXXXXXXXXXXXLHKGLNDPRNAGI 179
           A+Q+++ RR LRR PGVP++H  RSVM+MEP+               L+KGLNDP+ +  
Sbjct: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180

Query: 180 --------KTENPQ---TSIKKRTKQPNPLSVKKR 203
                    TE  Q   T  +K  K+PNPLS KK+
Sbjct: 181 PTPKEGTPDTEGTQPAATKKRKGVKEPNPLSKKKK 215

>TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6.15
           YOR004W
          Length = 259

 Score =  209 bits (531), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 97/177 (54%), Positives = 125/177 (70%), Gaps = 2/177 (1%)

Query: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAE--VK 58
           MRQKRAK+Y+KQ++VYNHTFKFREPYQV++D+ +V +   + ++L+KGL   L +   +K
Sbjct: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60

Query: 59  VMITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYV 118
            MITQCC+ ALY++  Q +I + KTFERRRCNH  KEP  P EC+ SIV VNG NKHRY+
Sbjct: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120

Query: 119 VASQDIDTRRILRRTPGVPLVHTVRSVMVMEPLXXXXXXXXXXXXXXXLHKGLNDPR 175
           VA+QD++ RR LR+ PGVPL+H  RSVMVMEPL               L  GLN  +
Sbjct: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTK 177

>KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 57.8 bits (138), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 70/143 (48%), Gaps = 13/143 (9%)

Query: 14  LVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVMITQCCMQALYETN 73
           L + +    + PYQVL+D   +        D+V+G+  TL A+   MIT C M  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDTLLAKCIPMITDCVMAELEKLG 110

Query: 74  KQG--AIELAKT--FERRRCNHPPKEPKPPIECLESIVCVNGHNKHR-YVVASQDIDTRR 128
            +   A++LA+    +R  C+H         +CL     VN   +H+ Y+VA+ D   ++
Sbjct: 111 PKYRIALKLARDPRIQRLTCSHKGTYAD---DCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 ILRRTPGVPLVHTVRSVMVMEPL 151
            +R+ PG+PL+       V+E L
Sbjct: 163 RIRKVPGIPLMSVGGHAYVIEKL 185

>Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C -
           Protein required for cell viability [contig 154] FULL
          Length = 189

 Score = 57.4 bits (137), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 70/146 (47%), Gaps = 19/146 (13%)

Query: 14  LVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVMITQCCMQALYETN 73
           L + +    + PYQVL+D   +        DLV+G+  TL A+   +IT C M    E  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDTLLAKCIPLITDCVMA---ELE 107

Query: 74  KQG-----AIELAKT--FERRRCNHPPKEPKPPIECLESIVCVNGHNKHR-YVVASQDID 125
           K G     A++LA+    +R  C+H         +CL     VN   +H+ Y+VA+ D  
Sbjct: 108 KLGPKYRIALKLARDPRIQRLSCSHKGTYAD---DCL-----VNRVLQHKCYIVATNDAA 159

Query: 126 TRRILRRTPGVPLVHTVRSVMVMEPL 151
            ++ +R+ PG+PL+       V+E L
Sbjct: 160 LKQRIRKVPGIPLMSVGGHAYVIEKL 185

>ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 55.8 bits (133), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 68/143 (47%), Gaps = 13/143 (9%)

Query: 14  LVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVMITQCCMQALYETN 73
           L + +    R PYQVL+D   +        D+VKG+   L A+   +IT C M  L +  
Sbjct: 51  LFFQYNQAIRPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  KQG--AIELAKT--FERRRCNHPPKEPKPPIECLESIVCVNGHNKHR-YVVASQDIDTRR 128
            +   A++LA+    +R  C H         +CL     VN   +H+ Y+VA+ D   ++
Sbjct: 111 PKYRIALKLARDPRIKRLSCTHKGTYAD---DCL-----VNRVMQHKCYIVATNDAPLKQ 162

Query: 129 ILRRTPGVPLVHTVRSVMVMEPL 151
            +R+ PG+PL+       V+E L
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKL 185

>Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON}
           complement(40805..41374) [570 nt, 190 aa]
          Length = 189

 Score = 55.5 bits (132), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 69/143 (48%), Gaps = 13/143 (9%)

Query: 14  LVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVMITQCCMQALYETN 73
           L + +    + PYQVL+D   +        D++KG+   L A+   +IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  KQG--AIELAKT--FERRRCNHPPKEPKPPIECLESIVCVNGHNKHR-YVVASQDIDTRR 128
            +   A+ LA+    +R  C+H         +C+     VN   +H+ Y+VA+ D+  ++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD---DCI-----VNRVLQHKCYIVATNDVGLKQ 162

Query: 129 ILRRTPGVPLVHTVRSVMVMEPL 151
            +R+ PG+PL+       V+E L
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKL 185

>AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR339C
          Length = 189

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 69/143 (48%), Gaps = 13/143 (9%)

Query: 14  LVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVMITQCCMQALYETN 73
           L + +    + PYQVL+D   +        DLV+G+   L A+   +IT C M  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 74  KQG--AIELAKT--FERRRCNHPPKEPKPPIECLESIVCVNGHNKHR-YVVASQDIDTRR 128
            +   A++LA+    +R  C+H         +CL     VN   +H+ Y+VA+ D   ++
Sbjct: 111 PKYRIALKLARDPRIKRLNCSHKGTYAD---DCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 ILRRTPGVPLVHTVRSVMVMEPL 151
            +R+ PG+PL+       V+E L
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKL 185

>KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {ON}
           highly similar to uniprot|Q05498 Saccharomyces
           cerevisiae YDR339C Protein required for cell viability
          Length = 189

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 70/143 (48%), Gaps = 13/143 (9%)

Query: 14  LVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVMITQCCMQALYETN 73
           L + +    + PYQVL+D   +        D+VKG+   L A+  ++IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNILITDCVMAELEKLG 110

Query: 74  KQG--AIELAKT--FERRRCNHPPKEPKPPIECLESIVCVNGHNKHR-YVVASQDIDTRR 128
            +   A++LA+    +R  C+H         +C+     V+   +H+ Y+VA+ D   ++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCI-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 ILRRTPGVPLVHTVRSVMVMEPL 151
            +R+ PG+PL+       V+E L
Sbjct: 163 RVRKVPGIPLMSVGGHSYVIEKL 185

>NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {ON}
           Anc_5.392
          Length = 189

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 69/143 (48%), Gaps = 13/143 (9%)

Query: 14  LVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVMITQCCMQALYETN 73
           L + +    + PYQVL+D   +        DLV+G+   L A+   +IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  KQG--AIELAKT--FERRRCNHPPKEPKPPIECLESIVCVNGHNKHR-YVVASQDIDTRR 128
            +   A++LA+    +R  C+H         +C+     VN   +H+ Y+VA+ D   ++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 ILRRTPGVPLVHTVRSVMVMEPL 151
            +R+ PG+PL+       V+E L
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKL 185

>SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 53.1 bits (126), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 68/143 (47%), Gaps = 13/143 (9%)

Query: 14  LVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVMITQCCMQALYETN 73
           L + +    + PYQVL+D   +        D+V+G+   L A+   +IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 74  KQG--AIELAKT--FERRRCNHPPKEPKPPIECLESIVCVNGHNKHR-YVVASQDIDTRR 128
            +   A+ LA+    +R  C+H         +CL     VN   +H+ Y+VA+ D   ++
Sbjct: 111 PKYRIALRLARDPRIKRLNCSHKGTYAD---DCL-----VNRVLQHKCYIVATNDAALKQ 162

Query: 129 ILRRTPGVPLVHTVRSVMVMEPL 151
            +R+ PG+PL+       V+E L
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKL 185

>TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 53.1 bits (126), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 67/143 (46%), Gaps = 13/143 (9%)

Query: 14  LVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVMITQCCMQALYETN 73
           L +      R PYQVL+D   +        D++KG+   L A+   +IT C M  L +  
Sbjct: 51  LFFQFNEAIRPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  KQG--AIELAKT--FERRRCNHPPKEPKPPIECLESIVCVNGHNKHR-YVVASQDIDTRR 128
            +   A+ LA+    +R  C+H         +C+     VN   +H+ Y+VA+ D   ++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD---DCI-----VNRVLQHKCYIVATNDQGLKQ 162

Query: 129 ILRRTPGVPLVHTVRSVMVMEPL 151
            +R+ PG+PL+       V+E L
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKL 185

>NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 53.1 bits (126), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 68/143 (47%), Gaps = 13/143 (9%)

Query: 14  LVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVMITQCCMQALYETN 73
           L + +    + PYQVL+D   +        DLVKG+   L A+   +IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  KQG--AIELAKT--FERRRCNHPPKEPKPPIECLESIVCVNGHNKHR-YVVASQDIDTRR 128
            +   A+ LA+    +R  C+H         +C+     VN   +H+ ++VA+ D   ++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD---DCI-----VNRVLQHKCFIVATNDAGLKQ 162

Query: 129 ILRRTPGVPLVHTVRSVMVMEPL 151
            +R+ PG+PL+       V+E L
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKL 185

>Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON}
           similar to Ashbya gossypii AEL102W
          Length = 189

 Score = 53.1 bits (126), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 69/143 (48%), Gaps = 13/143 (9%)

Query: 14  LVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVMITQCCMQALYETN 73
           L + +    + PYQVL+D   +        D+V+G+   L A+   +IT C M  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 74  KQG--AIELAKT--FERRRCNHPPKEPKPPIECLESIVCVNGHNKHR-YVVASQDIDTRR 128
            +   A++LA+    +R  C+H         +CL     VN   +H+ Y+VA+ D   ++
Sbjct: 111 PKYRIALKLARDPRIKRLTCSHRGTYAD---DCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 ILRRTPGVPLVHTVRSVMVMEPL 151
            +R+ PG+PL+       V+E L
Sbjct: 163 RIRKVPGIPLLSVGGHSYVIEKL 185

>TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 52.8 bits (125), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 67/143 (46%), Gaps = 13/143 (9%)

Query: 14  LVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVMITQCCMQALYETN 73
           L + +    + PYQVL+D   +        DLV+G+   L A+   +IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  KQG--AIELAKT--FERRRCNHPPKEPKPPIECLESIVCVNGHNKHR-YVVASQDIDTRR 128
            +   A++LA+    +R  C H         +C+     VN   +H+ Y+VA+ D   ++
Sbjct: 111 PKFRIALKLARDPRIKRLSCTHKGTYAD---DCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 ILRRTPGVPLVHTVRSVMVMEPL 151
            +R+ PG+PL+        +E L
Sbjct: 163 RVRKIPGIPLMSVGGHAYAIEKL 185

>KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 52.8 bits (125), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 69/146 (47%), Gaps = 19/146 (13%)

Query: 14  LVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVMITQCCMQALYETN 73
           L + +    + PYQVL+D   +        D+V+G+   L A+   +IT C    + E  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDC---VIAELE 107

Query: 74  KQG-----AIELAKT--FERRRCNHPPKEPKPPIECLESIVCVNGHNKHR-YVVASQDID 125
           K G     A++LA+    +R  C+H         +CL     VN   +H+ Y+VA+ D  
Sbjct: 108 KLGPKYRIALKLARDPRIKRLSCSHKGTYAD---DCL-----VNRVLQHKCYIVATNDAG 159

Query: 126 TRRILRRTPGVPLVHTVRSVMVMEPL 151
            ++ +R+ PG+PL+       V+E L
Sbjct: 160 LKQRVRKIPGIPLMSVGGHAYVIEKL 185

>CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339c
          Length = 189

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 68/143 (47%), Gaps = 13/143 (9%)

Query: 14  LVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVMITQCCMQALYETN 73
           L + +    + PYQVL+D   +        D+VKG+   L A+   +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 74  KQG--AIELAKT--FERRRCNHPPKEPKPPIECLESIVCVNGHNKHR-YVVASQDIDTRR 128
            +   A++LA+    +R  C H         +C+     VN   +H+ Y+VA+ D   ++
Sbjct: 111 PKYRIALKLARDPRIKRLTCTHKGTYAD---DCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 ILRRTPGVPLVHTVRSVMVMEPL 151
            +R+ PG+PL+       V+E L
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKL 185

>Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 69/143 (48%), Gaps = 13/143 (9%)

Query: 14  LVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVMITQCCMQALYETN 73
           L + +    + PYQVL+D   +        D+V+G+   L A+   +IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  KQG--AIELAKT--FERRRCNHPPKEPKPPIECLESIVCVNGHNKHR-YVVASQDIDTRR 128
            +   A++LA+    +R  C+H         +CL     V+   +H+ Y+VA+ D   ++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCL-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 ILRRTPGVPLVHTVRSVMVMEPL 151
            +R+ PG+PL+       V+E L
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKL 185

>Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 69/143 (48%), Gaps = 13/143 (9%)

Query: 14  LVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVMITQCCMQALYETN 73
           L + +    + PYQVL+D   +        D+V+G+   L A+   +IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  KQG--AIELAKT--FERRRCNHPPKEPKPPIECLESIVCVNGHNKHR-YVVASQDIDTRR 128
            +   A++LA+    +R  C+H         +CL     V+   +H+ Y+VA+ D   ++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCL-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 ILRRTPGVPLVHTVRSVMVMEPL 151
            +R+ PG+PL+       V+E L
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKL 185

>Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 69/143 (48%), Gaps = 13/143 (9%)

Query: 14  LVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVMITQCCMQALYETN 73
           L + +    + PYQVL+D   +        D+V+G+   L A+   +IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  KQG--AIELAKT--FERRRCNHPPKEPKPPIECLESIVCVNGHNKHR-YVVASQDIDTRR 128
            +   A++LA+    +R  C+H         +CL     V+   +H+ Y+VA+ D   ++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCL-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 ILRRTPGVPLVHTVRSVMVMEPL 151
            +R+ PG+PL+       V+E L
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKL 185

>YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON}
           FCF1Putative PINc domain nuclease required for early
           cleavages of 35S pre-rRNA and maturation of 18S rRNA;
           component of the SSU (small subunit) processome involved
           in 40S ribosomal subunit biogenesis; copurifies with
           Faf1p
          Length = 189

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 69/143 (48%), Gaps = 13/143 (9%)

Query: 14  LVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVMITQCCMQALYETN 73
           L + +    + PYQVL+D   +        D+V+G+   L A+   +IT C M  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  KQG--AIELAKT--FERRRCNHPPKEPKPPIECLESIVCVNGHNKHR-YVVASQDIDTRR 128
            +   A++LA+    +R  C+H         +CL     V+   +H+ Y+VA+ D   ++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCL-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 ILRRTPGVPLVHTVRSVMVMEPL 151
            +R+ PG+PL+       V+E L
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKL 185

>KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 69/146 (47%), Gaps = 19/146 (13%)

Query: 14  LVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVMITQCCMQALYETN 73
           L + +    + PYQVL+D   +        D+V+G+   L A+   +IT C    + E  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDC---VIAELE 107

Query: 74  KQG-----AIELAKT--FERRRCNHPPKEPKPPIECLESIVCVNGHNKHR-YVVASQDID 125
           K G     A++LA+    +R  C+H         +C+     VN   +H+ Y+VA+ D  
Sbjct: 108 KLGPKYRIALKLARDPRIKRLSCSHKGTYAD---DCI-----VNRVLQHKCYIVATNDAG 159

Query: 126 TRRILRRTPGVPLVHTVRSVMVMEPL 151
            ++ +R+ PG+PL+       V+E L
Sbjct: 160 LKQRVRKIPGIPLMSVGGHSYVIEKL 185

>TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 50.1 bits (118), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 69/143 (48%), Gaps = 13/143 (9%)

Query: 14  LVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVMITQCCMQALYETN 73
           L + +    + PYQVL+D   +        D+V+G+   L A+   +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVVAELEKLG 110

Query: 74  KQG--AIELAKT--FERRRCNHPPKEPKPPIECLESIVCVNGHNKHR-YVVASQDIDTRR 128
            +   A++LA+    +R  C+H         +C+     VN   +H+ Y+VA+ D   ++
Sbjct: 111 PKFRIALKLARDPRIKRLSCSHRGTYAD---DCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 ILRRTPGVPLVHTVRSVMVMEPL 151
            +R+ PG+PL+       V+E L
Sbjct: 163 RVRKIPGIPLMSVGGHSYVVEKL 185

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 33.5 bits (75), Expect = 0.46,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 12  QMLVYNHTFKFREPYQVLVDNQIVLDC--HGSNFDLVKGLQRTLQAEVKVMITQCC 65
           Q L Y+H  KF + ++  ++  I+L+   +GS  DL+K  +   +AEVK M TQ C
Sbjct: 145 QNLRYSHIVKFMDCFEDELNVYILLELCPNGSLMDLLKKRKILTEAEVKFMTTQVC 200

>Kwal_23.4575 s23 complement(773675..776032) [2358 bp, 785 aa] {ON}
           YNL201C - Hypothetical ORF [contig 5] FULL
          Length = 785

 Score = 30.4 bits (67), Expect = 4.5,   Method: Composition-based stats.
 Identities = 11/21 (52%), Positives = 16/21 (76%)

Query: 100 IECLESIVCVNGHNKHRYVVA 120
           + CL+SIVC+N    HRY++A
Sbjct: 618 VRCLKSIVCLNDEYYHRYLIA 638

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,856,801
Number of extensions: 783930
Number of successful extensions: 2542
Number of sequences better than 10.0: 45
Number of HSP's gapped: 2538
Number of HSP's successfully gapped: 45
Length of query: 245
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 138
Effective length of database: 41,212,137
Effective search space: 5687274906
Effective search space used: 5687274906
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)