Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G045306.16ON95895850570.0
ZYRO0C07898g6.16ON97499828300.0
SAKL0E01078g6.16ON94894225680.0
YEL061C (CIN8)6.16ON100093824940.0
Smik_5.266.16ON100293524800.0
Skud_5.286.16ON99893024600.0
Suva_5.66.16ON99993924480.0
NCAS0H008806.16ON100489024050.0
Kwal_56.224036.16ON94392823660.0
KLTH0C11330g6.16ON94176123250.0
TPHA0M002406.16ON93985722970.0
NDAI0D008706.16ON106993823030.0
KAFR0L003706.16ON96389622900.0
Ecym_30206.16ON94489022830.0
CAGL0B03641g6.16ON98886122220.0
ACR010C6.16ON94593622100.0
KNAG0M011306.16ON95093219520.0
Kpol_1032.66.16ON100468517740.0
Kpol_1045.736.16ON96293516010.0
KLLA0D01045g6.16ON96569915180.0
TBLA0A072306.16ON109758714400.0
TPHA0J003006.16ON98299812151e-150
ACR228C7.387ON11299169721e-114
SAKL0F12298g7.387ON11124589471e-110
Ecym_46887.387ON11344639431e-110
TDEL0C016007.387ON11055369311e-108
Suva_2.547.387ON11104629261e-108
ZYRO0B03234g7.387ON11384839241e-107
Skud_2.417.387ON11104749191e-106
NCAS0E026407.387ON11027769031e-104
KAFR0L017107.387ON11514559051e-104
NDAI0E043007.387ON11864519051e-104
YBL063W (KIP1)7.387ON11114688951e-103
Smik_2.537.387ON11134608911e-103
TPHA0E008907.387ON12325078679e-99
TBLA0D006407.387ON11424817292e-80
ADR145C2.633ON6353784842e-50
Ecym_34152.633ON6624094852e-50
KLLA0D05951g8.678ON6683534251e-42
KAFR0H024108.678ON6584143982e-39
Kpol_1004.255.531ON5063703895e-39
Kwal_26.88068.678ON7155603941e-38
ZYRO0E08668g3.528ON7783563932e-38
Kpol_1013.78.678ON6203573874e-38
Smik_7.483.528ON8053563906e-38
KLTH0D11286g8.678ON6783623823e-37
SAKL0F01760g3.528ON8093553853e-37
TPHA0D012708.678ON6963993762e-36
NCAS0F034703.479ON6984263752e-36
TPHA0D034803.528ON8473563773e-36
CAGL0M02189g8.678ON6723733743e-36
Kpol_423.83.528ON8063583763e-36
SAKL0H06490g8.678ON6574433699e-36
ZYRO0F07414g8.678ON6543733635e-35
TDEL0A062408.678ON6374573617e-35
Skud_16.1278.678ON7063783621e-34
NCAS0C013508.678ON6553583573e-34
SAKL0F03168g3.479ON7064123583e-34
TBLA0C039403.479ON7393673593e-34
Ecym_23958.678ON6873903574e-34
TBLA0C053103.479ON6763513565e-34
ACR145W8.678ON6853883548e-34
YPL155C (KIP2)8.678ON7063793531e-33
Ecym_44073.479ON7113553512e-33
SAKL0G05016g5.531ON5041753434e-33
SAKL0G18920g2.633ON6493583466e-33
KLTH0G03850g5.531ON4731753381e-32
TDEL0F036403.479ON7044273461e-32
Smik_6.3528.678ON7153843451e-32
CAGL0I07029g3.528ON7053593442e-32
NDAI0I029603.528ON8683633425e-32
CAGL0D04994g3.479ON6923743389e-32
TDEL0D059603.528ON7333543381e-31
KLLA0B00759g5.531ON4561753211e-30
Kwal_47.186085.531ON4791753193e-30
Ecym_40665.531ON4781743167e-30
Suva_16.1558.678ON7043783237e-30
KAFR0F042103.528ON6721793093e-28
Skud_16.4353.479ON7294093051e-27
Kwal_47.190933.528ON8191802998e-27
NCAS0E005503.528ON7841822981e-26
TBLA0C018808.678ON4683362882e-26
KLTH0G01606g3.528ON8191802943e-26
ZYRO0D12650g5.531ON4781792864e-26
Skud_7.533.528ON8051802925e-26
TBLA0C049603.528ON8013472909e-26
TPHA0D041903.479ON6724092889e-26
Suva_7.443.528ON8051802891e-25
KNAG0B005203.528ON7231802872e-25
KLLA0A01606g3.528ON7691742872e-25
YGL216W (KIP3)3.528ON8051802872e-25
AER441C3.528ON8181802811e-24
Ecym_12003.528ON8331792792e-24
KNAG0A078803.479ON7641532721e-23
Kpol_505.393.479ON6921492702e-23
AGR253W3.479ON7091822675e-23
KLTH0F14498g3.479ON7021672665e-23
Kpol_1050.1033.479ON6971582657e-23
KAFR0B065903.479ON7061512657e-23
KLLA0B10956g3.479ON6901472577e-22
NDAI0B057703.479ON7631542577e-22
TPHA0D032003.479ON7241502569e-22
Kpol_1019.112.633ON6474422541e-21
YPR141C (KAR3)3.479ON7291442443e-20
Suva_16.4693.479ON7311462434e-20
ZYRO0B04290g3.479ON7311492424e-20
Smik_16.3883.479ON7291482425e-20
NDAI0E02090singletonON6851952372e-19
TDEL0B072702.633ON6442592317e-19
KNAG0J017208.678ON6251842291e-18
Kwal_55.21164singletonOFF5881671871e-13
Kwal_YGOB_55.211643.479ON6571671862e-13
YKL079W (SMY1)2.633ON6561291683e-11
TPHA0N016502.633ON6822711683e-11
Suva_11.1452.633ON6571241648e-11
Smik_11.1602.633ON6561301622e-10
Skud_11.1482.633ON6561091576e-10
KNAG0M025402.633ON5221411478e-09
NCAS0H031802.633ON6602851461e-08
CAGL0L05104g2.633ON6753791414e-08
TBLA0A008202.633ON8031761353e-07
NDAI0C004802.633ON5981131308e-07
TBLA0C008002.633ON6931331237e-06
ZYRO0E01078g2.633ON6681591201e-05
KAFR0C040202.633ON6672291147e-05
NCAS0C052002.633ON57268900.053
KNAG0H003602.633ON681134900.057
NCAS0C028308.401ON87472791.1
KAFR0C036508.8ON21241761.5
YDL058W (USO1)4.238ON1790116772.0
Kpol_1002.476.221ON57991743.5
KLLA0F01100g8.618ON218172724.5
TDEL0C054603.409ON20198715.2
Suva_6.48na 1ON148104696.8
TPHA0F003604.39ON1151104726.9
ZYRO0F06424g8.636ON452174719.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G04530
         (958 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {O...  1952   0.0  
ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {...  1094   0.0  
SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar ...   993   0.0  
YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}  C...   965   0.0  
Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON} ...   959   0.0  
Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON} Y...   952   0.0  
Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YE...   947   0.0  
NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {...   931   0.0  
Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061...   915   0.0  
KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {...   900   0.0  
TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16...   889   0.0  
NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {...   891   0.0  
KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16...   886   0.0  
Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to ...   884   0.0  
CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} simila...   860   0.0  
ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON} S...   855   0.0  
KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6....   756   0.0  
Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..1...   687   0.0  
Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] ...   621   0.0  
KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar ...   589   0.0  
TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_...   559   0.0  
TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16...   472   e-150
ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON} ...   379   e-114
SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa] ...   369   e-110
Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} simila...   367   e-110
TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7....   363   e-108
Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W (...   361   e-108
ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa] ...   360   e-107
Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W (R...   358   e-106
NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7....   352   e-104
KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa] ...   353   e-104
NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {...   353   e-104
YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}  KIP1Kines...   349   e-103
Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W (R...   347   e-103
TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7....   338   9e-99
TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7....   285   2e-80
ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON} S...   191   2e-50
Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar t...   191   2e-50
KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} simila...   168   1e-42
KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {O...   157   2e-39
Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON} (54983....   154   5e-39
Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C...   156   1e-38
ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {...   155   2e-38
Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON} (11880.....   153   4e-38
Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)   154   6e-38
KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} simila...   151   3e-37
SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} simila...   152   3e-37
TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.6...   149   2e-36
NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {O...   149   2e-36
TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {O...   149   3e-36
CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa] ...   148   3e-36
Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON} (11134..13...   149   3e-36
SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {...   146   9e-36
ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} simila...   144   5e-35
TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON} Anc_8...   143   7e-35
Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {...   144   1e-34
NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {O...   142   3e-34
SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} simila...   142   3e-34
TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {O...   142   3e-34
Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}...   142   4e-34
TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON} Anc_3...   141   5e-34
ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic ho...   140   8e-34
YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON} ...   140   1e-33
Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar t...   139   2e-33
SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly...   136   4e-33
SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]...   137   6e-33
KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some s...   134   1e-32
TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {O...   137   1e-32
Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C ...   137   1e-32
CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} simila...   137   2e-32
NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {O...   136   5e-32
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...   134   9e-32
TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa] ...   134   1e-31
KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some sim...   128   1e-30
Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {...   127   3e-30
Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar t...   126   7e-30
Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {...   129   7e-30
KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {O...   123   3e-28
Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {...   122   1e-27
Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]...   119   8e-27
NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}...   119   1e-26
TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.6...   115   2e-26
KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} simila...   117   3e-26
ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some...   114   4e-26
Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)   117   5e-26
TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa] ...   116   9e-26
TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {O...   115   9e-26
Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)   115   1e-25
KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528...   115   2e-25
KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} simila...   115   2e-25
YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}  KIP3Kinesin-...   115   2e-25
AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}...   112   1e-24
Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar t...   112   2e-24
KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] ...   109   1e-23
Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}...   108   2e-23
AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic ...   107   5e-23
KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]...   107   5e-23
Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]...   106   7e-23
KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa] ...   106   7e-23
KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} simila...   103   7e-22
NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] ...   103   7e-22
TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {O...   103   9e-22
Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {O...   102   1e-21
YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON} ...    99   3e-20
Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {...    98   4e-20
ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} simila...    98   4e-20
Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {...    98   5e-20
NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {O...    96   2e-19
TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa] ...    94   7e-19
KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8....    93   1e-18
Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa] {...    77   1e-13
Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)...    76   2e-13
YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Prote...    69   3e-11
TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {...    69   3e-11
Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079...    68   8e-11
Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079...    67   2e-10
Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079...    65   6e-10
KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2....    61   8e-09
NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633     61   1e-08
CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa] ...    59   4e-08
TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.6...    57   3e-07
NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}...    55   8e-07
TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {O...    52   7e-06
ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar ...    51   1e-05
KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.6...    49   7e-05
NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON} Anc_2...    39   0.053
KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633...    39   0.057
NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401     35   1.1  
KAFR0C03650 Chr3 complement(744293..744931) [639 bp, 212 aa] {ON...    34   1.5  
YDL058W Chr4 (345665..351037) [5373 bp, 1790 aa] {ON}  USO1Essen...    34   2.0  
Kpol_1002.47 s1002 (137553..139292) [1740 bp, 579 aa] {ON} (1375...    33   3.5  
KLLA0F01100g Chr6 complement(101843..102499) [657 bp, 218 aa] {O...    32   4.5  
TDEL0C05460 Chr3 complement(981269..981874) [606 bp, 201 aa] {ON...    32   5.2  
Suva_6.48 Chr6 (83671..84114) [444 bp, 148 aa] {ON} YFL012W (REAL)     31   6.8  
TPHA0F00360 Chr6 (80013..83468) [3456 bp, 1151 aa] {ON} Anc_4.39...    32   6.9  
ZYRO0F06424g Chr6 complement(532056..533414) [1359 bp, 452 aa] {...    32   9.3  

>TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {ON}
           Anc_6.16 YEL061C
          Length = 958

 Score = 1952 bits (5057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 943/958 (98%), Positives = 943/958 (98%)

Query: 1   MVAMPQASGEDVEELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGI 60
           MVAMPQASGEDVEELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGI
Sbjct: 1   MVAMPQASGEDVEELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGI 60

Query: 61  TAQINSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTG 120
           TAQINSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTG
Sbjct: 61  TAQINSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTG 120

Query: 121 DEKLYDGELSESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIAS 180
           DEKLYDGELSESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIAS
Sbjct: 121 DEKLYDGELSESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIAS 180

Query: 181 SRKLRIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQ 240
           SRKLRIFDSNTMSAATNSMSTG               ELPTATFLRKRWKTAPSVTQSHQ
Sbjct: 181 SRKLRIFDSNTMSAATNSMSTGNSTKNSRNNSPRSSSELPTATFLRKRWKTAPSVTQSHQ 240

Query: 241 NSQDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYK 300
           NSQDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYK
Sbjct: 241 NSQDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYK 300

Query: 301 EYNGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHV 360
           EYNGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHV
Sbjct: 301 EYNGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHV 360

Query: 361 PFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVI 420
           PFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVI
Sbjct: 361 PFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVI 420

Query: 421 MKDILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEVKECKRAIETL 480
           MKDILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEVKECKRAIETL
Sbjct: 421 MKDILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEVKECKRAIETL 480

Query: 481 TSQNTLLLKDKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTV 540
           TSQNTLLLKDKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTV
Sbjct: 481 TSQNTLLLKDKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTV 540

Query: 541 GTMQSIIKEHERRERDIESKMGDLFNNEFARVKQTILSNIRDIEQQIDWENIGVQGNIDS 600
           GTMQSIIKEHERRERDIESKMGDLFNNEFARVKQTILSNIRDIEQQIDWENIGVQGNIDS
Sbjct: 541 GTMQSIIKEHERRERDIESKMGDLFNNEFARVKQTILSNIRDIEQQIDWENIGVQGNIDS 600

Query: 601 IRGEISKLLERAQQQTDDMYKDCVEKILDETPGHFQLAAEKVSEVEKLIATCHRDLTENL 660
           IRGEISKLLERAQQQTDDMYKDCVEKILDETPGHFQLAAEKVSEVEKLIATCHRDLTENL
Sbjct: 601 IRGEISKLLERAQQQTDDMYKDCVEKILDETPGHFQLAAEKVSEVEKLIATCHRDLTENL 660

Query: 661 SDVSEEFNNLRQYLNDHFFKNNHEEILVSHIDRTYHHIQTSADDLFQQFKEMMDNHLEKN 720
           SDVSEEFNNLRQYLNDHFFKNNHEEILVSHIDRTYHHIQTSADDLFQQFKEMMDNHLEKN
Sbjct: 661 SDVSEEFNNLRQYLNDHFFKNNHEEILVSHIDRTYHHIQTSADDLFQQFKEMMDNHLEKN 720

Query: 721 KDLMLESLKTATYDVIRKEMQLFEPQKKKWEDSFKYINKCDSINFAFQNGVKSPLLGIKS 780
           KDLMLESLKTATYDVIRKEMQLFEPQKKKWEDSFKYINKCDSINFAFQNGVKSPLLGIKS
Sbjct: 721 KDLMLESLKTATYDVIRKEMQLFEPQKKKWEDSFKYINKCDSINFAFQNGVKSPLLGIKS 780

Query: 781 TLGSSQEAINKTITKVKEQMDEHESPASMLSNSRVFSEQFSGILNKQSLLHESLKKSVII 840
           TLGSSQEAINKTITKVKEQMDEHESPASMLSNSRVFSEQFSGILNKQSLLHESLKKSVII
Sbjct: 781 TLGSSQEAINKTITKVKEQMDEHESPASMLSNSRVFSEQFSGILNKQSLLHESLKKSVII 840

Query: 841 TSDHADAVDKLKEAIDHVVSERGSSMEGERVEHVDGILRRMDEQNLLYLDRSPLRPANFK 900
           TSDHADAVDKLKEAIDHVVSERGSSMEGERVEHVDGILRRMDEQNLLYLDRSPLRPANFK
Sbjct: 841 TSDHADAVDKLKEAIDHVVSERGSSMEGERVEHVDGILRRMDEQNLLYLDRSPLRPANFK 900

Query: 901 MNKSERNSPNRSSPCKSVSHSPCKQPVCHPRINYKRSLTDLNDGQEEGLNKLSRHRCG 958
           MNKSERNSPNRSSPCKSVSHSPCKQPVCHPRINYKRSLTDLNDGQEEGLNKLSRHRCG
Sbjct: 901 MNKSERNSPNRSSPCKSVSHSPCKQPVCHPRINYKRSLTDLNDGQEEGLNKLSRHRCG 958

>ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {ON}
           some similarities with uniprot|P27895 Saccharomyces
           cerevisiae YEL061C CIN8 Kinesin motor protein involved
           in mitotic spindle assembly and chromosome segregation
          Length = 974

 Score = 1094 bits (2830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/998 (58%), Positives = 720/998 (72%), Gaps = 70/998 (7%)

Query: 1   MVAMPQASGEDVEELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGI 60
           M + P   GED EELNITVAVR RGRNEREI+AKSSVVVSVPDV GS+EV+INTT DVGI
Sbjct: 1   MGSSPAGGGEDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGI 60

Query: 61  TAQINSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTG 120
           TAQ+NSKTY VD+VFGPSANQ L+F++IAEPLF DF+KGYNCTVLVYGMTSTGKTYTMTG
Sbjct: 61  TAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTG 120

Query: 121 DEKLYDGELSESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIAS 180
           DEKLY+ ELS+SAGIIPRILFKLFETL+L+ EDYVVKCSFVELYNEELKDLL DS E +S
Sbjct: 121 DEKLYNDELSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSS 180

Query: 181 SRKLRIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFL-RKRWKTAPSVT--- 236
            RKLRI+DS + S + +                    +L T   + R+R +T P  +   
Sbjct: 181 MRKLRIYDSGSGSNSNSGSRKN---------SRNNSPKLVTDPMINRRRMRTVPLSSSLA 231

Query: 237 -QSHQNSQ--------------------------------DQNAGIYIQNLQDFHITNAK 263
            Q HQ  Q                                D  +G+YIQNLQDFHIT+A+
Sbjct: 232 KQQHQWQQRREQQHQLREQQQREQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHITSAR 291

Query: 264 EGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEIFRVSKMNLVDLAGSENI 323
           +G++LLQKGL++RQVATTKMNDFSSRSHTIFTITLY+E+ GE+F+VSKMNLVDLAGSENI
Sbjct: 292 DGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSENI 351

Query: 324 SRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFRESKLTRLLQDSLGGNTKTAL 383
           SRSGAQHQRAKEAGSINQSLLTLGRVINSL DKS HVPFRESKLTRLLQDSLGGNTKTAL
Sbjct: 352 SRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTAL 411

Query: 384 IATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKDILVKNITGELAKIKADLLST 443
           IATISPAKINSEETCSTLQYA+KAKNIKN+PQL S IMKDILVKNIT ELAK+K+DLLST
Sbjct: 412 IATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLST 471

Query: 444 KSKEGIYMSQDNYKELTNDLESYKTEVKECKRAIETLTSQNTLLLKDKKASNEVNDLQRI 503
           K +EG+YMSQDNYKE+TNDLESYKTE++E KR IE L+SQN+LLLKDKKASNEVN+LQRI
Sbjct: 472 KLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRI 531

Query: 504 KLQNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGTMQSIIKEHERRERDIESKMGD 563
           KLQNM+D MS L  K E Q+K+EQ LV     LK+T+   QS+IKE+ +RE+ I  +M  
Sbjct: 532 KLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQM 591

Query: 564 LFNNEFARVKQTILSNIRDIEQQIDWENI-------GVQGNIDSIRGEISKLLERAQQQT 616
           +   EF + +Q +++NI DI       +I       G+Q N++ +R E+ +LL  AQ++ 
Sbjct: 592 ILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKRA 651

Query: 617 DDMYKDCVEKILDETPGHFQLAAEKVSEVEKLIATCHRDLTENLSDVSEEFNNLRQYLND 676
           + MYKD +EKIL+E P  FQ  + KV +VE  + T H+ LTENLSD+SE +NNL+QY ND
Sbjct: 652 EKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYFND 711

Query: 677 HFFKNNHEEILVSHIDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDLMLESLKTATYDVI 736
           HFFKNNHEE+L SHID+TY  +Q SAD L Q+FK+MMD+HL+ NK LM++SL++AT + I
Sbjct: 712 HFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAI 771

Query: 737 RKEMQLFEPQKKKWEDSFKYINKCDSINFAFQNGVKSPLLGIKSTLGSSQEAINKTITKV 796
            KEMQLFEPQ+KKWE+SF  IN CDSI+  F   ++S L  IKST GSS + I+++++KV
Sbjct: 772 DKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVSKV 831

Query: 797 KEQMDEHESPASMLSNSRVFSEQFSGILNKQSLLHESLKKSVIITSDHADAVDKLKEAID 856
           K+++  +E  +++L  + V   Q + I+NK S L   L KS+  +  H  A D+LKE I 
Sbjct: 832 KDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYKSIKSSQGHISAFDELKERIR 891

Query: 857 HVVSERGSSMEGERVEHVDGILRRMDEQNLLYLDRSPLRPANFKMNKSERNSPNRSSPCK 916
           + ++   S++   ++     +      QN    +RSPL+P   + N+   N        +
Sbjct: 892 NTIASENSTLHQNKIATTPPL-----GQN---SERSPLKPTVLQPNQLPEN-------WR 936

Query: 917 SVSHSPCKQPVCHPRINYKRSLTDLNDGQEEGLNKLSR 954
               SP K  +       KR     N+  EE +NK+SR
Sbjct: 937 YGLRSPPKDQLSKSNGELKRHQD--NETLEENVNKISR 972

>SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar to
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 948

 Score =  993 bits (2568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/942 (55%), Positives = 690/942 (73%), Gaps = 35/942 (3%)

Query: 6   QASGEDVEELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQIN 65
           + S E+ +ELNITV+VRCRGRNEREIKAKSSVVV+VPDVTGSNEVSINTT ++GITAQ+N
Sbjct: 8   ELSEENGQELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMN 67

Query: 66  SKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 125
           SKTYTVD+VFGPSA+QSL+F++IAEPLF DFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY
Sbjct: 68  SKTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLY 127

Query: 126 DGELSESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASSRKLR 185
           DGELS++AGIIPRILFKLF+TLE Q EDY+VKCSF+ELYNEELKDLL + QE    +KLR
Sbjct: 128 DGELSDAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQESGVIKKLR 187

Query: 186 IFDSNTMSAAT---------NSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVT 236
           IFDSNT S+ +         N + T                +      L+++ +  P + 
Sbjct: 188 IFDSNTTSSNSRNNSRNNSPNLVGTSGTFKRIFKTPVPYKQQQQHQQHLQQQQQQQPRLI 247

Query: 237 QSHQNS-QDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFT 295
            + Q S  +Q++ IYIQNLQ+FHITNAK+GI LLQ+GLKHRQVA+TKMNDFSSRSHTIFT
Sbjct: 248 NNKQQSLSEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFT 307

Query: 296 ITLYKEYNGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTD 355
           I LYK +NGE+FRVSKMNLVDLAGSENISRSGAQ+QRAKEAGSINQSLLTLGRVINSL D
Sbjct: 308 IMLYKNHNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD 367

Query: 356 KSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQ 415
           K+ H+PFRESKLTRLLQDSLGGNTKTALIATISPAKIN+EET STL+YA KAKNIKNKPQ
Sbjct: 368 KNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQ 427

Query: 416 LGSVIMKDILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEVKECKR 475
           LG+++MKDILVKNIT ELAKIK+D LSTKSK+GIYM+QD+YKELT+DLE+YKTEV+ECKR
Sbjct: 428 LGTLVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECKR 487

Query: 476 AIETLTSQNTLLLKDKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLVATAST 535
            IE + SQN LLLKDK+AS+EV++LQRIK++++ D ++ LY K +KQ+K EQ+LV T  T
Sbjct: 488 EIEKMNSQNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHT 547

Query: 536 LKTTVGTMQSIIKEHERRERDIESKMGDLFNNEFARVKQTILSNIRDIEQQIDWENIGVQ 595
           LK  + T+Q+ +K  E  +   +S+M D+  +     KQ+I   +  ++      ++G+ 
Sbjct: 548 LKDAIYTVQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLGID 607

Query: 596 GNIDSIRGEISKLLERAQQQTDDMYKDCVEKILDETPGHFQLAAEKVSEVEKLIATCHRD 655
           GNID I+ E+S++LE     + D+ + CVEKIL+  P HF+     + ++  ++ +   +
Sbjct: 608 GNIDIIQEELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSYSNE 667

Query: 656 LTENLSDVSEEFNNLRQYLNDHFFKNNHEEILVSHIDRTYHHIQTSADDLFQQFKEMMDN 715
           L +NL D+SEE+NN R+YLN+H FKNNHEE L  H+D+TYH ++ SA +LF +FKEMMD+
Sbjct: 668 LVKNLGDISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMDS 727

Query: 716 HLEKNKDLMLESLKTATYDVIRKEMQLFEPQKKKWEDSFKYINKCDSINFAFQNGVKSPL 775
           HLE+NK LM++SLKTA+ +V+ KE++LF P K+KWE S + INKCDS+N  F + VK  L
Sbjct: 728 HLEENKSLMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDAL 787

Query: 776 LGIKSTLGSSQEAINKTITKVKEQMDEHESPASMLSNSRVFSEQFSGILNKQSLLHESLK 835
             ++  +  S E    T   VK+ + + +  + +L N+       + +  K + L + ++
Sbjct: 788 RRLEGNIEGSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHTFLRDQVE 847

Query: 836 KSVIITSDHADAVDKLKEAIDHVVSERGSSMEGERVEHVDG---ILRRMDEQNLLYLDRS 892
           +    TS + +A ++  E ID  + +    ++ +   H+ G   ++  M EQ    L ++
Sbjct: 848 R----TSSYIEAANEKFEGIDQFIRQ---IIDKKLPTHLVGNGELVNVMLEQ----LGKT 896

Query: 893 PLRPANFKMNKSERNSPNRS-SPCKSVSH------SPCKQPV 927
            L+P    +  + R   +RS SP K++ +      SP K+ V
Sbjct: 897 HLKP----IGSASRTPSSRSVSPMKTLDNNIFNGISPSKRKV 934

>YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}
           CIN8Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 1000

 Score =  965 bits (2494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/938 (53%), Positives = 660/938 (70%), Gaps = 53/938 (5%)

Query: 13  EELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVD 72
           EELNITVAVRCRGRNEREI  KSSVVV+VPD+TGS E+SINTTGD GITAQ+N+K YTVD
Sbjct: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92

Query: 73  EVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSES 132
           +VFGP A+Q L+F ++A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY+GELS++
Sbjct: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152

Query: 133 AGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASS---------RK 183
           AGIIPR+L KLF+TLELQ+ DYVVKCSF+ELYNEELKDLL DS    SS         +K
Sbjct: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL-DSNSNGSSNTGFDGQFMKK 211

Query: 184 LRIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTA--PSVTQ---- 237
           LRIFDS+T +  T++ ++                  P A  LRKR +T   P+  +    
Sbjct: 212 LRIFDSSTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAALLRKRLRTKSLPNTIKQQYQ 271

Query: 238 ---------------------------------SHQNSQDQNAGIYIQNLQDFHITNAKE 264
                                            S     DQ  GIYIQNLQ+FHITNA E
Sbjct: 272 QQQAVNSRNNSSSNSGSTTNNASSNTNTNNGQRSSMAPNDQTNGIYIQNLQEFHITNAME 331

Query: 265 GIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEIFRVSKMNLVDLAGSENIS 324
           G+ LLQKGLKHRQVA+TKMNDFSSRSHTIFTITLYK++  E+FR+SKMNLVDLAGSENI+
Sbjct: 332 GLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENIN 391

Query: 325 RSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFRESKLTRLLQDSLGGNTKTALI 384
           RSGA +QRAKEAGSINQSLLTLGRVIN+L DKS H+PFRESKLTRLLQDSLGGNTKTALI
Sbjct: 392 RSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFRESKLTRLLQDSLGGNTKTALI 451

Query: 385 ATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKDILVKNITGELAKIKADLLSTK 444
           ATISPAK+ SEETCSTL+YA+KAKNIKNKPQLGS IMKDILVKNIT ELAKIK+DLLSTK
Sbjct: 452 ATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMKDILVKNITMELAKIKSDLLSTK 511

Query: 445 SKEGIYMSQDNYKELTNDLESYKTEVKECKRAIETLTSQNTLLLKDKKASNEVNDLQRIK 504
           SKEGIYMSQD+YK L +DLESYK EV+ECKR IE+LTS+N LL+KDK  S E    Q  +
Sbjct: 512 SKEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLTSKNALLVKDKLKSKETIQSQNCQ 571

Query: 505 LQNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGTMQSIIKEHERRERDIESKMGDL 564
           +++++  +  L ++ +KQ+K E  +    + L+     MQ  + ++++RE D+  K    
Sbjct: 572 IESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTEVMQMALHDYKKRELDLNQKFEMH 631

Query: 565 FNNEFARVKQTILSNIRDIEQQIDWENIGVQGNIDSIRGEISKLLERAQQQTDDMYKDCV 624
              E  ++K T+   +  ++Q+   +   +Q N+D I+ E+  L+   Q++ + MYKDCV
Sbjct: 632 ITKEIKKLKSTLFLQLNTMQQESILQETNIQPNLDMIKNEVLTLMRTMQEKAELMYKDCV 691

Query: 625 EKILDETPGHFQLAAEKVSEVEKLIATCHRDLTENLSDVSEEFNNLRQYLNDHFFKNNHE 684
           +KIL+E+P  F +  EK+  +       ++++ ENLSD+SEE NN++QYL +HFFKNNH+
Sbjct: 692 KKILNESPKFFNVVIEKIDIIRVDFQKFYKNIAENLSDISEENNNMKQYLKNHFFKNNHQ 751

Query: 685 EILVSHIDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDLMLESLKTATYDVIRKEMQLFE 744
           E+L  H+D TY +I+   ++  + FK+++++HL++NK L++++L TAT  VI +EM LFE
Sbjct: 752 ELLNRHVDSTYENIEKRTNEFVENFKKVLNDHLDENKKLIMQNLTTATSAVIDQEMDLFE 811

Query: 745 PQKKKWEDSFKYINKCDSINFAFQNGVKSPLLGIKSTLGSSQEAINKTITKVKEQMDEHE 804
           P++ KWE+SF  IN CDS+N  F N + + L  IKST+ +S  ++N++I+ +K Q++E E
Sbjct: 812 PKRVKWENSFDLINDCDSMNNEFYNSMAATLSQIKSTVDTSSNSMNESISVMKGQVEESE 871

Query: 805 SPASMLSNSRVFSEQFSGILNKQSLLHESLKKSVIITSDHADAVDKLKEAIDHVVSERGS 864
           +  S+L N+  F++QF  ++NK ++L +++K S+  T  H   VD +   I++++   G+
Sbjct: 872 NAISLLKNNTKFNDQFEQLINKHNMLKDNIKNSITSTHSHITNVDDIYNTIENIMKNYGN 931

Query: 865 SMEGERVEHVDGILRRMDEQNLLYLDRSPLRPANFKMN 902
                + E ++ IL+ +   +     + PLR +N   N
Sbjct: 932 KENATKDEMIENILKEIPNLS----KKMPLRLSNINSN 965

>Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON}
           YEL061C (REAL)
          Length = 1002

 Score =  959 bits (2480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/935 (53%), Positives = 660/935 (70%), Gaps = 53/935 (5%)

Query: 13  EELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVD 72
           EELNITVAVRCRGRNEREI  KSSVVV+VPD+TGS E+SINTTGD GITAQ+N+K YTVD
Sbjct: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92

Query: 73  EVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSES 132
           +VFGP A+Q L+F ++A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY+GELS+S
Sbjct: 93  KVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDS 152

Query: 133 AGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASS--------RKL 184
           AGIIPR+L KLF+TLELQ+ DYVVKCSF+ELYNEELKDLL ++   +S+        +KL
Sbjct: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNSSSNNGFDGQFMKKL 212

Query: 185 RIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAP----------- 233
           RIFDS+T +  T++ ++                  P A  LR+R +T             
Sbjct: 213 RIFDSSTANNTTSNSASSSRSSSRNSSPRSLNDLTPKAALLRRRLRTKSLPNTIKQQQQH 272

Query: 234 -----------------------SVTQSHQNSQ-------DQNAGIYIQNLQDFHITNAK 263
                                  S   ++ N Q       DQ+ GIYIQNLQ+FHITNA 
Sbjct: 273 QQQQTMNSRNNSSSNSGSATNNISSDTNNNNGQRNSLAPNDQSNGIYIQNLQEFHITNAM 332

Query: 264 EGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEIFRVSKMNLVDLAGSENI 323
           EG+KLLQKGLKHRQVA+TKMNDFSSRSHTIFTITLYK++  E+FR+SKMNLVDLAGSENI
Sbjct: 333 EGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENI 392

Query: 324 SRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFRESKLTRLLQDSLGGNTKTAL 383
           +RSGA +QRAKEAGSINQSLLTLGRVIN+L DKS H+PFRESKLTRLLQDSLGGNTKTAL
Sbjct: 393 NRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFRESKLTRLLQDSLGGNTKTAL 452

Query: 384 IATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKDILVKNITGELAKIKADLLST 443
           IATISPAK+ SEETCSTL+YA+KAKNIKNKPQLG+ IMKDILVKNIT ELAKIK+DLLST
Sbjct: 453 IATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLST 512

Query: 444 KSKEGIYMSQDNYKELTNDLESYKTEVKECKRAIETLTSQNTLLLKDKKASNEVNDLQRI 503
           KSKEGIYM+QD+YK L +DLESYK EV+ECKR IE+LTS+N+LL+K+K  S E    Q  
Sbjct: 513 KSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESLTSKNSLLVKEKLKSKETIQSQNS 572

Query: 504 KLQNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGTMQSIIKEHERRERDIESKMGD 563
           ++++++  +  L ++ +KQ+K E  +    S L+     MQ  +++++RRE D+  K   
Sbjct: 573 QIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLTEVMQMALQDYKRRELDLNKKFET 632

Query: 564 LFNNEFARVKQTILSNIRDIEQQIDWENIGVQGNIDSIRGEISKLLERAQQQTDDMYKDC 623
               E   +K T+ S +  ++Q+   +   +Q N+D I+ E+  L+E  Q++ + MYKDC
Sbjct: 633 HITTEIKNMKTTLFSQLSTLQQRNILQETDIQPNLDIIKNEVLTLMETMQEKAELMYKDC 692

Query: 624 VEKILDETPGHFQLAAEKVSEVEKLIATCHRDLTENLSDVSEEFNNLRQYLNDHFFKNNH 683
           V+KIL+E+P  F    EK+  +       ++++ ENLSD+SEE NNL+QY  +HFF+NNH
Sbjct: 693 VKKILNESPKFFNAIVEKIDIIGVDFERFYKNIAENLSDISEENNNLKQYFTNHFFRNNH 752

Query: 684 EEILVSHIDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDLMLESLKTATYDVIRKEMQLF 743
           +E+L  H+D TY  I+   +   + FK+ +++HLE+NK L++++L T T  VI +EM LF
Sbjct: 753 QELLSHHVDSTYEKIEKKTNQFVENFKKALNDHLEENKKLIMKNLTTTTSAVIDQEMSLF 812

Query: 744 EPQKKKWEDSFKYINKCDSINFAFQNGVKSPLLGIKSTLGSSQEAINKTITKVKEQMDEH 803
           EP++ KWE SF  IN+CDS+N  F N + + L  IKST+ +S  ++NK+I+ +K Q++E 
Sbjct: 813 EPKRVKWEHSFDLINECDSMNNEFYNSMATTLSQIKSTVDTSSNSMNKSISVMKGQVEES 872

Query: 804 ESPASMLSNSRVFSEQFSGILNKQSLLHESLKKSVIITSDHADAVDKLKEAIDHVVSERG 863
           E+  S+L N+  F++QF  ++NK ++L ++++ S+  T+ H   +D +   I+ +++  G
Sbjct: 873 ENAISLLKNNIKFNDQFKQLINKHTILKDNIESSITSTNSHITNIDDIYNTIEKIMNNYG 932

Query: 864 SSMEGERVEHVDGILRRMDEQNLLYLDRSPLRPAN 898
           +     + E ++ +L  +   +     R PLR +N
Sbjct: 933 NKENATKDEMIENLLNEIPNLS----KRMPLRISN 963

>Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON}
           YEL061C (REAL)
          Length = 998

 Score =  952 bits (2460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/930 (52%), Positives = 661/930 (71%), Gaps = 47/930 (5%)

Query: 13  EELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVD 72
           EELNITVAVRCRGRNEREI  KSSVVV+VPD+TGS EVSINTTGD GITAQ+N+K YTVD
Sbjct: 35  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVD 94

Query: 73  EVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSES 132
           +VFGP A+Q L+F+++A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY+GEL+++
Sbjct: 95  KVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA 154

Query: 133 AGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASS--------RKL 184
           AGIIPR+L KLF+TLELQ+ DYVVKCSF+ELYNEELKDLL ++   +S+        +KL
Sbjct: 155 AGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEELKDLLDNNSNGSSNNGFDGQFMKKL 214

Query: 185 RIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTA--PSVTQ----- 237
           RIFDS+T +  T++ ++                  P A  LRKR +T   P+  +     
Sbjct: 215 RIFDSSTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAALLRKRLRTKSLPNTIKQQQQQ 274

Query: 238 ----------------------------SHQNSQDQNAGIYIQNLQDFHITNAKEGIKLL 269
                                       S     DQ+ GIYIQNLQ+FHITNA EG+ LL
Sbjct: 275 QAMNSRNNSSSNSGSAANNSSSNTNGQRSPMTQNDQSNGIYIQNLQEFHITNALEGLNLL 334

Query: 270 QKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEIFRVSKMNLVDLAGSENISRSGAQ 329
           Q+GLKHRQVA+TKMNDFSSRSHTIFTITLYK++  E+FR+SKMNLVDLAGSENI+RSGA 
Sbjct: 335 QRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGAL 394

Query: 330 HQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFRESKLTRLLQDSLGGNTKTALIATISP 389
           +QRAKEAGSINQSLLTLGRVIN+L D+S H+PFRESKLTRLLQDSLGGNTKTALIATISP
Sbjct: 395 NQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISP 454

Query: 390 AKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKDILVKNITGELAKIKADLLSTKSKEGI 449
           AK+ SEETCSTL+YA+KAKNIKNKPQLG+ +MKDILVKNIT ELAKIK+DLLSTKSKEGI
Sbjct: 455 AKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGI 514

Query: 450 YMSQDNYKELTNDLESYKTEVKECKRAIETLTSQNTLLLKDKKASNEVNDLQRIKLQNMR 509
           YMSQD+YK L +DLES+K EV+ECKR IE+L S+N+LL+KDK  S E    Q  ++++++
Sbjct: 515 YMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLK 574

Query: 510 DAMSDLYSKAEKQNKREQNLVATASTLKTTVGTMQSIIKEHERRERDIESKMGDLFNNEF 569
             ++ L ++ +KQ+K E  +    + L+     MQ  ++++++RE D+  K     + E 
Sbjct: 575 ATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEI 634

Query: 570 ARVKQTILSNIRDIEQQIDWENIGVQGNIDSIRGEISKLLERAQQQTDDMYKDCVEKILD 629
             +K  +   + +++Q+  ++   +Q N+D ++ E+  L+E  Q++ + MYKDCV+KIL+
Sbjct: 635 KSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILN 694

Query: 630 ETPGHFQLAAEKVSEVEKLIATCHRDLTENLSDVSEEFNNLRQYLNDHFFKNNHEEILVS 689
           E+P  F +  EK+  +       ++++ ENLSD+SEE NNL+QYL +HFFKNNH+E+L  
Sbjct: 695 ESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNH 754

Query: 690 HIDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDLMLESLKTATYDVIRKEMQLFEPQKKK 749
           HID TY +I+   +   + FK  +++HLE+NK L+++++  AT  VI +EM LFEP++ K
Sbjct: 755 HIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAK 814

Query: 750 WEDSFKYINKCDSINFAFQNGVKSPLLGIKSTLGSSQEAINKTITKVKEQMDEHESPASM 809
           WE+SF  INKCDS+N  F N + + L  IK T+ +S  ++N++I+ +K Q++E E+  S+
Sbjct: 815 WENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISL 874

Query: 810 LSNSRVFSEQFSGILNKQSLLHESLKKSVIITSDHADAVDKLKEAIDHVVSERGSSMEGE 869
           L N+  F++QF  +++K  +L ++++ S+  T  H   VD +   I+ +++  G+     
Sbjct: 875 LKNNTKFNDQFKQLISKHIILKDNIESSITSTHSHITNVDDIYNTIEDIMTNHGNKENAT 934

Query: 870 RVEHVDGILRRMDEQNLLYLDRSPLRPANF 899
           + E +D IL+ +   +     R PLR +N 
Sbjct: 935 KDEMIDNILKEIPNLS----KRLPLRISNI 960

>Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON}
           YEL061C (REAL)
          Length = 999

 Score =  947 bits (2448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/939 (53%), Positives = 667/939 (71%), Gaps = 50/939 (5%)

Query: 13  EELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVD 72
           EELNITVAVRCRGRNEREI  KSSVVV+VPD+TGS EVSINTTGD GITAQ+N+K YTVD
Sbjct: 33  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 92

Query: 73  EVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSES 132
           +VFGP A+Q L+F ++A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY+GELS++
Sbjct: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152

Query: 133 AGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQ--------EIASSRKL 184
           AGIIPR+L KLF+TLELQ+ DYVVKCSF+ELYNEELKDLL ++         E    +KL
Sbjct: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGPFMKKL 212

Query: 185 RIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAP---SVTQSHQ- 240
           RIFDSNT +  T++ ++                  P A  LRKR +T     ++ Q HQ 
Sbjct: 213 RIFDSNTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAALLRKRLRTKSLPNTIKQQHQQ 272

Query: 241 ---------------------------NSQ-------DQNAGIYIQNLQDFHITNAKEGI 266
                                      NSQ       DQ+ GIYIQNLQ+FHITNA EG+
Sbjct: 273 QTTNSRNNSSSNPGSTNNNIPGNINTNNSQRSSMAPNDQSNGIYIQNLQEFHITNAMEGL 332

Query: 267 KLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEIFRVSKMNLVDLAGSENISRS 326
            LLQ+GLKHRQVA+TKMNDFSSRSHTIFTITLYK++  E+FR+SKMNLVDLAGSENI+RS
Sbjct: 333 NLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRS 392

Query: 327 GAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFRESKLTRLLQDSLGGNTKTALIAT 386
           GA +QRAKEAGSINQSLLTLGRVIN+L DKS H+PFRESKLTRLLQDSLGGNTKTALIAT
Sbjct: 393 GALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLGGNTKTALIAT 452

Query: 387 ISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKDILVKNITGELAKIKADLLSTKSK 446
           ISPAK+ SEETCSTL+YA+KAKNIKNKPQLG+ IMKDILVKNIT ELAKIK+DLLSTKSK
Sbjct: 453 ISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSK 512

Query: 447 EGIYMSQDNYKELTNDLESYKTEVKECKRAIETLTSQNTLLLKDKKASNEVNDLQRIKLQ 506
           EGIYMSQD+YK L +DLESYK EV+ECKR IE+L+S+N+LLLKDK  S +    Q  +++
Sbjct: 513 EGIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSSKNSLLLKDKLKSKDTIQSQNSQME 572

Query: 507 NMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGTMQSIIKEHERRERDIESKMGDLFN 566
           +++  ++ L ++ +KQ+K E  +    + L+     MQ  +++++RRE D+  K     +
Sbjct: 573 SLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHIS 632

Query: 567 NEFARVKQTILSNIRDIEQQIDWENIGVQGNIDSIRGEISKLLERAQQQTDDMYKDCVEK 626
            E   +K T+ S +  +EQ    +   +Q N+D I+ E+  L+E  Q++ + MYKDCV+K
Sbjct: 633 KEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKK 692

Query: 627 ILDETPGHFQLAAEKVSEVEKLIATCHRDLTENLSDVSEEFNNLRQYLNDHFFKNNHEEI 686
           IL+E+P  F +  EK+  +       + ++ ENLSD+SEE NNL+QYL +HFFKNNH+E+
Sbjct: 693 ILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQEL 752

Query: 687 LVSHIDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDLMLESLKTATYDVIRKEMQLFEPQ 746
           L  HID TY  I+    +  + FK  +++HLE+NK L++++L  AT  VI +EM LFEP+
Sbjct: 753 LNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPK 812

Query: 747 KKKWEDSFKYINKCDSINFAFQNGVKSPLLGIKSTLGSSQEAINKTITKVKEQMDEHESP 806
           + KWE+SF  INKCDS+N  F N + + L  IK+T+ +S  ++NK+I+ +K Q++E E+ 
Sbjct: 813 RVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENA 872

Query: 807 ASMLSNSRVFSEQFSGILNKQSLLHESLKKSVIITSDHADAVDKLKEAIDHVVSERGSSM 866
            S+L N++ F++QF  ++NK ++L ++++ S+  T  H   +D + + I++++   G+  
Sbjct: 873 VSLLKNNKKFNDQFKQLVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKE 932

Query: 867 EGERVEHVDGILRRMDEQNLLYLDRSPLRPANFKMNKSE 905
              + E +D IL+ +   +     R PLR +N   N ++
Sbjct: 933 NAVKNEMIDNILKEIPSLS----KRVPLRLSNTNGNSAQ 967

>NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {ON}
           Anc_6.16
          Length = 1004

 Score =  931 bits (2405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/890 (55%), Positives = 648/890 (72%), Gaps = 47/890 (5%)

Query: 10  EDVEELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTY 69
           E+  ELNITVAVRCRGRNEREI +KS VVV+VPD+TG+ E+SINTTG+ GITAQ+NSKTY
Sbjct: 24  EEDTELNITVAVRCRGRNEREINSKSPVVVTVPDITGAQEISINTTGETGITAQMNSKTY 83

Query: 70  TVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE- 128
           TVD+VFGP+A+Q L+FQ++AEPLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLY    
Sbjct: 84  TVDKVFGPAADQDLIFQEVAEPLFRDFVKGYNCTVLVYGMTSTGKTYTMTGDEKLYQNGT 143

Query: 129 -LSESAGIIPRILFKLFETLELQKE--------DYVVKCSFVELYNEELKDLLG-DSQE- 177
            LS++AGIIPRILFKLF+TL+  +         D+VVKCSFVELYNE+LKDLL  DS + 
Sbjct: 144 MLSDAAGIIPRILFKLFDTLDNHRHSDVTGSTTDFVVKCSFVELYNEDLKDLLNYDSNDE 203

Query: 178 -----IASSRKLRIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTA--TFLRKRWK 230
                   SRKLRIFDS T +   NS S                  LP A  T L  R K
Sbjct: 204 QQQQQQLGSRKLRIFDS-TNNNNNNSNSNASSRASSRNNSPRTSSILPNANATNLAMRKK 262

Query: 231 T----------APSVTQSHQNSQDQNA----------GIYIQNLQDFHITNAKEGIKLLQ 270
           +          A S   +  N+ D+ +          GIYIQNLQ+FHITNAKEG+ LLQ
Sbjct: 263 SIRYNYNSNNKAKSSNNTRPNTNDEPSSIAGPDENTNGIYIQNLQEFHITNAKEGLSLLQ 322

Query: 271 KGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEIFRVSKMNLVDLAGSENISRSGAQH 330
           KGLKHRQVA+TKMNDFSSRSHTIFTITLYKE+   +FR+SKMNLVDLAGSENI+RSGA +
Sbjct: 323 KGLKHRQVASTKMNDFSSRSHTIFTITLYKEHKDNLFRLSKMNLVDLAGSENINRSGAMN 382

Query: 331 QRAKEAGSINQSLLTLGRVINSLTDKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPA 390
           QRAKE GSINQSLLTLGRVINSL DKS HVPFRESKLTRLLQDSLGGNTKTALIATISPA
Sbjct: 383 QRAKETGSINQSLLTLGRVINSLADKSPHVPFRESKLTRLLQDSLGGNTKTALIATISPA 442

Query: 391 KINSEETCSTLQYAAKAKNIKNKPQLGSVIMKDILVKNITGELAKIKADLLSTKSKEGIY 450
           K+ SEETCSTL+YA+KAKNIKNKPQLGSVI+KDIL+KNIT ELAK+K+DL+STKSK+GIY
Sbjct: 443 KVTSEETCSTLEYASKAKNIKNKPQLGSVILKDILLKNITSELAKVKSDLMSTKSKDGIY 502

Query: 451 MSQDNYKELTNDLESYKTEVKECKRAIETLTSQNTLLLKDKKASNEVNDLQRIKLQNMRD 510
           MS ++Y+EL  +LES KTEV+E KR IE L+SQN++LLKDK+++NEVN+LQRIKL N++D
Sbjct: 503 MSHEHYQELIMELESSKTEVQESKRMIEKLSSQNSMLLKDKRSANEVNELQRIKLNNLKD 562

Query: 511 AMSDLYSKAEKQNKREQNLVATASTLKTTVGTMQSIIKEHERRERDIESKMGDLFNNEFA 570
           +MS+L  K E QN +E  L+     L+ +   + S++K ++ ++  +++++ ++ N    
Sbjct: 563 SMSNLNEKLEIQNGKETKLMEQIGQLEKSREKLNSLVKNYQTKQSQLKTQISNILNENLF 622

Query: 571 RVKQTILSNIRDIEQQIDWENIGVQGNIDSIRGEISKLLERAQQQTDDMYKDCVEKILDE 630
            +K+ IL++ +D  +Q +  N  V+ N+  I+ EI+ +LE+ Q +T+ MYK+ +E+ L++
Sbjct: 623 ELKK-ILNSHKDAIRQSEG-NFDVEMNLKVIKDEITSMLEKTQHKTEMMYKEFIEEFLEQ 680

Query: 631 TPGHFQLAAEKVSEVEKLIATCHRDLTENLSDVSEEFNNLRQYLNDHFFKNNHEEILVSH 690
           TP + Q   E V++VE ++   + ++TENLSD+SEE+NNL+QYL++ FF+NNHE++L  H
Sbjct: 681 TPINLQKIFEHVTQVEFMVTGYYNEITENLSDISEEYNNLKQYLDNDFFQNNHEDLLNIH 740

Query: 691 IDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDLMLESLKTATYDVIRKEMQLFEPQKKKW 750
           I+ T   +  S+ +LF +FK MMD HL +NK LM+++ +TAT DVI KEM+LF+P++ KW
Sbjct: 741 INATSDILAQSSAELFNKFKIMMDAHLMENKKLMIDNFRTATNDVITKEMELFKPKRNKW 800

Query: 751 EDSFKYINKCDSINFAFQNGVKSPLLGIKSTLGSSQEAINKTITKVKEQMDEHESP---- 806
           E+S + IN+CDSIN  F + +   +  IK+ L SS  +I+  I  +K Q+ E  S     
Sbjct: 801 EESIELINRCDSINNGFHHNMTGQVSKIKTNLASSSSSIHNAIASIKSQVLEQLSNDDSD 860

Query: 807 -ASMLSNSRVFSEQFSGILNKQSLLHESLKKSVIITSDHADAVDKLKEAI 855
             + L N  +F++ F+ I+ K  +L ++ K ++  T      +D+L E +
Sbjct: 861 VKTALENDPMFNKHFNEIIEKNMILQKNRKNAINYTDKSLLNIDELSETV 910

>Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061C
           (CIN8) - 1:1 [contig 185] FULL
          Length = 943

 Score =  915 bits (2366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/928 (50%), Positives = 662/928 (71%), Gaps = 30/928 (3%)

Query: 11  DVEELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYT 70
           D EELNITVAVRCRGRNE+E+KA+SSVVV+VPDVTG+NEVSINTTGD GITAQINSKTYT
Sbjct: 3   DDEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYT 62

Query: 71  VDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELS 130
           VD+VFGPSA+Q L+F+ IAEPLF DFIKGYNCTVLVYGMTSTGKTYTMTGDE+LYDGELS
Sbjct: 63  VDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELS 122

Query: 131 ESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASSRKLRIFDSN 190
           E AGIIPR+LFKLF+ L  Q +DY++KCSF+ELYNEELKDLL ++ + +  +KLRIFDS 
Sbjct: 123 EGAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLRIFDSV 182

Query: 191 TMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQ------- 243
           +  ++ +  S+                    ++F  +R   APS+ +  ++         
Sbjct: 183 SNVSSNSRASSRNNSPKPNEG----------SSFGTRRKTRAPSIHRPTKSPVSKPVSPC 232

Query: 244 DQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYN 303
           + ++ I+IQNLQ+FHI +AKEGI+LLQ+GL+HRQVA+TKMND SSRSHTIFTI LYK+ N
Sbjct: 233 EPSSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCN 292

Query: 304 GEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFR 363
           GE FRVSKMNLVDLAGSENISRSGAQ+QRAKEAGSINQSLLTLGRVINSL DKSLH+PFR
Sbjct: 293 GESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFR 352

Query: 364 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKD 423
           ESKLTRLLQDSLGGNTKTALIATISPAKINSEET STL+YA KAKNIKNKPQ+GS IMKD
Sbjct: 353 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKD 412

Query: 424 ILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEVKECKRAIETLTSQ 483
           +L+K++T EL KIK+DLLSTKSK+GIYMSQ+NYKELTN+LE+YKTEV+ECKRA+E +++Q
Sbjct: 413 VLLKSVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEKVSAQ 472

Query: 484 NTLLLKDKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGTM 543
           N+LL+K+K+ SNEVN+ Q++KL+ + + +  LY K ++Q+K EQ L      L   + TM
Sbjct: 473 NSLLIKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHTM 532

Query: 544 QSIIKEHERRERDIESKMGDLFNNEFARVKQTILSNIRDIEQQIDWENIGVQGNIDSIRG 603
           Q  ++ +E + +   ++M  +  +     K++++  I  ++  +D     V+ N+D++  
Sbjct: 533 QQSLRIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKINVDENGDDVEVNVDAVTT 592

Query: 604 EISKLLERAQQQTDDMYKDCVEKILDETPGHFQLAAEKVSEVEKLIATCHRDLTENLSDV 663
           E++++ +       +++++ ++K+ D+TP +F+    +V  +  ++++   +L  +LS +
Sbjct: 593 ELTRIFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQVESITSVVSSYSSNLMIHLSSI 652

Query: 664 SEEFNNLRQYLNDHFFKNNHEEILVSHIDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDL 723
           SEE+NNL+ YLN+HFFKNN +E L  H+DRTYH ++ SA+ +F + +EM++  L+ NK+ 
Sbjct: 653 SEEYNNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELDTNKEF 712

Query: 724 MLESLKTATYDVIRKEMQLFEPQKKKWEDSFKYINKCDSINFAFQNGVKSPLLGIKSTLG 783
           M++SL+ A  +V+ KEM L +P K+ WE+S + IN+CD +N  F+N +   +  I  T+ 
Sbjct: 713 MMQSLRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEIFKTID 772

Query: 784 SSQEAINKTITKVKEQMDEHESPASMLSNSRVFSEQFSGILNKQSLLHESLKKSVIITSD 843
             Q+    T    K ++    +  S L N+ +  +    I  K +LL   ++ S    ++
Sbjct: 773 QGQKTSQVTTEDAKSELTRVRAAFSSLQNNGIILQNVDSIKKKHNLLKSQVQDS----AN 828

Query: 844 HADAVDKLKEAIDHVVSE--RGSSMEGERVEH-VDGILRRMDEQNLLYL---DRSPLRPA 897
           +  A  +    ID+ + +     ++   + E+ +DG+L ++++++L  L    ++P+R  
Sbjct: 829 YMQAATQKFGEIDNSIQDLLNAQTIPQPQSENPIDGLLEQLNDKSLKPLGPSGKTPMRTV 888

Query: 898 NFKMNKSERNSPNRSSPCKSVSHSPCKQ 925
              +  +++  P + S   S + SP K+
Sbjct: 889 QRSVTNTDQLLPPQKS---SYTISPIKE 913

>KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {ON}
           similar to uniprot|P27895 Saccharomyces cerevisiae
           YEL061C CIN8 Kinesin motor protein involved in mitotic
           spindle assembly and chromosome segregation
          Length = 941

 Score =  900 bits (2325), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/761 (58%), Positives = 576/761 (75%), Gaps = 5/761 (0%)

Query: 13  EELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVD 72
           EELNITVAVRCRGRNE+E+KAKSSVVV+VPDVTG+NEVSINTTGD GITAQINSKTYTVD
Sbjct: 5   EELNITVAVRCRGRNEKEVKAKSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64

Query: 73  EVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSES 132
            VFGPSA+Q L+F+ IAEPLF DFIKGYNCTVLVYGMTSTGKTYTMTGDE+LYDGELSE 
Sbjct: 65  RVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124

Query: 133 AGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASSRKLRIFDSNTM 192
           AGIIPR+LFKLF+ L+   +DY++KCSF+ELYNEELKDLL ++ + +  RKLRIFDS T 
Sbjct: 125 AGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDSSMPRKLRIFDSVTN 184

Query: 193 SAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQDQNAGIYIQ 252
             ++ S S                  +   T     +K + S T     S + N+ I+IQ
Sbjct: 185 PNSSRSSSRNSSPKPPEGSTSGTKRRIRPNTM----YKPSRSPTVKPTLSSELNSAIHIQ 240

Query: 253 NLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEIFRVSKM 312
           NLQ+FHI +AKEGI+LLQ+GL+HRQVA+TKMND SSRSHTIFTI LY++ NGE FRVSKM
Sbjct: 241 NLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESFRVSKM 300

Query: 313 NLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFRESKLTRLLQ 372
           NLVDLAGSENISRSGAQ+QRAKEAGSINQSLLTLGRVINSL DK+ H+PFRESKLTRLLQ
Sbjct: 301 NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQ 360

Query: 373 DSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKDILVKNITGE 432
           DSLGGNTKTALIATISPAKINSEET STL+YA KAKNIKNKPQ+GS IMKD+LVKN+T E
Sbjct: 361 DSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLVKNVTAE 420

Query: 433 LAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEVKECKRAIETLTSQNTLLLKDKK 492
           L KI++DLL+TKSK+GIYMSQ+NYKELTN+LE+YKTEV+ECKRAIE L++QN LL K+K+
Sbjct: 421 LVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLSTQNGLLTKEKR 480

Query: 493 ASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGTMQSIIKEHER 552
            +NEVN+ QR+K++ + + +  LY K ++Q+K EQ L      L   + TMQ+ +K +E 
Sbjct: 481 ITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRTMQNSLKVYED 540

Query: 553 RERDIESKMGDLFNNEFARVKQTILSNIRDIEQQIDWENIGVQGNIDSIRGEISKLLERA 612
           +    +++M  +        K ++L+ I  + +  + +   V  NID++  E++++ +  
Sbjct: 541 QGHRFQTEMERVLYENIGSFKHSLLNEIEKL-KGTEEDGFDVDANIDTLTKELNRIYDFI 599

Query: 613 QQQTDDMYKDCVEKILDETPGHFQLAAEKVSEVEKLIATCHRDLTENLSDVSEEFNNLRQ 672
              T ++ +  + KI ++TP + Q    +V  +  ++ +   DL  +LS +SEE+N+L+ 
Sbjct: 600 NTSTIEICRKFMNKITEQTPTYLQDIRNQVESITHVVGSYSSDLMMHLSSISEEYNHLKD 659

Query: 673 YLNDHFFKNNHEEILVSHIDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDLMLESLKTAT 732
           YLN+HFFKNN ++ L  H+DRTYH ++ SA+ +F + +EMM+  LE NK++M++SLK A 
Sbjct: 660 YLNEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKLREMMNEELETNKEIMMQSLKNAA 719

Query: 733 YDVIRKEMQLFEPQKKKWEDSFKYINKCDSINFAFQNGVKS 773
            +V+ KEM L +P K+ WE S + IN+CD +N  F+  + S
Sbjct: 720 SEVVAKEMGLLDPVKQAWESSLENINECDKLNSGFEKDIGS 760

>TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16
           YEL061C
          Length = 939

 Score =  889 bits (2297), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/857 (52%), Positives = 625/857 (72%), Gaps = 15/857 (1%)

Query: 1   MVAMPQASGEDVEELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDV-- 58
           M A PQ   +D +E+NI VAVRCRGRN+REIK+KSSV+VSVPDV GSNE+SINT+ D+  
Sbjct: 1   MSADPQKIEDDTDEMNIMVAVRCRGRNKREIKSKSSVIVSVPDVMGSNEISINTSDDIVS 60

Query: 59  GITAQINSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTM 118
           G+TAQ+NSKTYTVD+VFGPSANQ L+F++IAEPLF DF++GYNCTVLVYGMTSTGKTYTM
Sbjct: 61  GLTAQLNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTM 120

Query: 119 TGDEKLYDGELSESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEI 178
           TGDEKLY G+LS+SAGIIPR+LFKLFET+E Q ++YV+KCSF+ELYNEELKDLL DS   
Sbjct: 121 TGDEKLYKGDLSDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNN- 179

Query: 179 ASSRKLRIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQS 238
              +KLRIFDSN   ++ N+  +                   +   LRK      + +  
Sbjct: 180 TKLKKLRIFDSNLSKSSNNNNIS------------RQNSHFISGMDLRKNPINPINNSND 227

Query: 239 HQNSQDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITL 298
           +   Q+ NA IYIQNL++FHI NA+EGI+LLQKGLK+RQVA+TKMND SSRSHTIFTI L
Sbjct: 228 NTAIQNGNASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINL 287

Query: 299 YKEYNGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSL 358
           YKE+ GEIF++SKMNLVDLAGSENISRSGAQ+QRAKEAGSINQSLLTLGRVINS+ DK++
Sbjct: 288 YKEHKGEIFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNI 347

Query: 359 HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGS 418
           H+PFRESKLTRLLQDSLGGNTKTALIATISPAK+N+EETCSTL+YA KAK+IKNKPQLGS
Sbjct: 348 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGS 407

Query: 419 VIMKDILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEVKECKRAIE 478
           +IMKD+ +K++  ELAKIK DL STK K+G+YM+Q++YK+LTNDLESYKTE++EC R ++
Sbjct: 408 IIMKDVRLKDLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVK 467

Query: 479 TLTSQNTLLLKDKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLVATASTLKT 538
           +L  QN LLLKDKKASNEVN LQ + L  M + +S++ +  E Q+K+EQ LV   +  + 
Sbjct: 468 SLELQNALLLKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSRE 527

Query: 539 TVGTMQSIIKEHERRERDIESKMGDLFNNEFARVKQTILSNIRDIEQQIDWENIGVQGNI 598
               M+++IKE+  +E  I+S M  +FN+E  ++K+ ++ N+  I ++       V+ NI
Sbjct: 528 KSLKMKTVIKEYSEKEERIQSNMKSIFNDELIKLKELLIENLNGIAKENLIVQTNVKDNI 587

Query: 599 DSIRGEISKLLERAQQQTDDMYKDCVEKILDETPGHFQLAAEKVSEVEKLIATCHRDLTE 658
             I+ ++  ++  +Q+ +  ++ +  ++I+ ETP   ++ +  V + ++L  T   +L E
Sbjct: 588 KLIKDDVISIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFE 647

Query: 659 NLSDVSEEFNNLRQYLNDHFFKNNHEEILVSHIDRTYHHIQTSADDLFQQFKEMMDNHLE 718
           NL  + ++++ L +Y ++ FFK+NH  I+  H++ T   I+ S  D+F+QF++ M+   E
Sbjct: 648 NLESIKQQYSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAE 707

Query: 719 KNKDLMLESLKTATYDVIRKEMQLFEPQKKKWEDSFKYINKCDSINFAFQNGVKSPLLGI 778
           +N+ L+LE+LKT + D+I+ EM  F+  K +W+ SFK IN CD +N ++ + + + L  +
Sbjct: 708 QNEKLILENLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNM 767

Query: 779 KSTLGSSQEAINKTITKVKEQMDEHESPASMLSNSRVFSEQFSGILNKQSLLHESLKKSV 838
           K  L SS E I K + ++K  +D   S   +L+  R   + ++ I++K+  LH+ L+ S+
Sbjct: 768 KGKLQSSDEIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQISL 827

Query: 839 IITSDHADAVDKLKEAI 855
             T +     D++ ++I
Sbjct: 828 NSTQNSLLVFDEICKSI 844

>NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {ON}
           Anc_6.16
          Length = 1069

 Score =  891 bits (2303), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/938 (50%), Positives = 640/938 (68%), Gaps = 76/938 (8%)

Query: 5   PQASGEDVEELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQI 64
           P+   ++ EELNITVAVRCRGRNEREIK KSSV+V+VPD+ GSNEVSINTT DVGITAQ+
Sbjct: 42  PKEGEQEEEELNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQM 101

Query: 65  NSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKL 124
           NSKTYTVD+VFGPSANQ L+F ++AEPLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKL
Sbjct: 102 NSKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKL 161

Query: 125 YDGELSESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGD-----SQEIA 179
           Y+GELSESAGIIPRILFKLF+TLE+ +EDYVVKCSF+ELYNE+LKDLL D     +   +
Sbjct: 162 YNGELSESAGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNEDLKDLLNDNNNSINNSKS 221

Query: 180 SSRKLRIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTAT--------FLRKRWKT 231
           +  KLRIFDS   S A+N    G                 P+ +        +LR++ K+
Sbjct: 222 NINKLRIFDS---STASNVNVPGSNASSRANSRNNSPRLNPSTSNVGTTNNNYLRRKLKS 278

Query: 232 APSVTQSHQNSQDQNAGIYIQNL------------------------------------- 254
           +      + N    NA   ++N+                                     
Sbjct: 279 SRYSNPENSNIFTSNASSSVKNMTKNSFLSNSKNQTSNLNTNSNTRTNPPKLPTSSLETP 338

Query: 255 -QD-----FHITNAKE--------GIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYK 300
            QD      +I N +E        G+ LLQKGLK+RQVA+TKMNDFSSRSHTIFTITLYK
Sbjct: 339 PQDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYK 398

Query: 301 EYNGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHV 360
           E+ G +FR+SKMNLVDLAGSENI+RSGA +QRAKE GSINQSLLTLGRVINSL D++ H+
Sbjct: 399 EHQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHI 458

Query: 361 PFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVI 420
           PFRESKLTRLLQDSLGGNTKTALIATISPAK+ SEETCSTL+YA+KAKNIKNKPQLGS+I
Sbjct: 459 PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSII 518

Query: 421 MKDILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEVKECKRAIETL 480
            KDIL+KNIT EL+++K+DLLSTKSKEGIYMSQ++Y++L N+L+++KTE  E KR IE L
Sbjct: 519 SKDILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERL 578

Query: 481 TSQNTLLLKDKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTV 540
           +SQN LLLKDK+ SNEVN+LQRIKL   +D+++ L  K E QN +EQ LV++ S L+T+ 
Sbjct: 579 SSQNALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSC 638

Query: 541 GTMQSIIKEHERRERDIESKMGDLFNNEFARVKQTILSNIRDIEQQIDWENIGVQGNIDS 600
            T + +I+ +E ++ D++SK+  +  ++   ++  +  +   I+      +  +  N+D 
Sbjct: 639 DTFKKMIENYECQQIDVKSKIEQILEDDLLSLRNLLQDHQNKIKTLNSGTDFDIGSNLDM 698

Query: 601 IRGEISKLLERAQQQTDDMYKDCVEKILDETPGHFQLAAEKVSEVEKLIATCHRDLTENL 660
           I+ E+ K+L   Q++ +  YK  +E  L +TP +F+   E ++++   I   H  + +NL
Sbjct: 699 IQNEVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNL 758

Query: 661 SDVSEEFNNLRQYLNDHFFKNNHEEILVSHIDRTYHHIQTSADDLFQQFKEMMDNHLEKN 720
           SD+SEE+NNL+QYLN++ F+NNHE+++ +HI+ T   +  SAD LF  FK+MM+ HLE N
Sbjct: 759 SDISEEYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESN 818

Query: 721 KDLMLESLKTATYDVIRKEMQLFEPQKKKWEDSFKYINKCDSINFAFQNGVKSPLLGIKS 780
           ++LML S K AT +VI KEM+LF P+KKKWE+S   IN+CDS+N  FQ  V   L   +S
Sbjct: 819 RNLMLNSFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLSYTRS 878

Query: 781 TLGSSQEAINKTITKVKEQMDEHE------SPASMLSNSRVFSEQFSGILNKQSLLHESL 834
            + +S   +    T++K +M          +  +++ ++++   QF+ +  K S+  +++
Sbjct: 879 KITASINQMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNELARKNSIFQDNV 938

Query: 835 KKSVIITSDHADAVDKLKEAIDHVVSE---RGSSMEGE 869
           + S+       + ++ L+++I   V +   +G   EGE
Sbjct: 939 ENSLKCAVASVNNLNHLEDSIKMAVRDTRIKGGPTEGE 976

>KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16
           YEL061C
          Length = 963

 Score =  886 bits (2290), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/896 (52%), Positives = 609/896 (67%), Gaps = 49/896 (5%)

Query: 13  EELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVD 72
           EELNITVAVRCRGRN+REI AKSSVVV+VPD+ GS EV+INT+ D+G TAQ+NSKTYTVD
Sbjct: 15  EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 74

Query: 73  EVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSES 132
           +VFGPSA QSL+F +IAEPLF+DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+ ELS+S
Sbjct: 75  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 134

Query: 133 AGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLL-GD-SQEIASSRKLRIFDSN 190
           AGIIPRILFKLFETLE   ED++VKCSFVELYNEELKDLL GD + +  + +KLRIFDS 
Sbjct: 135 AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRIFDS- 193

Query: 191 TMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRW--------------------- 229
            +   + S S                 +L     LR R                      
Sbjct: 194 -LGRDSRSNSRNNSPKMSNNNTTFLKKKLRNEALLRSRNIASSKRSSMQTIRNTTTTKAS 252

Query: 230 ------------------KTAPSVTQSHQNSQDQNAGIYIQNLQDFHITNAKEGIKLLQK 271
                             K +P+         DQ AGIYIQNLQ+FHIT AKEGIKLLQK
Sbjct: 253 ATTTTTTMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQK 312

Query: 272 GLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEIFRVSKMNLVDLAGSENISRSGAQHQ 331
           GLK+RQVA+TKMNDFSSRSHTIFTITL+KE  GEIFR+SKMNLVDLAGSENI+RSGA +Q
Sbjct: 313 GLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENINRSGALNQ 372

Query: 332 RAKEAGSINQSLLTLGRVINSLTDKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAK 391
           RAKEAGSINQSLLTLGRVINSL DK++HVPFRESKLTRLLQDSLGGNTKTALIATISPAK
Sbjct: 373 RAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAK 432

Query: 392 INSEETCSTLQYAAKAKNIKNKPQLGSVIMKDILVKNITGELAKIKADLLSTKSKEGIYM 451
           +  EETCSTL+YA+KAKNIKNKPQLGS IMKDIL+KNIT EL KIK+DLLSTKSK+GIYM
Sbjct: 433 VTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYM 492

Query: 452 SQDNYKELTNDLESYKTEVKECKRAIETLTSQNTLLLKDKKASNEVNDLQRIKLQNMRDA 511
            Q +YKELT DL++YKTE++ECKR IE+LTSQN LLLKDK+  NE N+LQRIK+Q M ++
Sbjct: 493 DQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNES 552

Query: 512 MSDLYSKAEKQNKREQNLVATASTLKTTVGTMQSIIKEHERRERDIESKMGDLFNNEFAR 571
           M  LY+K E+Q   E  L         T   +  II E + RE  + SK   L ++  + 
Sbjct: 553 MKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSY 612

Query: 572 VKQTILSNIRDIEQQIDWENIGVQGNIDSIRGEISKLLERAQQQTDDMYKDCVEKILDET 631
           V + +   I + + Q   +N  V  N+  I+ E++ LL  A+   +  Y++C+ K L +T
Sbjct: 613 VSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDT 672

Query: 632 PGHFQLAAEKVSEVEKLIATCHRDLTENLSDVSEEFNNLRQYLNDHFF---KNNHEEILV 688
           P  F    + V  ++ L +  +  + ENLSD+SEE+NN +Q++ D F+   K +  E+L 
Sbjct: 673 PLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLN 732

Query: 689 SHIDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDLMLESLKTATYDVIRKEMQLFEPQKK 748
            +I+ T   I++S++D+    + +++ HL  NK+L++ SL   T +++  E+   +P+  
Sbjct: 733 KYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLS 792

Query: 749 KWEDSFKYINKCDSINFAFQNGVKSPLLGIKSTLGSSQEAINKTITKVKEQMDEHESPAS 808
           KWE+S + IN+ D++N  F + V+S +  +   +  + ++IN  I K+ E    ++   S
Sbjct: 793 KWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDSINNNIKKINEHFKTNDIAHS 852

Query: 809 ---MLSNSRVFSEQFSGILNKQSLLHESLKKSVIITSDHADAVDKLKEAIDHVVSE 861
              M+ ++ +    F  I  K S LHE +K+  ++T++    +++L  +I  V+ +
Sbjct: 853 NNLMIDDNNIIKNNFKSIEEKNSRLHEFVKEGYLVTNESMKKLNELDTSIRTVLKD 908

>Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to
           Ashbya gossypii ACR010C
          Length = 944

 Score =  884 bits (2283), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/890 (50%), Positives = 641/890 (72%), Gaps = 19/890 (2%)

Query: 13  EELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVD 72
           EELNITVAVRCRGRNEREIKAKS+VVV+VPDVTGSNEVSINTTGD+GI  ++NS+TYTVD
Sbjct: 19  EELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVD 78

Query: 73  EVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSES 132
           +VFGPSA+Q L+F+ IAEPLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELS+S
Sbjct: 79  QVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSDS 138

Query: 133 AGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASSRKLRIFDSNTM 192
           AGIIPR+LF+LF+TLE  + D++VKCS++ELYNEELKDLL D+ +   S++LRIFDSNT+
Sbjct: 139 AGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDY--SKRLRIFDSNTI 196

Query: 193 S---AATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQDQNAGI 249
           +   A + + S                  +PT     KR    PS+ +  Q   +Q++ I
Sbjct: 197 TNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKP---KR----PSLNK--QLLYEQSSAI 247

Query: 250 YIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEIFRV 309
           YIQNLQ+FHITNA+EGI +LQKGLKHRQVA+TKMNDFSSRSHTIFTI LYK Y GE+FR+
Sbjct: 248 YIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGELFRI 307

Query: 310 SKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFRESKLTR 369
           SKMNLVDLAGSENISRSGAQ+QRAKEAGSINQSLLTLGRVINSL DKS+H+PFRESKLTR
Sbjct: 308 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTR 367

Query: 370 LLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKDILVKNI 429
           LLQDSLGGNTKTALIATISPAKIN++ET STL+YA KAKNIKN+PQLGS +MKDILVK+I
Sbjct: 368 LLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKDILVKSI 427

Query: 430 TGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEVKECKRAIETLTSQNTLLLK 489
           + EL+K+K+D LSTK+KEGIYMS ++Y+E+ NDLE+Y+TE++E KR +E+ +SQN+LLLK
Sbjct: 428 SSELSKLKSDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSSQNSLLLK 487

Query: 490 DKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGTMQSIIKE 549
           DKKAS ++N+LQ +K+  +++ +  L  K E+Q++ E +LV+T   LK  + TM+  ++ 
Sbjct: 488 DKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHTMKGSLQN 547

Query: 550 HERRERDIESKMGDLFNNEFARVKQTILSNIRDIEQQIDWENIGVQGNIDSIRGEISKLL 609
           +E  E  +++ + ++        ++++  ++  ++ ++  +N+ +  N+D IR    + L
Sbjct: 548 YETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIRTIFHETL 607

Query: 610 ERAQQQTDDMYKDCVEKILDETPGHFQLAAEKVSEVEKLIATCHRDLTENLSDVSEEFNN 669
           +  +    DM  + V+ + D+    +Q   E + +++  + T    LT  L++++EE NN
Sbjct: 608 DSVRSAGSDMCTNIVKIVKDQPSTSYQQFKEALGDLDTKVQTYSVTLTNKLTEMTEENNN 667

Query: 670 LRQYLNDHFFKNNHEEILVSHIDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDLMLESLK 729
           +++YL++HF KNN++E+L   +++ YH  +T++D L      MM++H+E++++LML S+K
Sbjct: 668 MKEYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDALISSVVSMMESHMEESRNLMLSSMK 727

Query: 730 TATYDVIRKEMQLFEPQKKKWEDSFKYINKCDSINFAFQNGVKSPLLGIKSTLGSSQEAI 789
            A  ++I KE+++F+P K++W  SF+ IN+CD+ +  F+N     L  +K    +S  A 
Sbjct: 728 DAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQFENKSTKLLTNLKELADNSVVAA 787

Query: 790 NKTITKVKEQMDEHESPASMLSNSRVFSEQFSGILNKQSLLHESLKKSVIITSDHADAVD 849
           +    +V+E +   E      S      +Q + I +K  +L +  + ++    + +   +
Sbjct: 788 DDVAKQVQENVTNFEGIVRQASAKESIVKQMNDINDKHKMLEDHFENNIKYFKESSKGFE 847

Query: 850 KLKEAIDHVVSERGSSMEGERVEHVDGILRRMDEQN---LLYLDRSPLRP 896
           ++  +I  ++  R  S E   ++ ++ +L R++ ++   +    ++P+RP
Sbjct: 848 EMDCSIKKII--REMSPEVGDIKQIEALLERVNSRSFGPIASTGKTPMRP 895

>CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} similar
           to uniprot|P27895 Saccharomyces cerevisiae YEL061c CIN8
           Kinesin-like protein
          Length = 988

 Score =  860 bits (2222), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/861 (51%), Positives = 600/861 (69%), Gaps = 51/861 (5%)

Query: 13  EELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVD 72
           EELNI VAVRCRGRNEREIKAKSSVVV VPD   +NEVSINTT DVGI A++NSKTYTVD
Sbjct: 30  EELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVD 89

Query: 73  EVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSES 132
           +VFGPSA+Q LV+++IAEPLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKL++GEL ++
Sbjct: 90  KVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDA 149

Query: 133 AGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIAS---SRKLRIFDS 189
           AGIIPR+LF+LF+TLE  K+DY+VKCSFVELYNEELKDLL DS   A+   ++KLRIFDS
Sbjct: 150 AGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLL-DSTNTATNSDNKKLRIFDS 208

Query: 190 NTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRW-------------------- 229
           N    + +  S+                    A  LR++                     
Sbjct: 209 NVNGTSASGSSSRSSSRNNSPRSAPDNSR---AQMLRRKLGRHNTTGNSKISNNNHNKFS 265

Query: 230 ---KTAPSVTQSHQNSQDQN---------------------AGIYIQNLQDFHITNAKEG 265
              +T+   T++H ++  QN                     A IYIQNL++FHIT+A EG
Sbjct: 266 RFKQTSQESTRAHASNNHQNVHIPNNNSNNTNQQQSPIDQSASIYIQNLEEFHITSAMEG 325

Query: 266 IKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEIFRVSKMNLVDLAGSENISR 325
           ++LLQKGLK RQVA+TKMNDFSSRSH+IFTITLYKE NGE+FRVSKMNLVDLAGSENISR
Sbjct: 326 LQLLQKGLKQRQVASTKMNDFSSRSHSIFTITLYKEQNGELFRVSKMNLVDLAGSENISR 385

Query: 326 SGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFRESKLTRLLQDSLGGNTKTALIA 385
           SGA +QRAKEAGSINQSLLTLGRVINSL DKS H+PFRESKLTRLLQDSLGGNTKTALIA
Sbjct: 386 SGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFRESKLTRLLQDSLGGNTKTALIA 445

Query: 386 TISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKDILVKNITGELAKIKADLLSTKS 445
           TISPAK+ SEETCSTL+YA+KAKNIKNKPQLG+ IMKDILV++IT ELAKIK+DLLSTKS
Sbjct: 446 TISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVRSITSELAKIKSDLLSTKS 505

Query: 446 KEGIYMSQDNYKELTNDLESYKTEVKECKRAIETLTSQNTLLLKDKKASNEVNDLQRIKL 505
           KEG+YMS ++YK+L  D+E YKTE++E KRAIE+LT+QN +L +++ +  + N   +  +
Sbjct: 506 KEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQNAMLQQERLSLKDDNACYKANI 565

Query: 506 QNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGTMQSIIKEHERRERDIESKMGDLF 565
            +++D +  L S  ++Q  +E N+ +    ++     M+  I   E ++++++  +    
Sbjct: 566 ASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEMKKTIHLFEFKQQELQQSISTFI 625

Query: 566 NNEFARVKQTILSNIRDIEQQIDWENIGVQGNIDSIRGEISKLLERAQQQTDDMYKDCVE 625
           ++E + ++ T+  +I  ++   D ++  + GN+  +  E+ K+++ A+++    Y +CV+
Sbjct: 626 SDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRLEKEVVKVIKAAEEEASKSYGECVK 685

Query: 626 KILDETPGHFQLAAEKVSEVEKLIATCHRDLTENLSDVSEEFNNLRQYLNDHFFKNNHEE 685
            +L ETP  F+  + ++  + KL    H  + E LSDVSEE+NNL+QYL ++FFKNNHEE
Sbjct: 686 MMLKETPRLFESVSGRLDNISKLAEENHSKIAETLSDVSEEYNNLKQYLTNNFFKNNHEE 745

Query: 686 ILVSHIDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDLMLESLKTATYDVIRKEMQLFEP 745
           +L  H+  TY  ++ ++  L Q F  M+D H+++NK  MLE++   T +VI  E+Q+F  
Sbjct: 746 LLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKRHMLENILGVTDEVINNELQMFGE 805

Query: 746 QKKKWEDSFKYINKCDSINFAFQNGVKSPLLGIKSTLGSSQEAINKTITKVKEQMDEHES 805
           Q+ KWE S   IN+CDS+N +F   + S L+ I+  + SS++ I  TI+ ++ +    +S
Sbjct: 806 QRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDVVSSSRDNIGATISSIQSRTRNRQS 865

Query: 806 PASMLSNSRVFSEQFSGILNK 826
              M+  + V  +Q + I  K
Sbjct: 866 IEEMIQGNDVIRQQITRIKQK 886

>ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL061C
           (CIN8)
          Length = 945

 Score =  855 bits (2210), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/936 (49%), Positives = 639/936 (68%), Gaps = 47/936 (5%)

Query: 13  EELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVD 72
           EELNITVAVRCRGRNEREIKAKSSVVV+VPDVTGSNEVSINTT +VGI A++NS+TYTVD
Sbjct: 19  EELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVD 78

Query: 73  EVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSES 132
           +VFGPSA+QSL+F++IAEPLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLYDG+LS+S
Sbjct: 79  KVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDS 138

Query: 133 AGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASSRKLRIFDSNTM 192
           AGIIPRI+FKLF+ LE    D++VKCS++ELYNEELKDLL +S +  SS++LRIFDS++M
Sbjct: 139 AGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHD--SSKRLRIFDSSSM 196

Query: 193 SAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAP----SVTQSHQNSQDQNAG 248
           + ++ + S                 E+    F R+R +  P     ++ + Q   +  +G
Sbjct: 197 NHSSRASSQ---------SNSPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSG 247

Query: 249 IYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEIFR 308
           IY+QN+Q+FHI NA+EGI +LQKGLKHRQVA+TKMNDFSSRSHTIFTI LYK  +GE+FR
Sbjct: 248 IYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCDGELFR 307

Query: 309 VSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFRESKLT 368
           VSKMNLVDLAGSENISRSGAQ+QRAKEAGSINQSLLTLGRVINSL DKS+H+PFRESKLT
Sbjct: 308 VSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLT 367

Query: 369 RLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKDILVKN 428
           RLLQDSLGGNTKTALIATISPAKIN++ET STL+YAAKAKNIKN+PQLG+++MKDILVKN
Sbjct: 368 RLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMKDILVKN 427

Query: 429 ITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEVKECKRAIETLTSQNTLLL 488
           I+ ELAKIK+D LSTKSK+GIYMS ++Y+E+ NDLE+ +TE++E KR IE+LTSQN LLL
Sbjct: 428 ISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQIESLTSQNNLLL 487

Query: 489 KDKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGTMQSIIK 548
           KDKKAS EV +LQ  K++ ++  +  LY K E+Q+  E  L  T   LK  + TMQ  +K
Sbjct: 488 KDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIHKLKEALHTMQGSLK 547

Query: 549 EHERRERDIESKMGDLFNNEFARVKQTILSNIRDIEQQIDWENIGVQGNIDSIRGEISKL 608
            +E  E  +++ + ++        ++++  ++  ++  +  +N+ ++ NI++I       
Sbjct: 548 SYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDKNLSIKENINNITTIFDDT 607

Query: 609 LERAQQQTDDMYKDCVEKILDETPG-HFQLAAEKVSEVEKLIATCHRDLTENLSDVSEEF 667
           L+  +    DM  D + K++ ETP  + +   E VS ++  +++    LT  L+++SEE 
Sbjct: 608 LKSVEANGSDMC-DTLVKLIKETPSMYLKEFNETVSSLKSELSSYSNALTNKLTEISEEN 666

Query: 668 NNLRQYLNDHFFKNNHEEILVSHIDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDLMLES 727
           N+LR+YL+ H FKN+ +E+L   ++  Y  ++  +D L  +   M+  H+E+++ LM+ S
Sbjct: 667 NHLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQLLSKLVSMVGAHVEESRTLMVNS 726

Query: 728 LKTATYDVIRKEMQLFEPQKKKWEDSFKYINKCDSINFAFQNGVKSPLLGIK----STLG 783
           +K    ++I  E  LF+P + +W  S   IN+CD+ +  F+    S L  +K    ++L 
Sbjct: 727 MKDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQNFEAKSTSGLDKLKELSDASLK 786

Query: 784 SSQEAINKTITKVKEQMDEHESPASMLSNSRVFSEQFSGILNKQSLLHESLKKSVIITSD 843
           SS++A+N    K K + D        L   +   +Q   I +K  +L +    +V    +
Sbjct: 787 SSEDAVN----KAKHRTDSFHDFVQKLCCDQSLKKQMHDISDKHRMLEDHFDDNVKYFKE 842

Query: 844 HADAVDKLKEAIDHVVSERGSSMEGERVEHVDGILRRMDEQNLLYLDRSPLRPANFKMNK 903
            +   + +  +I  ++ E   S E   ++ V+ ++ R++ +       SP+RP       
Sbjct: 843 SSKGFEDMDCSIKKIIHEM--SPEVGDIKSVETLMERINARTF-----SPVRPTG----- 890

Query: 904 SERNSPNR-------SSPCKSVSHSPCKQPVCHPRI 932
               +P+R       +S   S S SP K    + RI
Sbjct: 891 ---KTPSRQVLKNAITSKASSRSMSPIKTLDTNVRI 923

>KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6.16
           YEL061C
          Length = 950

 Score =  756 bits (1952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/932 (44%), Positives = 611/932 (65%), Gaps = 40/932 (4%)

Query: 7   ASGEDVEELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINS 66
           AS  + +++NITVAVRCRGRN+REI+AKS +VV+VPDVT + EVSINT+G  GI AQ+ +
Sbjct: 17  ASAMEKDDINITVAVRCRGRNKREIEAKSPIVVTVPDVTTTPEVSINTSGGSGIEAQLQA 76

Query: 67  KTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKL-Y 125
           KTYTVD+V+GP ++Q LVF+  AEPLF DF++GYNCT+LVYGMTSTGKTYTMTGD ++  
Sbjct: 77  KTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGA 136

Query: 126 DGELSESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQE-------- 177
           +G+++  AGI PRIL KLFE L+   +DYVVKCSFVELYNE+L+DLL + Q+        
Sbjct: 137 EGDVNGQAGIAPRILVKLFECLQ---DDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTEN 193

Query: 178 -------IASSRKLRIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWK 230
                  + +S+KLRIFDSN   + +   +T                +      L     
Sbjct: 194 SSKQPESLNASKKLRIFDSNNSRSNSPVTNTNNPTHKARSDYLKKKLKSNRKKSLDDMSL 253

Query: 231 TAPSVTQSHQNSQDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRS 290
            A +  ++H        GIYIQNL+DFHI+ AKEG++LLQ+GL+ RQVATTK+ND SSRS
Sbjct: 254 NANAGGKTH--VPPTQTGIYIQNLKDFHISTAKEGLQLLQRGLQRRQVATTKLNDVSSRS 311

Query: 291 HTIFTITLYKEYNGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVI 350
           HTIFTITLYK++  +++R+SK+NLVDLAGSEN++++GA + RAKE+GSINQSLLTLGRVI
Sbjct: 312 HTIFTITLYKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVI 371

Query: 351 NSLTDKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNI 410
           NSL DKS H+PFRESKLTRLLQDSLGGNTKT LIATISPAKI +EETCSTL+YA+KAKNI
Sbjct: 372 NSLADKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNI 431

Query: 411 KNKPQLGSVIMKDILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEV 470
           KNKPQLGS I+KDIL+K+++ EL K++ADL  TKSKEGIY+SQ NYKE+ +DL+++KTE+
Sbjct: 432 KNKPQLGSFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTEL 491

Query: 471 KECKRAIETLTSQNTLLLKDKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLV 530
            E KR  ++L  +N LL K+KK+  E  D  + +L N+R  +  + +K  + N +   L 
Sbjct: 492 TELKRTNDSLVQENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLS 551

Query: 531 ATASTLKTTVGTMQSIIKEHERRERDIESKMGDLFNNEFARVKQTILSNIRDIEQQIDWE 590
              + +      ++S+I+ ++++    + K   L  +E A +   ILS   D  + ++  
Sbjct: 552 EQVTDMNRIQTELKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQW-DTLKNVNSG 610

Query: 591 NIGVQGNIDSIRGEISKLLERAQQQTDDMYKDCVEKILDETPGHFQLAAEKVSEVEKLIA 650
           N  +  +IDSIRGE+  LLE  ++  + +YK C++ +L ETP  FQL ++ V ++  +  
Sbjct: 611 NYQIHTHIDSIRGEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIRGMTE 670

Query: 651 TCHRDLTENLSDVSEEFNNLRQYLNDHFFKNNHEEILVSHIDRTYHHIQTSADDLFQQFK 710
             + ++  N SD+SEEFN  +QYL+  FF+NNH E++ +H D    ++Q  +DDL Q  +
Sbjct: 671 EHYTEMARNFSDLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLLQSVQ 730

Query: 711 EMMDNHLEKNKDLMLESLKTATYDVIRKEMQLFEPQKKKWEDSFKYINKCDSINFAFQNG 770
             + N+L  N  ++  S+     DVI KEM LF P+K KWE+S   IN+ DS++  F+N 
Sbjct: 731 NSIQNYLSTNAQMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNKFRNN 790

Query: 771 VKSPLLGIKSTLGSSQEAINKTITKVKEQMDEHE-SPASMLSNSRVFSEQFSGILNK-QS 828
           +   +  I S + +S E+++++I+ +K+ + E++ +    ++++ + +  F  I  K  +
Sbjct: 791 MTKSVDDIASVIRNSNESMDRSISTIKKHIIENDINSQEQINSNELLTNSFKAIQEKSNN 850

Query: 829 LLHESLKKSVIITSDHADAVDKLKEAIDHVVSERGSSMEGERVEH-VDGILRRMDEQNL- 886
           +LH       +   +  D +  L  +I  ++        G++  H   G+   +  QN  
Sbjct: 851 ILHLVTGDLTVTAQESMDGIQNLDRSIRTLI-------HGDQYIHSTKGV--HIPPQNRG 901

Query: 887 --LYLDRSPLRPANFKMNK---SERNSPNRSS 913
             L+    PL+P++  +N+   S ++SP + S
Sbjct: 902 PELHSTLIPLKPSSSNLNRLSDSTKSSPRKRS 933

>Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON}
           (9109..12123) [3015 nt, 1005 aa]
          Length = 1004

 Score =  687 bits (1774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/685 (51%), Positives = 504/685 (73%), Gaps = 8/685 (1%)

Query: 244 DQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYN 303
           D+  GIYIQNL++FHIT+AKEGI+LLQ+GL++RQVA+TKMNDFSSRSHTIFTI LYKE++
Sbjct: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357

Query: 304 GEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFR 363
           G+IFR+SKMNLVDLAGSENISRSGAQ+QRAKEAGSINQSLLTLGRVINSL DK++H+PFR
Sbjct: 358 GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFR 417

Query: 364 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKD 423
           ESKLTRLLQDSLGGNTKTALIATISPAK+NSEETCSTL+YAAKAK+IKNKPQLGS+I KD
Sbjct: 418 ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKD 477

Query: 424 ILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEVKECKRAIETLTSQ 483
           ILVKNI  ELAK+KADLLSTKS++G+YMSQ +YKELTNDLESYKTEV+ECKR I+ LT+Q
Sbjct: 478 ILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQ 537

Query: 484 NTLLLKDKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGTM 543
           N LLLKDKKASNEV++LQ+IKLQ+M+D++S L+   EKQ+++EQ LV     LK+    M
Sbjct: 538 NGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEM 597

Query: 544 QSIIKEHERRERDIESKMGDLFNNEFARVKQTILSNIRDIEQQIDWENIGVQGNIDSIRG 603
           Q+ IK H  RE+  ++KM  +FN E  R+K  ++ N+  I ++I   N  +  NI+ I+ 
Sbjct: 598 QATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKD 657

Query: 604 EISKLLERAQQQTDDMYKDCVEKILDETPGHFQLAAEKVSEVEKLIATCHRDLTENLSDV 663
           E+  +++  Q + + +YKDC+E+++ E+P       + + +++K+    +  L+ ++S++
Sbjct: 658 EVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQKISDLYNEQLSISISEL 717

Query: 664 SEEFNNLRQYLNDHFFKNNHEEILVSHIDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDL 723
           + E N+L+QYLN  FFK++HEEIL  HI++TY +I+ ++  + +Q K  ++ +LE+++++
Sbjct: 718 NIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESRNI 777

Query: 724 MLESLKTATYDVIRKEMQLFEPQKKKWEDSFKYINKCDSINFAFQNGVKSPLLGIKSTLG 783
           +++SLK  T D+++ EM+LF P+KKKWEDSF+ INKCDS+N  +   + + L  +K+++ 
Sbjct: 778 IIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKTSVT 837

Query: 784 SSQEAINKTITKVKEQMDEHESPASMLSNSRVFSEQFSGILNKQSLLHESLKKSVIITSD 843
           S+ + ++  ++++++  D       +  NS+   +QF+ ++ K S L   L +S+ +   
Sbjct: 838 STSDLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLNESITMNES 897

Query: 844 HADAVDKLKEAIDHVVSERGSSMEGERVEHVDGILRRMDEQNLLYLDRS---PLRPANFK 900
             +A DKL E+I     +  ++    R++    ++++  + + + LDR    PL P  F 
Sbjct: 898 SINAFDKLSESIHSAFEKYNTANTISRLDESTNLMKQNKDGD-ISLDRVEMLPLSPIFFS 956

Query: 901 MNKSERNSPNRSSPCKSVSHSPCKQ 925
            NK+     +  SP K V +S  K+
Sbjct: 957 ENKNN----HVLSPSKVVVNSSAKK 977

 Score =  297 bits (761), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 139/179 (77%), Positives = 165/179 (92%), Gaps = 1/179 (0%)

Query: 13  EELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVD 72
           +ELNI VAVRCRGRNEREIKAKSSVVVSVPDV GS+E++INTT DVGI  Q+NSKTYTVD
Sbjct: 11  DELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVD 70

Query: 73  EVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSES 132
           +VFGPSANQ L+F+++AEPLF DFI+GYNCTVLVYGMTSTGKTYTMTGDE+LY+GELS+S
Sbjct: 71  KVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDS 130

Query: 133 AGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEI-ASSRKLRIFDSN 190
           AGIIPR+LFKLF+ +E Q +DY++KCSF+ELYNEELKDLL + Q I ++++KLRIFDSN
Sbjct: 131 AGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINSTAKKLRIFDSN 189

>Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa]
           {ON} complement(169349..172237) [2889 nt, 963 aa]
          Length = 962

 Score =  621 bits (1601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/935 (38%), Positives = 572/935 (61%), Gaps = 58/935 (6%)

Query: 11  DVEELNITVAVRCRGR--NEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKT 68
           D  E NI V  R +G+  NE+    +  +++  P +     +      D         + 
Sbjct: 9   DKVECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGL-----IKFKGKDDAV------KRE 57

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDE-KLYDG 127
           + +D +F     Q  ++    +P+F DFI GYNC+ LVYG T +GKTYT++G+E  L   
Sbjct: 58  FGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHS 117

Query: 128 ELSE-SAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEI---ASSRK 183
           E S  S G+IPR+L +LF+ L     D+VVKCS+VE+YNEELKDLL D       AS +K
Sbjct: 118 EASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSASIKK 177

Query: 184 LRIFDS---NTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKR-------WKTAP 233
           LRI DS   N  + A ++ +T                 +PTA   +K         K A 
Sbjct: 178 LRIVDSGSPNVKNGANSNCNT------RDNSPLTSSKSIPTAIIRKKMGRQSLTALKQAN 231

Query: 234 SVTQSHQNS----------QDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKM 283
           +++ S  NS          Q++    YIQNL++FHITNAKEGI+LL +GLK+RQ+A++K 
Sbjct: 232 TLSISRSNSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKN 291

Query: 284 NDFSSRSHTIFTITLYKEYNGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSL 343
             +SSR+ TIFTI LYKE  GEIFRVSK N VDLAG+E+  +    +QR K+   INQ +
Sbjct: 292 QKYSSRASTIFTIVLYKEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDINIINQGI 351

Query: 344 LTLGRVINSLTDKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQY 403
             L +++NSL +K   +PF++SKLT L++D+L GN+K+  I T+   K + +E   TL++
Sbjct: 352 QNLNKIVNSLHEKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEF 411

Query: 404 AAKAKNIKNKPQLGSVIMKDILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDL 463
             K +++K  P LG  I K+ L+K+I+ ELAK+K+DLLSTKSKEG+YMS ++Y  LT DL
Sbjct: 412 GNKVRSLKCYPLLGPSINKETLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDL 471

Query: 464 ESYKTEVKECKRAIETLTSQNTLLLKDKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQN 523
           + +K E+ + K+ I+ L  Q+T L KDK+A  EVN++QRIKLQ+MRD++S +Y+  EKQ 
Sbjct: 472 DKHKVEIMDLKKVIDELNEQSTTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQ 531

Query: 524 KREQNLVATASTLKTTVGTMQSIIKEHERRERDIESKMGDLFNNEFARVKQTILSNIRDI 583
           +RE +L+ +   LK TV  M   I  +  RE  ++++M  LFN E +++K  +L N+R  
Sbjct: 532 RREHDLINSTDKLKETVNNMNVTIARYTDRESSVQTQMKTLFNEELSKLKSMLLKNLRQF 591

Query: 584 EQQIDWENIGVQGNIDSIRGEISKLLERAQQQTDDMYKDCVEKILDETPGHFQLAAEKVS 643
           E+    +N+ ++ N++    EI ++L+ ++ + D ++ DC++K+ +E+P  F    + VS
Sbjct: 592 EKNELIDNLEIENNLNKAHEEIKQILQISENEIDSLFLDCIKKMSEESPKLFSSFIQDVS 651

Query: 644 EVEKLIATCHRDLTENLSDVSEEFNNLRQYLNDHFFKNNHEEILVSHIDRTYHHIQTSAD 703
            +E   +  + +L E LSDVSEEFNNL+QY+N+ FFKNNHEE+L +++++TYH +Q S+D
Sbjct: 652 RLENSTSENYNNLAELLSDVSEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSD 711

Query: 704 DLFQQFKEMMDNHLEKNKDLMLESLKTATYDVIRKEMQLFEPQKKKWEDSFKYINKCDSI 763
           D   +F ++++++LE NK ++L+++K+AT +VI  EM  F PQK+KWE S + I K    
Sbjct: 712 DFLLKFNDLLESYLEGNKSVLLQNIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHS 771

Query: 764 NFAFQNGVKSPLLGIKSTLGSSQEAINKTITKVKEQMDEHESPASMLSNSRVFSEQFSGI 823
           +  F+   +  +  ++ TL  + E++  T++++K +++E +  A+++ N+ V +E+F  I
Sbjct: 772 SNEFKTKNRVIVGKLQDTLKGTSESLFDTLSEMKSKINELQKAANIIENNEVVTEEFISI 831

Query: 824 LNKQSLLHESLKKSVIITSDHADAVDKLKEAIDHVV-SERGSSMEGERVEHVDGILRRMD 882
           + K  +L ++L  ++  T +   A DKL ++I +V  +E  +++ G +      IL+ + 
Sbjct: 832 MKKNGILKDTLNINMTSTEESIVAFDKLDDSIRNVFKNEIDTNITGYQ-----SILKEIF 886

Query: 883 EQNLLYLDRSPLRPANFKMNKS---ERNSPNRSSP 914
           +Q    LD+  L P N +  KS   +  SP+R+SP
Sbjct: 887 DQ----LDQQRLTP-NMRNRKSPVRQSVSPSRTSP 916

>KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar to
           uniprot|Q8J1G7 Ashbya gossypii ACR010C CIN8 Kinesin-like
           protein CIN8 and some similarites with YEL061C
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 965

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/699 (46%), Positives = 466/699 (66%), Gaps = 16/699 (2%)

Query: 244 DQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYN 303
           +Q++ IYIQ+LQ+FHIT+AKEG++LLQKGL HRQVA+TKMND SSRSHTIFT+TLYK +N
Sbjct: 264 EQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFN 323

Query: 304 GEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFR 363
           GE FRVSK+NLVDLAGSENISRSGAQ+QRAKEAGSINQSLLTLGRVINSL DK+ H+PFR
Sbjct: 324 GETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFR 383

Query: 364 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKD 423
           ESKLTRLLQDSLGGNTKTALIATISPAKINSEET STL+YA KAKNIKNKPQLGS +MKD
Sbjct: 384 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKD 443

Query: 424 ILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEVKECKRAIETLTSQ 483
           ILVKNI+ ELAK+K+D LSTKSKEGIYMS  +Y E+ ND+E+YKTE++E +R IE L+SQ
Sbjct: 444 ILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQ 503

Query: 484 NTLLLKDKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGTM 543
           N LL KDKK+S +  + QR++++N++ +M  LY K + ++K E  L      LK  V  M
Sbjct: 504 NQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNM 563

Query: 544 QSIIKEHERRERDIESKMGDLFNNEFARVKQTILSNIRDIEQQIDWENIGVQGNIDSIRG 603
           Q  +K HE  E+ ++S +  +  +     ++ I + + +++QQ   ++  +  +I++++ 
Sbjct: 564 QGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVKD 623

Query: 604 EISKLLERAQQQTDDMYKDCVEKILDETPGHFQLAAEKVSEVEKLIATC--HRD-LTENL 660
            +  LLE  ++    M ++  +K++ + P  F      +SE+  + +    H D L E L
Sbjct: 624 SLETLLETVKKDAIIMCENLAQKVVGDQPKFFN---SMLSELNDMFSKVDEHTDRLKEGL 680

Query: 661 SDVSEEFNNLRQYLNDHFFKNNHEEILVSHIDRTYHHIQTSADDLFQQFKEMMDNHLEKN 720
           S ++ E NNL+ YL+ HFF+NNH+EIL  H D+TYH +  S+  L  +   ++ +H+E+N
Sbjct: 681 SQITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQN 740

Query: 721 KDLMLESLKTATYDVIRKEMQLFEPQKKKWEDSFKYINKCDSINFAFQNGVKSPLLGIKS 780
           + L++++LKTAT +VI +EM  FEP +K WE SF +IN CDS++  F++     L  +KS
Sbjct: 741 RTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKS 800

Query: 781 TLGSSQEAINKTITKVKEQMDEHESPASMLSNSRVFSEQFSGILNKQSLLHESLKKSVII 840
            + S+    +    K+K+ +   +    + + +   +     I NK S+L + L+K+V  
Sbjct: 801 HMESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTVDDIKNKHSVLRDELEKNVSF 860

Query: 841 TSDHADAVDKLKEAIDHVVSERGSSMEGERVEHVDGILRRMDEQNLLYLD---RSPLRPA 897
               ++    +  ++  +++ R    EG+     D +++ +D  ++  +    ++PLRP 
Sbjct: 861 IHASSEGFKAIDSSLKRIMNFRMP--EGKTETLADDLIKHIDSSSVAPVASSGKTPLRPL 918

Query: 898 NFKMNKSERNSPNRSSPCKS----VSHSPCKQPVCHPRI 932
             K    +R+     SP KS    + +SP K+     RI
Sbjct: 919 -LKSETKQRSLSKSVSPAKSSHATIINSPLKRKSSDSRI 956

>TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON}
           Anc_6.16 YEL061C
          Length = 1097

 Score =  559 bits (1440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/587 (51%), Positives = 400/587 (68%), Gaps = 21/587 (3%)

Query: 244 DQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYN 303
           D N  IYIQNLQ+F+I NA +GIKLLQKGL+HR+VA+TKMND SSRSHTIFTITLYKE+N
Sbjct: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN 388

Query: 304 GEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFR 363
           G ++RVSKMNLVDLAGSENI++SGAQHQRAKEAGSINQSLLTLGRVINSL DKS+H+PFR
Sbjct: 389 GGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 448

Query: 364 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKD 423
           ESKLTRLLQDSLGGNTKT LI+TISPAKIN +ET STL+YA+KAKNIKNKP LGS IMKD
Sbjct: 449 ESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMKD 508

Query: 424 ILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEVKECKRAIETLTSQ 483
           +L+KNIT EL KIK+DL+ST+ K+G+YMSQ +YKEL NDLESYKTEV+E KRA E L SQ
Sbjct: 509 VLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERLISQ 568

Query: 484 NTLLLKDKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGTM 543
           N  LLKDKKASNE+N+LQRI+++   + + +LY   ++  KRE  LV     LK    +M
Sbjct: 569 NGSLLKDKKASNELNELQRIQIEKKNEKIKELYEILDEHYKREDILVELIRQLKNVGTSM 628

Query: 544 QSIIKEHERRERDIESKMGDLFNNEFARVKQ---TILSNIR---------------DIEQ 585
           QS I+ +  R+ +IE     +  NEF  +K     ILSNI                   +
Sbjct: 629 QSTIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGNIIDNLKSSIISNNSSIE 688

Query: 586 QIDWENIGVQGNIDSIRGEISKLLERAQQQTDDMYKDCVEKILDETPGHFQLAAEKVSEV 645
            ID  N   Q NID I     K+L++ Q+++  +Y  C+E+IL + P        +++ +
Sbjct: 689 AIDSSNF--QKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFKIEINSI 746

Query: 646 EKLIATCHRDLTENLSDVSEEFNNLRQYLNDHFFKNNHEEILVSHIDRTYHHIQTSADDL 705
           +         +TENLSD+SEE+NN ++YLN+ F +NN+E IL +H++     I++ +++L
Sbjct: 747 DFQYNDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESFSNNL 806

Query: 706 FQQFKEMMDNHLEKNKDLMLESLKTATYDVIRKEMQLFEPQKKKWEDSFKYINKCDSINF 765
                + ++     N  L  E L     D+++KE +  +P K+KW  S + IN  D IN 
Sbjct: 807 LLNINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTDKINN 866

Query: 766 AFQNGVKSPLLGIKSTLGSSQEAINKTITKVK-EQMDEHESPASMLS 811
            F N + + +L I + +  S   IN +I  +K  ++ E+E+   +LS
Sbjct: 867 TFHNDMNNRILQINNLILQSHNDINNSINDIKVNEIRENEAVNEILS 913

 Score =  306 bits (785), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 163/177 (92%), Gaps = 1/177 (0%)

Query: 13  EELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVD 72
           EELNITVAVRCRGRNERE++AKSSVVVSVPD+ GSNEVSINT+ +VGI A +NSKTYTVD
Sbjct: 9   EELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVD 68

Query: 73  EVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSES 132
           +VFGPSA+Q L+F++IAEPLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLYDGELS+S
Sbjct: 69  KVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDS 128

Query: 133 AGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASSRKLRIFDS 189
           AGIIPR+LFKLFE+ E+  +DY++KCSFVELYNE+LKDLL DS +  + +KLRIFDS
Sbjct: 129 AGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVD-NTYKKLRIFDS 184

>TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16
           YEL061C
          Length = 982

 Score =  472 bits (1215), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 334/998 (33%), Positives = 553/998 (55%), Gaps = 95/998 (9%)

Query: 16  NITVAVRCRGRNEREIKAKSSVVVSVPDVTG--SNEVSI--NTTGDVGITAQINSKTYTV 71
           NITVAVRCR   + E  + S  ++S+ D     SNEV +   +TG          K YT+
Sbjct: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTG--------RKKIYTL 60

Query: 72  DEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGD----EKLYDG 127
           D V+G   +Q  +F +   P +  F  GYN +++ YG   +GK YT+ G+    +   + 
Sbjct: 61  DAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNA 120

Query: 128 ELSESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEI--------- 178
           E SE+ G++PR+L +LF+ LE    D+++KCSFVE+YN+EL+DLL D+            
Sbjct: 121 E-SENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDTGNNANGNNSNGA 179

Query: 179 --ASSRKLRIFD--SNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRW----- 229
             ++ +KLRI D  SN + +A +S S+                ++PTA  +RKR      
Sbjct: 180 TGSTGKKLRIVDSASNGLRSAGSSNSS-----TRDNSPLTNSKKIPTA-MMRKRMGKRSL 233

Query: 230 -------------------KTAPSVTQSHQNSQDQNAGIYIQNLQDFHITNAKEGIKLLQ 270
                              +T      S Q+S ++   IYIQNLQ+  IT  +EG+ +++
Sbjct: 234 PPNNSISNNTANNNRLSLSRTNSFSDYSLQSSHERLNSIYIQNLQEITITEIEEGMAIIK 293

Query: 271 KGLKHRQVATT----KMNDFSSRSHTIFTITLYKEYN-GEIFRVSKMNLVDLAGSE---- 321
           KGLK+R++A+T      N+FS RSH+IF ITLYKE    E+FR+SK++ V+ AGSE    
Sbjct: 294 KGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSEYGDN 353

Query: 322 NISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFRESKLTRLLQDSLGGNTKT 381
           N S++GA           N +L +  ++IN + + S +  F +SKLT+LLQ++  G T+T
Sbjct: 354 NTSKNGA----------FNSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQNNFDGITRT 403

Query: 382 ALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKDILVKNITGELAKIKADLL 441
             IA I+P K   + TCS L  A K K IKN+P+ GSVI K+ L+K ++ EL K K+DLL
Sbjct: 404 LFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITKESLIKILSNELVKTKSDLL 463

Query: 442 STKSKE-GIYMSQDNYKELTNDLESYKTEVKECKRAIETLTSQNTLLLKDKKASNEVNDL 500
           S KS + GIYM + +Y ELT  LESYK +++  K +I  LT +   +  +K+   E+N+ 
Sbjct: 464 SYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKRTFEEINER 523

Query: 501 QRIKLQNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGTMQSIIKEHERRERDIESK 560
           QRIKLQN+R+ +S+L    EKQ+KRE  L      L + +G MQ  ++++  +E  +++K
Sbjct: 524 QRIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSILGNMQKSVEKYSDKEIHLQNK 583

Query: 561 MGDLFNNEFARVKQTILSNIRDIEQQIDWENIGVQGNIDSIRGEISKLLERAQQQTDDMY 620
           +  L++ E  ++K ++ SN  DI+ ++  +N  +  NID+I+ EI K+  ++Q +  ++ 
Sbjct: 584 LKLLYDKELVKLKNSLESNFADIKNRMPDDNDNMNTNIDNIKAEILKIANQSQSKVKELL 643

Query: 621 KDCVEKILDETPGHFQLAAEKVSEVEKLIATCHRDLTENLSDVSEEFNNLRQYLNDHFFK 680
            +   ++LD +P +F+     +  +E+ +   H   +E LSD+SEEFNNL  Y+ND+F K
Sbjct: 644 TNSANQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSELLSDISEEFNNLNNYINDNFLK 703

Query: 681 NNHEEILVSHIDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDLMLESLKTATYDVIRKEM 740
           ++HEE++ ++I+RTYH +Q  + +  + FK+++D ++EKN   + +S+ + T +++  E+
Sbjct: 704 SSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKNTKSLSKSITSLTSEIVENEL 763

Query: 741 QLFEPQKKKWEDSFKYI--NKCDSINFAFQNGVKSPLLGIKSTLGSSQEAINKTITKVKE 798
             F P+KKKWE +   I  N  +SI    +N     L  + S   S+ E     ++ +K+
Sbjct: 764 TQFNPEKKKWELASNEIIENFNESIT-KNKNKNSEILAKLLSESTSTSELFINNMSSIKK 822

Query: 799 QMDEHESPASMLSNSRVFSEQFSGILNKQSLLHESLKKSVIITSDHADAVDKLKEAIDHV 858
            ++  E  + + +++ +   +F  I+NK   L + +  +   + +  D+ D LKEA+ +V
Sbjct: 823 NVEIVEEFSEIFNSNDLIKSEFLEIINKNKKLKDLITDNFNSSENSIDSFDNLKEAMQNV 882

Query: 859 VSERGSSMEGERVEHVDGILRRMDEQNLLYLDRSPLRPANFKMNKSERNSPNRSSPCKSV 918
                         ++  I  +M++Q  L ++ S  + A +K N     SP++ SP KS 
Sbjct: 883 FKNEMKESYSNDTLNLKEIFEQMEQQK-LGVNSSSKKKA-YKQNL----SPSKISPIKSS 936

Query: 919 S--HSPCKQPV-CHPRINYKRSLT---DLNDGQEEGLN 950
           +  +SP K  +     I+ KR +    +LN    E LN
Sbjct: 937 TKLNSPLKVEIQSLSEIDMKRPIKRKLNLNLDLSENLN 974

>ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL063W
           (KIP1)
          Length = 1129

 Score =  379 bits (972), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 308/916 (33%), Positives = 459/916 (50%), Gaps = 183/916 (19%)

Query: 6   QASGEDVEELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINT-TGDVGITAQI 64
           Q+ GE   E NI V VRCR RNEREI+ KSSVV+S     G   +  N  TG        
Sbjct: 46  QSEGEP--EYNIKVYVRCRSRNEREIREKSSVVISTLGNNGREVILTNPGTG-------- 95

Query: 65  NSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKL 124
           ++KTYT D VFG  ++Q  +F ++A     + I+GYNCTV  YG T TGKTYTM+GD  +
Sbjct: 96  SNKTYTFDRVFGVESDQESMFNQVARAYINEMIEGYNCTVFAYGQTGTGKTYTMSGDITM 155

Query: 125 YDGE--------LSESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQ 176
                       LSE AGIIPR+L +LF  L    EDY VK SF+ELYNE+L+DLL D +
Sbjct: 156 MGSSEDDPNFVLLSEHAGIIPRVLVELFRELREVSEDYSVKVSFLELYNEKLRDLLVDDK 215

Query: 177 EI----------ASSRKLRIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLR 226
           ++          A    +RI+DS                                     
Sbjct: 216 DVSLEDHNFNGMAPPESIRIYDS------------------------------------L 239

Query: 227 KRWKTAPSVTQSHQNSQDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDF 286
           K  +T+P+              I+++ +++ +I +A+EG+KLL  G   R+VA TK ND 
Sbjct: 240 KTDRTSPN-----------GYSIFVKGMEEMYIRSAQEGLKLLMDGSLKRKVAATKCNDL 288

Query: 287 SSRSHTIFTITL----YKEYNGEIF-RVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQ 341
           SSRSHTIFTIT         +GE + +V K+NLVDLAGSENI+RSGA+++RA+EAG IN+
Sbjct: 289 SSRSHTIFTITTNVTKIHPISGEQYVKVGKLNLVDLAGSENINRSGAENKRAQEAGLINK 348

Query: 342 SLLTLGRVINSLTDKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTL 401
           SLLTLGRVIN+L D S H+P+RESKLTRLLQDSLGG TKT +IATISPAKI+ EET STL
Sbjct: 349 SLLTLGRVINALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTL 408

Query: 402 QYAAKAKNIKNKPQLGSVIMKDILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTN 461
           +YA +AK+IKN PQ+  ++ K+  +     E+ +++ +L ++ SKEGIY++Q+ ++    
Sbjct: 409 EYATRAKSIKNTPQVNQLMAKESCIIEYIQEIERLRKELRASHSKEGIYITQEKFE---- 464

Query: 462 DLESYKTEVKECKRAIETLTSQ----------NTLLLKDKKAS-NEVNDLQRIKLQNMRD 510
             ES    V+E +  I+ L  Q           T L+K+K     E++   R  L+  +D
Sbjct: 465 TYESNSILVEEQQAKIDNLQEQLRRLKEKFLEQTKLIKEKDGQIKELDVANRKYLEQSKD 524

Query: 511 A---MSDLYSKAEKQNKREQNLVATASTLKTTVGTMQSIIKEHERRERDIESKMGDLFNN 567
               ++ ++SK E                 T +G   + +K  E    DI    G++  +
Sbjct: 525 LTIYINGIHSKLEDYE-------------HTMIGIHNNNMKLLE----DINDNRGNIHED 567

Query: 568 EFARVKQTILSNI---RDIEQQIDWENIGVQGNIDSIRGEISKLLERAQQQTDDMYKDCV 624
             A+V      N+   R+I   I   N+ +Q   D  +  +  + E  Q++   + +   
Sbjct: 568 LLAKVDHIETCNLIISREITSLISIRNV-LQAYSDRFKTVLGGVFEELQEKLTQVGRTTE 626

Query: 625 EKILDETPGHFQLAAEKVSEVEKLI-ATCH---RDLTENLSDVSEEFNNLR--------- 671
           E  LD          EK  EV  +I ATC    R + E++S++  E  +L          
Sbjct: 627 ESQLD---VDLSFVDEKFEEVTDIIKATCENLVRTMDEHVSNMKLETTDLTSSCASLLEK 683

Query: 672 --QYLNDHFFK---------NNHEEILVSHID----RTYHHIQTSADDLFQQFKEM---- 712
             Q L+    K         N+  + +V  +D       + +Q + D L    KE+    
Sbjct: 684 ECQALHGKLQKYVESMKQELNSTLQEMVRDLDMKASSMLNVVQCTKDGLISHKKELEADL 743

Query: 713 -------------MDNHLE----KNKDLMLESLKTATYDVIRKEMQLFEPQKKKWEDSFK 755
                        M+  L+    K +  + ES+K A+YD + K+M   E ++K +E+S  
Sbjct: 744 ESQKREHFDIAQTMEEQLQKIVGKERQNIQESMK-ASYDFLMKQMVETELRQKNFEESI- 801

Query: 756 YINKCDSINFAFQNG---VKSPLLG--IKSTLG---SSQEAINKTITKVKEQMDEHESPA 807
            ++K   +     NG   + S  +G    S +G   S +  ++     +K  + E +   
Sbjct: 802 -VSKVKGLLSHSNNGMSKMSSYAVGRLYDSAIGGVNSIENTVSSATFSMKNDLQEFQMDI 860

Query: 808 SMLSNSRVFSEQFSGI 823
           S + +SR F ++F+ +
Sbjct: 861 SPICDSRRFGDEFTAV 876

>SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1112

 Score =  369 bits (947), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 206/458 (44%), Positives = 285/458 (62%), Gaps = 64/458 (13%)

Query: 16  NITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVDEVF 75
           NI V VRCR RN+REI  KSSVV+S     G + +  N +     +     KTYT D VF
Sbjct: 54  NIKVYVRCRSRNKREIGEKSSVVISTMGAQGRDVILSNPSSSSSGSLTNVKKTYTFDRVF 113

Query: 76  GPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE------- 128
           G  ++Q +VF  +A+   ++ ++GYNCTV  YG T TGKTYTM+GD  +           
Sbjct: 114 GAESDQEVVFNSVAKNYISEMLQGYNCTVFAYGQTGTGKTYTMSGDINILGSTTHNHDQS 173

Query: 129 ---LSESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDS--QEIASSRK 183
              LSE AGIIPR+L  LF+ L+ +  DY VK SF+ELYNE LKDLL DS  ++  ++  
Sbjct: 174 SILLSEHAGIIPRVLVDLFKDLKNESTDYSVKVSFLELYNERLKDLLADSNKEDDNNAES 233

Query: 184 LRIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQ 243
           +RIFD+                                               +  +N+Q
Sbjct: 234 IRIFDN----------------------------------------------IKPEKNTQ 247

Query: 244 DQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITL----Y 299
             ++ I ++ +++ +I +A+EG+KLL +G   RQVA+TK ND SSRSHT+FTIT      
Sbjct: 248 GSHS-IMVKGMEEIYIKSAQEGLKLLTEGSIKRQVASTKCNDLSSRSHTVFTITTNVTKV 306

Query: 300 KEYNGEIF-RVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSL 358
              +GE + +  K+NLVDLAGSENI+RSGA+++RA+EAG IN+SLLTLGRVIN+L D S 
Sbjct: 307 DPLSGEEYVKNGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQ 366

Query: 359 HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGS 418
           H+P+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET STL+YA +AK+IKN PQ+  
Sbjct: 367 HIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETVSTLEYATRAKSIKNTPQINQ 426

Query: 419 VIMKDILVKNITGELAKIKADLLSTKSKEGIYMSQDNY 456
            + KD  +     E+ +++ +L +T++K+GIY++Q+ Y
Sbjct: 427 SMTKDSCITEYIHEIDRLRKELRATRTKDGIYITQEKY 464

>Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} similar
           to Ashbya gossypii ACR228C
          Length = 1134

 Score =  367 bits (943), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 209/463 (45%), Positives = 285/463 (61%), Gaps = 57/463 (12%)

Query: 9   GEDVEELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSIN-TTGDVGITAQINSK 67
           G + +  NI V VRCR RN REIK KSSVVVS     G   +  N +TG        N+K
Sbjct: 49  GSEEQGYNIKVYVRCRSRNVREIKEKSSVVVSTLGSQGREIILSNQSTG--------NNK 100

Query: 68  TYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDG 127
           TYT D+VFG  ++Q  +F K+A     + ++GYNCTV  YG T TGKTYTM+GD  +   
Sbjct: 101 TYTFDQVFGVESDQESLFDKVARAYITEMLEGYNCTVFAYGQTGTGKTYTMSGDISVVGA 160

Query: 128 EL--------SESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIA 179
            L        SE AGIIPR+L +LF+ L+ + EDY VK SF+ELYNE+L+DLL + +E  
Sbjct: 161 SLEDPNYVLLSEHAGIIPRVLVELFQQLQRESEDYSVKVSFLELYNEKLRDLLVEDKEPL 220

Query: 180 SSRKLRIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSH 239
                 I +        NS                     P    +    K   S +  H
Sbjct: 221 ------IDEGGIGGGVANS---------------------PETIRIYDNLKLDRSNSSGH 253

Query: 240 QNSQDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITL- 298
                    I ++ +++ +I +A+EG+KLL +G   R+VA T+ ND SSRSHTIFTIT  
Sbjct: 254 --------SIMVKGMEEMYIRSAQEGLKLLMEGSLKRKVAATRCNDLSSRSHTIFTITTN 305

Query: 299 ---YKEYNGEIF-RVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLT 354
                  +GE + ++ K+NLVDLAGSENI+RSGA+++RA+EAG IN+SLLTLGRVIN+L 
Sbjct: 306 VTKIHPISGEQYVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 365

Query: 355 DKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKP 414
           D S H+P+RESKLTRLLQDSLGG TKT +IAT+SPAK + EET STL+YA +AK+IKN P
Sbjct: 366 DHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKTSMEETASTLEYATRAKSIKNTP 425

Query: 415 QLGSVIMKDILVKNITGELAKIKADLLSTKSKEGIYMSQDNYK 457
           Q+  ++ K+  +     E+ K++ +L +  +KEGIY++++ Y+
Sbjct: 426 QINQLMAKESCILGYIKEIEKLRKNLKANHAKEGIYITEEKYE 468

>TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7.387
           YBL063W
          Length = 1105

 Score =  363 bits (931), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 212/536 (39%), Positives = 316/536 (58%), Gaps = 87/536 (16%)

Query: 16  NITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVDEVF 75
           N+ V VRCR RNE+EI+ KSSVV+S     G   +  N  G +  +     +TYT D+VF
Sbjct: 41  NMRVYVRCRSRNEQEIEEKSSVVISTLGAKGREVILSNGAGSLSHS----KRTYTFDQVF 96

Query: 76  GPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY---DGE---- 128
           G  ++Q  VF ++A+   ++ ++GYNCTV  YG T TGKTYTM+GD  +    D +    
Sbjct: 97  GAESDQETVFDEVAKDYISEMLEGYNCTVFTYGQTGTGKTYTMSGDISILGDLDSQDKIL 156

Query: 129 LSESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASSRKLRIFD 188
           L E +GIIPR+L  LF+ L  +  +Y VK SF+ELYNE+LKDLL +S++      +RIFD
Sbjct: 157 LGEHSGIIPRVLVDLFKQLSQETNEYTVKVSFLELYNEKLKDLLAESEQ--EEENIRIFD 214

Query: 189 SNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQDQNAG 248
           +N+      ++                           K+       +    ++   ++ 
Sbjct: 215 NNSGFNCNKNV---------------------------KQLVKLDGSSHRTSSASSSSSS 247

Query: 249 IYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEY-----N 303
           I ++ +++F+I +A EG++LL  G   R+VA TK ND SSRSHT+FTIT          N
Sbjct: 248 IMVKGMEEFYIKSAHEGLELLMTGSLKRKVAATKCNDLSSRSHTVFTITTNVARTDPVSN 307

Query: 304 GEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFR 363
            +  ++ K+NLVDLAGSENI+RSGA+++RA+EAG IN+SLLTLGRVIN+L D S H+P+R
Sbjct: 308 EQYIKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDNSQHIPYR 367

Query: 364 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKD 423
           ESKLTRLLQDSLGG TKT +IATISPAKI+ +ET STL+YA +AK+IKN PQ+   + K+
Sbjct: 368 ESKLTRLLQDSLGGKTKTCIIATISPAKISMDETVSTLEYATRAKSIKNTPQVNQSMSKN 427

Query: 424 ILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEVKECKRAIETLTSQ 483
             +     E+ +++ +L +++ KEG+Y+++D ++                      L   
Sbjct: 428 SCLGEYIHEIERLRQELKASRQKEGMYITEDQFQ----------------------LYES 465

Query: 484 NTLLLKDKKASNEVNDLQRIKLQNMRDAM----------SDLYSKAEKQNKREQNL 529
           N++L+++          Q++++QNM D +          ++L   AEK+ K+ Q L
Sbjct: 466 NSILVEE----------QKVRIQNMEDQILKFKAKYVEQTNLSKDAEKRLKQSQLL 511

>Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  361 bits (926), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 205/462 (44%), Positives = 279/462 (60%), Gaps = 78/462 (16%)

Query: 14  ELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVDE 73
           E NI V VRCR RN REI  KSSVV+S     G   +  N +     +++   KTY  D+
Sbjct: 50  ESNIHVYVRCRSRNRREIDEKSSVVISTLGPQGKEIILSNGSHQSYSSSK---KTYQFDQ 106

Query: 74  VFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE----- 128
           VFG  ++Q +VF   A+    + + GYNCT+  YG T TGKTYTM+GD  +  G+     
Sbjct: 107 VFGAESDQEMVFHATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINIL-GDVQSTD 165

Query: 129 ---LSESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIA-----S 180
              L E AGIIPR+L  LF+ L    ++Y VK SF+ELYNE LKDLL D+++       S
Sbjct: 166 NLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVSFLELYNENLKDLLSDNEDDDPTANDS 225

Query: 181 SRKLRIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQ 240
            +++RIFD+N                                                  
Sbjct: 226 KKQIRIFDNN-------------------------------------------------- 235

Query: 241 NSQDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITL-- 298
              + N+ I ++ +Q+  I +A EG+ LL +G   R+VA TK ND SSRSHT+FTIT   
Sbjct: 236 ---NNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNI 292

Query: 299 ----YKEY--NGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINS 352
                KE+  N    ++ K+NLVDLAGSENI+RSGA+++RA+EAG IN+SLLTLGRVIN+
Sbjct: 293 IEQDSKEHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINA 352

Query: 353 LTDKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKN 412
           L D S H+P+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET STL+YA +AK+IKN
Sbjct: 353 LVDHSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKN 412

Query: 413 KPQLGSVIMKDILVKNITGELAKIKADLLSTKSKEGIYMSQD 454
            PQ+   + KD  +K+   E+ K++ DL ++++K+GI+++QD
Sbjct: 413 SPQVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQD 454

>ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1138

 Score =  360 bits (924), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 216/483 (44%), Positives = 302/483 (62%), Gaps = 38/483 (7%)

Query: 16  NITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVDEVF 75
           NI V VRCR RN+REI  KSSVVVS     G + +  N +  +        KTY  DEVF
Sbjct: 44  NIKVYVRCRSRNQREIDEKSSVVVSTMGRKGKSVILSNPSSPLSHPK----KTYMFDEVF 99

Query: 76  GPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY---DGE---- 128
           G  ++Q  +F ++A+    + ++GYNCTV  YG T TGKTYTM+GD  ++   D +    
Sbjct: 100 GADSDQESIFTEVAKNYIQEMLEGYNCTVFAYGQTGTGKTYTMSGDMSIWGDLDSQDKIL 159

Query: 129 LSESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASSRKLRIFD 188
           L E AGIIPR+L  LF+ L  +  ++ VK SF+ELYNE LKDLL D+   +    +RIFD
Sbjct: 160 LGEHAGIIPRVLVNLFKQLSKETTEHSVKISFLELYNERLKDLLADND--SDEDNIRIFD 217

Query: 189 SNTMSA--ATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQDQN 246
           +N  +A  A+N MS                  L  AT        + S + S  +S   +
Sbjct: 218 NNNSNAHGASNGMS-----QVKMNKSKVRAPTLSGAT-------VSSSASNSSTSSSSSS 265

Query: 247 AGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLY----KEY 302
           + I ++ +++ +I +A EG++LL KG   R+VA TK ND SSRSHTIFTI  +       
Sbjct: 266 SSITVKGMEERYIKSAYEGLQLLTKGSLKRKVAATKCNDLSSRSHTIFTIVTHVARTDPV 325

Query: 303 NGEIF-RVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVP 361
           +GE + ++ K+NLVDLAGSENI+RSGA++ RA+EAG IN+SLLTLGRVIN+L + S H+P
Sbjct: 326 SGEQYVKIGKLNLVDLAGSENINRSGAENMRAQEAGLINKSLLTLGRVINALVEHSSHIP 385

Query: 362 FRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIM 421
           +R SKLTRLLQDSLGG TKT +IATISPA+I+ +ET STL+YA +AK+IKN PQ+   + 
Sbjct: 386 YRGSKLTRLLQDSLGGKTKTCIIATISPARISMDETVSTLEYATRAKSIKNTPQVNQSLS 445

Query: 422 KDILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDL-ESYKTEVKECKRAIETL 480
           KD  +     E+ +++ +L +++ +EG+Y++Q+ Y     DL ES    V+E K  I+ +
Sbjct: 446 KDSCIMEYIYEIERLRQELKASRQREGMYITQEQY-----DLYESNSLLVEEQKVVIQNM 500

Query: 481 TSQ 483
             Q
Sbjct: 501 GEQ 503

>Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  358 bits (919), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 206/474 (43%), Positives = 282/474 (59%), Gaps = 78/474 (16%)

Query: 2   VAMPQASGEDVEELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGIT 61
           V  P  +     + NI V VRCR RN+REI  KSSVV+S     G   +  N +     +
Sbjct: 37  VTPPIYNSAATSDSNIHVYVRCRSRNKREIDEKSSVVISTLGPQGKEIILSNGSHQSYSS 96

Query: 62  AQINSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGD 121
           ++   KTY  D+VFG  ++Q  VF   A+    + + GYNCT+  YG T TGKTYTM+GD
Sbjct: 97  SK---KTYQFDQVFGAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGD 153

Query: 122 EKLYDGE--------LSESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLG 173
             +  G+        L E AGIIPR+L  LF+ L    ++Y VK +F+ELYNE LKDLL 
Sbjct: 154 INIL-GDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVTFLELYNENLKDLLS 212

Query: 174 DSQEIA-----SSRKLRIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKR 228
           D+++       S R++RIFD+N                                      
Sbjct: 213 DNEDDDPAVNDSKRQIRIFDNN-------------------------------------- 234

Query: 229 WKTAPSVTQSHQNSQDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSS 288
                          + N+ I ++ +Q+  I +A EG+ LL +G   R+VA TK ND SS
Sbjct: 235 ---------------NNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSS 279

Query: 289 RSHTIFTITL------YKEY--NGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSIN 340
           RSHT+FTIT        K++  N    ++ K+NLVDLAGSENI+RSGA+++RA+EAG IN
Sbjct: 280 RSHTVFTITTNIVEQDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLIN 339

Query: 341 QSLLTLGRVINSLTDKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCST 400
           +SLLTLGRVIN+L D S H+P+RESKLTRLLQDSLGG TKT +IATISPAKI+ EET ST
Sbjct: 340 KSLLTLGRVINALVDHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETAST 399

Query: 401 LQYAAKAKNIKNKPQLGSVIMKDILVKNITGELAKIKADLLSTKSKEGIYMSQD 454
           L+YA +AK+IKN PQ+   + KD  +K+   E+ K++ DL ++++K+GI+++QD
Sbjct: 400 LEYATRAKSIKNTPQVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQD 453

>NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7.387
          Length = 1102

 Score =  352 bits (903), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 257/776 (33%), Positives = 393/776 (50%), Gaps = 143/776 (18%)

Query: 17  ITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVDEVFG 76
           I V VRCR RNEREI+ KSSVV+S      S ++ ++        A+   +TYT D VFG
Sbjct: 61  IKVYVRCRSRNEREIQEKSSVVISTLGAPQSTQLLLSNPLLPLAYAK---RTYTFDRVFG 117

Query: 77  PSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGEL------- 129
             ++Q  VF   A+    + ++GYNCTV  YG T TGKTYTM+GD  +  G+L       
Sbjct: 118 AESDQESVFNDAAKNYIHEMLEGYNCTVFAYGQTGTGKTYTMSGDLNILGGDLDSNTMVL 177

Query: 130 -SESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASSRKLRIFD 188
             E AGIIPR+L +LF  L+   E Y VK SF+ELYNE LKDLL   Q  +    +RIFD
Sbjct: 178 LGEHAGIIPRVLVELFRWLD-GNEGYSVKVSFLELYNERLKDLLASEQ--SEEENIRIFD 234

Query: 189 SNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQDQNAG 248
           + + S                                                     + 
Sbjct: 235 NVSAS-----------------------------------------------------SS 241

Query: 249 IYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITL----YKEYNG 304
           I ++ +++ +I +A +G++LL  G   R+VA TK ND SSRSHT+FTIT         +G
Sbjct: 242 IMVKGMEEIYINSAHQGLQLLMDGSIKRKVAATKCNDLSSRSHTVFTITTNITKLDPVSG 301

Query: 305 EIF-RVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFR 363
           E + +  K+NLVDLAGSENI+RSGA+++RA+EAG IN+SLLTLGRVIN+L D + H+P+R
Sbjct: 302 EQYVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHTQHIPYR 361

Query: 364 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKD 423
           ESKLTRLLQDSLGG TKT +IATISPAKI+ +ET STL+YA +AK+IKN PQ+   + KD
Sbjct: 362 ESKLTRLLQDSLGGKTKTCIIATISPAKISMDETISTLEYATRAKSIKNTPQVNQSMSKD 421

Query: 424 ILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDL-ESYKTEVKECKRAIETLTS 482
             +     E+ +++ +L +++ K+GI ++QD +     DL ES    V E K  I+ +  
Sbjct: 422 SCINEYVHEIERLRQELKTSRQKDGISITQDQF-----DLYESNGILVDEQKTKIQNMEE 476

Query: 483 Q----------NTLLLKDKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLVAT 532
           Q           T L K+ ++  + N+LQ I+L++ R  +  L    +  +         
Sbjct: 477 QIQRFKDKYVKQTELNKNLESRLKQNELQTIQLKSQRTQLLSLLENFQSNSNH------- 529

Query: 533 ASTLKTTVGTMQSIIKEHERRERDIE---SKMGDLFNNEFARVKQTI--LSNIRDIEQQI 587
                     ++ + K H+     I+    +  +L N     VK     +S I D ++++
Sbjct: 530 ---------YIERVTKIHDSNTHLIQQLAQQRSELHNGSITYVKSVTEAMSGISDQQKEL 580

Query: 588 DWENIGVQGNIDSIRGEISKLLERAQQQTDDMYK---------------DCVEKILDETP 632
                 +Q   D  +  I+ +    + +  D  K               D + ++ D+  
Sbjct: 581 SELRNVLQSYNDKFKHVITGIFTELEDKVKDTRKSTLEPLTSMNLRLILDMIGELRDDIS 640

Query: 633 GHFQLAAEKVSEVEKLIATCHRDLTENLSDVSEEFNNLRQYLNDHFFKNNHEEILVSHID 692
             F++  +  +E    I   H+D+ E        F+++ +Y       ++ E++L + I+
Sbjct: 641 TRFEMLKKPRTEDTTKIFKAHQDIIETC------FSHINEYC------DSMEKVLTTSIN 688

Query: 693 RTYHHIQTSADDLFQQFKEMMDNHLEKNKDLMLESLKTATYDVIRKEMQLFEPQKK 748
           +   H   S+ D+FQ       +  +K  D ++  +KT     +  E Q+ E +K+
Sbjct: 689 QFQAHSLPSSFDIFQ-------DKTKKELDELMNIIKTQKQYAMNLEQQIIEEKKR 737

>KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa]
           {ON} Anc_7.387 YBL063W
          Length = 1151

 Score =  353 bits (905), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 207/455 (45%), Positives = 281/455 (61%), Gaps = 61/455 (13%)

Query: 16  NITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVDEVF 75
           NI V VRCR RN+REI+ KSSVV+S     G   V  + +  +  T     KTY  D+VF
Sbjct: 59  NIQVYVRCRSRNQREIEEKSSVVISTMGAQGKEVVLSDPSSVLSHTK----KTYIFDQVF 114

Query: 76  GPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGD-EKLYDGE------ 128
           G  ++Q +VF   A+    + ++GYNCT+  YG T TGKTYTM+GD   L D E      
Sbjct: 115 GVESDQEVVFNATAQNYIHEMLQGYNCTIFAYGQTGTGKTYTMSGDINILGDLESQDKIL 174

Query: 129 LSESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASSRKLRIFD 188
           L E AGIIPR+L  LF+ L  +  +Y VK SF+ELYNE LKDLL  S+E   S  +RIFD
Sbjct: 175 LGEHAGIIPRVLVNLFQYLTRESTEYSVKISFLELYNERLKDLLSQSKETEES--IRIFD 232

Query: 189 SNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQDQN-- 246
           ++                                          PS     Q S   N  
Sbjct: 233 NHI-----------------------------------------PSGNSKIQKSSRNNTY 251

Query: 247 AGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKE----Y 302
           + I ++ +++ +I +A EG++LL +G   R+VA+TK ND SSRSHTIFTIT         
Sbjct: 252 SSIMVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKCNDLSSRSHTIFTITTNITKIDPV 311

Query: 303 NGEIF-RVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVP 361
           +GE + ++ K+NLVDLAGSENISRSGA++ RA+EAG IN+SLLTLGRVIN+L D S H+P
Sbjct: 312 SGEQYVKIGKLNLVDLAGSENISRSGAENMRAQEAGLINKSLLTLGRVINALVDHSQHIP 371

Query: 362 FRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIM 421
           +RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET STL+YA +AK+IKN PQ+   + 
Sbjct: 372 YRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETISTLEYATRAKSIKNTPQINQSMS 431

Query: 422 KDILVKNITGELAKIKADLLSTKSKEGIYMSQDNY 456
           KD+ +     E+ +++ +L +++ K+G+Y++Q+ +
Sbjct: 432 KDVCINEYVQEIERLRQELKASRQKDGVYITQEQF 466

>NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {ON}
           Anc_7.387
          Length = 1186

 Score =  353 bits (905), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 198/451 (43%), Positives = 271/451 (60%), Gaps = 71/451 (15%)

Query: 16  NITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVDEVF 75
           NI V VRCR R+EREIK KSSVV+S     G+  +  N +  +        K+Y+ D VF
Sbjct: 108 NIKVYVRCRSRSEREIKEKSSVVISTLGPQGNQVILSNPSSPLSYPK----KSYSFDRVF 163

Query: 76  GPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDG-------E 128
           G  ++Q  VF   A+   ++ + GYNCTV  YG T TGKTYTM+GD  +           
Sbjct: 164 GAESDQETVFNDAAKNYISEMLSGYNCTVFAYGQTGTGKTYTMSGDLNILGNLESKDMIL 223

Query: 129 LSESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASSRKLRIFD 188
           L E AGIIPR+L  LF+ L L+  DY VK SF+ELYNE LKDL   ++  +    +RIFD
Sbjct: 224 LGEHAGIIPRVLVNLFKMLALEN-DYSVKISFLELYNERLKDLFAQNE--SEEETIRIFD 280

Query: 189 SNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQDQNAG 248
           +N  ++++                                                    
Sbjct: 281 NNNNASSS---------------------------------------------------- 288

Query: 249 IYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFT----ITLYKEYNG 304
           I ++ +++ +I +A EG++LL  G   R+VA+TK ND SSRSHT+FT    IT     +G
Sbjct: 289 IMVKGMEEIYIKSAHEGLQLLMDGSLKRKVASTKCNDLSSRSHTVFTIATNITKIDPISG 348

Query: 305 EIF-RVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFR 363
           E + +  K+NLVDLAGSENI+RSGA+++RA+EAG IN+SLLTLGRVIN+L D S H+P+R
Sbjct: 349 EQYIKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHIPYR 408

Query: 364 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKD 423
           ESKLTRLLQDSLGG TKT +IATISPAKI+ EET STL+YA +AK+IKN PQ+   + KD
Sbjct: 409 ESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYAIRAKSIKNTPQINQSMSKD 468

Query: 424 ILVKNITGELAKIKADLLSTKSKEGIYMSQD 454
             +     E+ +++ +L +++ K+GI ++QD
Sbjct: 469 TCINEYVSEIERLRLELKTSRQKDGICITQD 499

>YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}
           KIP1Kinesin-related motor protein required for mitotic
           spindle assembly, chromosome segregation, and 2 micron
           plasmid partitioning; functionally redundant with Cin8p
           for chromosomal but not plasmid functions
          Length = 1111

 Score =  349 bits (895), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 206/468 (44%), Positives = 282/468 (60%), Gaps = 78/468 (16%)

Query: 8   SGEDVEELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSK 67
           +G    + NI V VRCR RN+REI+ KSSVV+S     G   +  N +     +++   K
Sbjct: 44  NGAATSDSNIHVYVRCRSRNKREIEEKSSVVISTLGPQGKEIILSNGSHQSYSSSK---K 100

Query: 68  TYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDG 127
           TY  D+VFG  ++Q  VF   A+    + + GYNCT+  YG T TGKTYTM+GD  +  G
Sbjct: 101 TYQFDQVFGAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINIL-G 159

Query: 128 E--------LSESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIA 179
           +        L E AGIIPR+L  LF+ L    ++Y VK SF+ELYNE LKDLL DS++  
Sbjct: 160 DVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKISFLELYNENLKDLLSDSEDDD 219

Query: 180 SS-----RKLRIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPS 234
            +     R++RIFD+N                                            
Sbjct: 220 PAVNDPKRQIRIFDNN-------------------------------------------- 235

Query: 235 VTQSHQNSQDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIF 294
                    + N+ I ++ +Q+  I +A EG+ LL +G   R+VA TK ND SSRSHT+F
Sbjct: 236 ---------NNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVF 286

Query: 295 TITL------YKEY--NGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTL 346
           TIT        K++  N    ++ K+NLVDLAGSENI+RSGA+++RA+EAG IN+SLLTL
Sbjct: 287 TITTNIVEQDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTL 346

Query: 347 GRVINSLTDKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAK 406
           GRVIN+L D S H+P+RESKLTRLLQDSLGG TKT +IATISPAKI+ EET STL+YA +
Sbjct: 347 GRVINALVDHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATR 406

Query: 407 AKNIKNKPQLGSVIMKDILVKNITGELAKIKADLLSTKSKEGIYMSQD 454
           AK+IKN PQ+   + KD  +K+   E+ K++ DL ++++K+GI+++QD
Sbjct: 407 AKSIKNTPQVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQD 454

>Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W
           (REAL)
          Length = 1113

 Score =  347 bits (891), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 205/460 (44%), Positives = 276/460 (60%), Gaps = 78/460 (16%)

Query: 16  NITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVDEVF 75
           NI V VRCR RN+REI  KSSVV+S     G   +  N +     +++   KTY  D+VF
Sbjct: 52  NIHVYVRCRSRNKREIDEKSSVVISTLGPQGKEIILSNGSHQSYSSSK---KTYQFDQVF 108

Query: 76  GPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE------- 128
           G  ++Q  VF   A+    + + GYNCT+  YG T TGKTYTM+GD  +  G+       
Sbjct: 109 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINIL-GDVQSTDKL 167

Query: 129 -LSESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIA-----SSR 182
            L E AGIIPR+L  LF+ L     +Y VK SF+ELYNE LKDLL DS +       + R
Sbjct: 168 LLGEHAGIIPRVLVDLFKELSTLNREYSVKISFLELYNENLKDLLSDSDDDDPVVNDTKR 227

Query: 183 KLRIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNS 242
           ++RIFD+N                                                    
Sbjct: 228 QIRIFDNN---------------------------------------------------- 235

Query: 243 QDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITL---- 298
            + N+ I ++ +Q+  I +A EG+ LL +G   R+VA TK ND SSRSHT+FTIT     
Sbjct: 236 -NNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVE 294

Query: 299 --YKEY--NGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLT 354
              K++  N    ++ K+NLVDLAGSENI+RSGA+++RA+EAG IN+SLLTLGRVIN+L 
Sbjct: 295 QDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 354

Query: 355 DKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKP 414
           D S H+P+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET STL+YA +AK+IKN P
Sbjct: 355 DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNTP 414

Query: 415 QLGSVIMKDILVKNITGELAKIKADLLSTKSKEGIYMSQD 454
           Q+   + KD  +K+   E+ K+K DL ++++K+GI+++QD
Sbjct: 415 QVNQSLSKDTCLKDYIQEIEKLKNDLKNSRNKQGIFITQD 454

>TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7.387
           YBL063W
          Length = 1232

 Score =  338 bits (867), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 202/507 (39%), Positives = 287/507 (56%), Gaps = 75/507 (14%)

Query: 16  NITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEV----------SINTTGDVGITAQ-- 63
           NI V VRCR R +REI  KSSVV+S     G+  +          + N  G         
Sbjct: 51  NIKVYVRCRSRTQREIDEKSSVVISTLGANGNKVILSPNQSRKLYNTNANGSTRTKNNTN 110

Query: 64  ---------------INSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYG 108
                           N +TYT D+VFG  ++Q  +F+ +A+    + ++GYNCTV  YG
Sbjct: 111 LNNNIKNATTNSNTGTNGRTYTFDKVFGVESDQETLFESVAKNYIYEMLQGYNCTVFAYG 170

Query: 109 MTSTGKTYTMTGDEKLY---DGE----LSESAGIIPRILFKLF----------------- 144
            T TGKTYTM+GD  +    D +    L E AGIIPR+L  LF                 
Sbjct: 171 QTGTGKTYTMSGDLNILGNLDSKDKILLGEHAGIIPRVLVYLFKELSKNDTITNTKVNNN 230

Query: 145 ------------ETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASSRKLRIFDSNTM 192
                       E + L+  +Y VK SF+ELYNE+L DLL + +  A +   ++ +  + 
Sbjct: 231 KNNNNNSNNKNEEQINLKNTEYSVKVSFLELYNEKLTDLLSNYKTDALNSNDKLINQTSG 290

Query: 193 SAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQDQNAGIYIQ 252
           ++   S++ G               +     F  K  +   +  +S  N     + I ++
Sbjct: 291 NSTPYSITNGLNVNDKFKIKNNNLHD-----FDGKNVRIMSNQNKSASNC--NGSSITVK 343

Query: 253 NLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTI----TLYKEYNGEIF- 307
            +++ +I +A EG++LL +G   R+VA+TK+ND SSRSHTIFTI    T      G+ F 
Sbjct: 344 GMEEIYIKSAHEGLQLLTEGSLKRKVASTKLNDLSSRSHTIFTIITNVTKVDPVTGKHFV 403

Query: 308 RVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFRESKL 367
           +  K+NLVDLAGSENI+RSGA+++RA+EAG IN+SLLTLGRVIN+L D+S H+P+RESKL
Sbjct: 404 KTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDRSHHIPYRESKL 463

Query: 368 TRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKDILVK 427
           TRLLQDSLGG TKT +IAT+SPAKI+ EET STL+YA +AK+IKN PQ+   + KD  + 
Sbjct: 464 TRLLQDSLGGKTKTCIIATVSPAKISLEETVSTLEYATRAKSIKNTPQINQSLSKDTFIH 523

Query: 428 NITGELAKIKADLLSTKSKEGIYMSQD 454
               E+ +++ +L   ++KEGIY++QD
Sbjct: 524 EYINEIDRLRNELKLARTKEGIYITQD 550

>TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7.387
           YBL063W
          Length = 1142

 Score =  285 bits (729), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 191/481 (39%), Positives = 259/481 (53%), Gaps = 103/481 (21%)

Query: 16  NITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVDEVF 75
           NI V VRCR RN++EI  KSSVVVS     G+  +  N+T         N   Y  D VF
Sbjct: 9   NIKVYVRCRSRNQKEIDEKSSVVVSTLGQNGNQIIISNST---------NKNKYIFDNVF 59

Query: 76  GPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELS----- 130
           G  ++Q  +F  +A     + I GYNCT+  YG T TGKTYTM+GD  +  G+L+     
Sbjct: 60  GVESDQESIFNSVAYNYIQEMIDGYNCTLFAYGQTGTGKTYTMSGDLNII-GDLNSTKNI 118

Query: 131 ---ESAGIIPRILFKLFETLE--------LQKEDYVVKCSFVELYNEELKDLLGDSQEIA 179
              E AGIIPR+L +LF +LE           + Y VK SF+ELYNE LKDLL    ++ 
Sbjct: 119 LLGEHAGIIPRVLVQLFTSLEDSISNQKNTSVKGYTVKISFLELYNERLKDLLSADADLP 178

Query: 180 SSRKLRIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQS- 238
                     N+ S++ N                                   PSV+ + 
Sbjct: 179 P---------NSGSSSAND----------------------------------PSVSSNI 195

Query: 239 --HQNSQDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTI 296
               N    ++ I ++ +Q+  I NA EG+ LL KG   R+V +TK+ND SSRSHTIFTI
Sbjct: 196 KIFDNKDSSDSSIIVKGMQEIFIKNAMEGLNLLMKGSLQRKVKSTKLNDLSSRSHTIFTI 255

Query: 297 T-----LYKEYNGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVIN 351
           T     L  + N E  ++ K+NLVDLAGSENI++SG +  R++E G IN+SLLTLGRVIN
Sbjct: 256 TTNIIKLDNQTNKEYIKIGKLNLVDLAGSENITKSGLK--RSQETGLINKSLLTLGRVIN 313

Query: 352 SLTDKS------------------------LHVPFRESKLTRLLQDSLGGNTKTALIATI 387
           +L+DK+                         H+P+RESKLTRLLQDSLGG TKT +IATI
Sbjct: 314 ALSDKTNNTHGSNNDNNNSSSSSSISNSHHSHIPYRESKLTRLLQDSLGGMTKTCIIATI 373

Query: 388 SPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKDILVKNITGELAKIKADLLSTKSKE 447
           SPAK   +ET STL+YA +A +IKN P++         + +   ++ ++K +L ++  K 
Sbjct: 374 SPAKTCLDETISTLEYATRAMSIKNNPKINKSQNPSNFINDYINQIDRLKLELQTSTDKI 433

Query: 448 G 448
           G
Sbjct: 434 G 434

>ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL079W
           (SMY1)
          Length = 635

 Score =  191 bits (484), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 134/378 (35%), Positives = 190/378 (50%), Gaps = 69/378 (18%)

Query: 44  VTGSNEVSINTTGDVGITAQINSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCT 103
           V  ++E ++   G     A   ++ +  D VFG  A Q  VF  +AE +   F  GYN T
Sbjct: 40  VVAADEGTVEFAG-----AADEARAFRFDYVFGTDARQEEVFDYVAEEMLDQFFTGYNST 94

Query: 104 VLVYGMTSTGKTYTMTGDEKLYDGELSESAGIIPRILFKLFETLELQKE----DYVVKCS 159
           +L YG T +GK+YTM G             G+IPRI  ++FE + L K     +YVV  S
Sbjct: 95  ILAYGQTGSGKSYTMFGPPG--------HRGLIPRICQQIFERIGLLKNCADIEYVVSVS 146

Query: 160 FVELYNEELKDLLGDSQEIASSRKLRIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXEL 219
           F+E+Y E++ DLLG+S   ASS K                                    
Sbjct: 147 FLEIYLEKVYDLLGESINKASSPK------------------------------------ 170

Query: 220 PTATFLRKRWKTAPSVTQSHQNSQDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVA 279
                  K      S+T    N+     G+Y++      +++  E +  +  G   R   
Sbjct: 171 -------KNSDKRASLTVHESNT----FGVYVEGATIVSVSDGDELLNCIHLGEAQRYKG 219

Query: 280 TTKMNDFSSRSHTIFTITLYKEYN--GEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAG 337
           +T MN  SSRSH I  I L K  N  G I + S + LVDLAGSE ++++ A     +EA 
Sbjct: 220 STDMNLESSRSHAIVKINLLKRDNLEGNIQK-SDLFLVDLAGSEKVAKTNAVGATLEEAK 278

Query: 338 SINQSLLTLGRVINSLT--DKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSE 395
            IN SL +LG VIN+LT  +K  H+P+R+S+LTRLL+DSLGGN+KT LI   +  K N  
Sbjct: 279 KINLSLSSLGNVINALTQKEKRTHIPYRDSQLTRLLRDSLGGNSKTTLILNCACDKSNES 338

Query: 396 ETCSTLQYAAKAKNIKNK 413
           ET +TL++ ++AK+IKNK
Sbjct: 339 ETLTTLRFGSRAKHIKNK 356

>Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar to
           Ashbya gossypii ADR145C
          Length = 662

 Score =  191 bits (485), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 140/409 (34%), Positives = 212/409 (51%), Gaps = 69/409 (16%)

Query: 16  NITVAVRCRGRNEREIKAKSSVVVSVPDVT---GSNEVSINTTGDVGITAQINSKTYTVD 72
           N+ V VR +  +  E K  +  VV++ + T    +N+ S  +T   G+  +  S+++  D
Sbjct: 34  NVKVMVRLKPIDAPE-KQYNVAVVALDESTVEFPNNDTSPGSTN--GVQGESPSRSFHFD 90

Query: 73  EVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSES 132
            VFG ++ Q  V+  +AE +   F  GYN T+L YG T +GK+YTM G          ++
Sbjct: 91  YVFGTNSTQDDVYDFVAEEMLDQFFTGYNSTILAYGQTGSGKSYTMFGP--------IDN 142

Query: 133 AGIIPRILFKLFETLELQKE----DYVVKCSFVELYNEELKDLLGDSQEIASSRKLRIFD 188
            G+IPRI  ++FE + L K     +YVV  SF+E+Y E++ DLLG+S   ++S       
Sbjct: 143 RGLIPRICHEIFERIGLLKSSADIEYVVSVSFLEIYLEKVYDLLGESINKSAS------- 195

Query: 189 SNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQDQNAG 248
                                          P  T  ++   T       H++S     G
Sbjct: 196 -------------------------------PKKTSEKRTSLTI------HESS---TFG 215

Query: 249 IYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGE-IF 307
           +Y+Q+     +++  E +  +  G   R  ++T MN  SSRSH I  I L K  N E   
Sbjct: 216 VYVQSATVISVSDGDELLHCIHLGESQRCKSSTDMNFESSRSHAIVKINLLKRDNLEGSI 275

Query: 308 RVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKS---LHVPFRE 364
           + S + LVDLAGSE +S++ A     +EA  IN SL +LG VIN+LT K     H+P+R+
Sbjct: 276 QKSDLFLVDLAGSEKVSKTNAVGATLEEAKKINLSLSSLGNVINALTQKDKKRTHIPYRD 335

Query: 365 SKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNK 413
           S+LTRLL+DSLGGN+KT LI   +  K N  ET +TL++ ++AK I+NK
Sbjct: 336 SQLTRLLRDSLGGNSKTTLILNCACDKSNEAETLTTLRFGSRAKQIENK 384

>KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 668

 Score =  168 bits (425), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 111/353 (31%), Positives = 178/353 (50%), Gaps = 67/353 (18%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           +  D VF P  N   V++ +A P+     +G+NCT+  YGMT +GKTYTM+G +      
Sbjct: 106 FNFDHVFSPEMNNDRVYETMALPMIDKLFEGFNCTIFAYGMTGSGKTYTMSGSK------ 159

Query: 129 LSESAGIIPRILFKLFETLE--LQKEDYVVKCSFVELYNEELKDLLGDSQEIASSRKLRI 186
                GIIP  +  +F+ +   L ++ + V+ S++E+YNE + DLL   Q        + 
Sbjct: 160 --SGPGIIPMCVDTIFDRINVGLPRKKFTVRVSYLEIYNERIFDLLNLPQG-------KT 210

Query: 187 FDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQDQN 246
            +SN M                          +P++T            T   +   D  
Sbjct: 211 LNSNIM--------------------------VPSSTL-----------TNDLKLRDDLK 233

Query: 247 AGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLY--KEYNG 304
            G+ +  L + ++++ KE +K +  G  +R+   T  N  SSRSH +  I ++   E  G
Sbjct: 234 YGVKVVGLVERNVSSNKELMKCISIGDHNRKTGETDFNTRSSRSHAVVLIRVFCTDEITG 293

Query: 305 EIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSL------ 358
           E   +S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+ +S       
Sbjct: 294 EQV-MSTLSLCDLAGSE---RATGQQERRKEGAYINKSLLALGTVISKLSMESSGLSTNV 349

Query: 359 -HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNI 410
            H+P+R+SKLTR+LQ +L G++  A I T+      S E+ +T+++A++AKNI
Sbjct: 350 GHIPYRDSKLTRILQPALSGDSLVATICTVDTRPETSTESINTIRFASRAKNI 402

>KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {ON}
           Anc_8.678 YPL155C
          Length = 658

 Score =  157 bits (398), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 127/414 (30%), Positives = 188/414 (45%), Gaps = 90/414 (21%)

Query: 61  TAQINSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTG 120
           T   N+  Y  D VF P  +   +++  A PL      G+N T+  YGMT +GKTYTM G
Sbjct: 125 TINTNNDEYKFDHVFSPHVDNFEIYKTTAIPLIDKLFTGFNATLFCYGMTGSGKTYTMMG 184

Query: 121 DEKLYDGELSESAGIIPRILFKLFETLELQKED--YVVKCSFVELYNEELKDLLGDSQEI 178
           D +  DG       I+P  +  LF  +   + D  Y V  S++E+YNE++ DLL D +  
Sbjct: 185 DNENPDG-------IVPLSVSLLFNQVLNSRNDKKYDVILSYLEIYNEKIYDLLDDDR-- 235

Query: 179 ASSRKLRIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQS 238
                            TN + T                          R+ + PS   S
Sbjct: 236 -----------------TNHLLTPS------------------------RFTSTPSRLNS 254

Query: 239 HQ--NSQDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTI 296
            +     D   G+ I  L +     ++E +K ++ G  +R+ + T+ N  SSRSH +  +
Sbjct: 255 SELRIRDDLEYGVKITGLNEERCDTSQELMKWIKYGDSNRKTSETEYNLRSSRSHAVILV 314

Query: 297 TLYKEYNGEIFRVSK-MNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTD 355
            L      +  + S  + L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+ 
Sbjct: 315 RLVTHNVIDGSKTSSTLTLCDLAGSE---RAAGQQERRKEGAFINKSLLALGTVISKLSA 371

Query: 356 KSL------------------------HVPFRESKLTRLLQDSLGGNTKTALIATISPAK 391
           +SL                        H+P+R+SKLTRLLQ +L GN+    I TI P  
Sbjct: 372 ESLSNSKHVSNPMGPPASPSLNSNGNNHIPYRDSKLTRLLQPALSGNSAVTTICTIDPRM 431

Query: 392 INSEETCSTLQYAAKAKNI-------KNKPQLG-SVIMKDILVKNITGELAKIK 437
               ET +TL++A++AKN+       KN   +  S + KD ++K +T  L K K
Sbjct: 432 ETYAETINTLRFASRAKNVSLRFNIKKNLSTISKSEVEKDKIIKELTFRLEKQK 485

>Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON}
           (54983..56503) [1521 nt, 507 aa]
          Length = 506

 Score =  154 bits (389), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 123/370 (33%), Positives = 171/370 (46%), Gaps = 94/370 (25%)

Query: 72  DEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSE 131
           DE FG   +QS  ++        D + GYNC +L YG T +GKTYTM G+ K      ++
Sbjct: 64  DEGFGKINSQSEFYKGSINHFVKDALNGYNCCILAYGQTGSGKTYTMMGESK------ND 117

Query: 132 SAGIIPRILFKLFETLE----------LQKEDYVVKCSFVELYNEELKDLLGDSQEIASS 181
           + G+IPR    LF  +E           Q+ +Y V CS  E+YNE++ DLL +  E+ S 
Sbjct: 118 TRGVIPRFCEDLFHEIESIKIKDSSDLSQRSEYKVVCSIFEIYNEQIIDLL-EMNEVQSC 176

Query: 182 RKLRIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQN 241
            K R+ ++                                    R R     ++T+   +
Sbjct: 177 SKYRVREN------------------------------------RDRSMYIENITEIEVS 200

Query: 242 SQDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYK- 300
           + DQ             I   K G        ++R   +T MN  SSRSH I +IT+ + 
Sbjct: 201 NIDQ------------MIKCVKMG-------FRNRTTRSTNMNVNSSRSHAIVSITIKRT 241

Query: 301 ----EYNGEIFRVSKMNLVDLAGSENISRSGAQHQ-RAKEAGSINQSLLTLGRVINSLTD 355
                 N  I   S    VDLAGSE  + +   H  R KE  SIN+SL TL RV+ SL  
Sbjct: 242 DIDLNTNSSIISDSICRFVDLAGSERSTATQNCHNDRLKEGNSINKSLSTLRRVLTSLKK 301

Query: 356 K--------------SLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTL 401
           +              ++ VPFRES LT +L+D+LGGN+KT +IA ISP   N EE+ STL
Sbjct: 302 REELKYNSNSNSSAHNIVVPFRESLLTWILKDNLGGNSKTCIIACISPT--NFEESASTL 359

Query: 402 QYAAKAKNIK 411
           +YA  A+ IK
Sbjct: 360 RYADIAQTIK 369

>Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C
           (KIP2) - kinesin-related protein [contig 68] FULL
          Length = 715

 Score =  156 bits (394), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 149/560 (26%), Positives = 246/560 (43%), Gaps = 104/560 (18%)

Query: 25  GRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVDEVFGPSANQSLV 84
           G N ++ +   SV + +   T +N  +     D    A  +   +  D VF P +N   V
Sbjct: 96  GENSQQYRGAISVSIRLKP-TDANAKNPWFVSDEQTIAHNDVGEFKFDNVFRPQSNNYEV 154

Query: 85  FQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSESAGIIPRILFKLF 144
           +Q+I +P+     +GYN  +  YGMT +GKT+TM+G          E AG+I   +  +F
Sbjct: 155 YQQIGKPMIDRLFQGYNAIIFAYGMTGSGKTFTMSGT--------PEEAGLISLSVEHIF 206

Query: 145 ETL---ELQKEDYVVKCSFVELYNEELKDLLGDSQEIASSRKLRIFDSNTMSAATNSMST 201
             +    L  + + V  S++E+YNE++ DLL  S   +          +  S  T++  T
Sbjct: 207 AQIMSESLANKSFQVTVSYLEIYNEKIYDLLNQSSLKSPGGGSGGGYGSFSSKPTHAAGT 266

Query: 202 GXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQDQNAGIYIQNLQDFHITN 261
                           ELP                       D   G+ +  L +  + +
Sbjct: 267 ----------------ELPV--------------------RDDSKHGVRVMGLTEQRVYS 290

Query: 262 AKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLY-KEYNGEIFRVSKMNLVDLAGS 320
           +++ +K +  G  +R+   T  N  SSRSH I T+ L   +        S ++L DLAGS
Sbjct: 291 SEDVLKWISLGDTNRRTGETDYNTRSSRSHAIVTLNLACTDLVSGAETTSTLSLCDLAGS 350

Query: 321 ENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLH---------VPFRESKLTRLL 371
           E   R+  QH+R KE   IN+SLL LG VI+ L+  S+H         +P+R+SKLTR+L
Sbjct: 351 E---RAAGQHERRKEGAFINKSLLALGTVISKLSASSMHTTPSFGNSHIPYRDSKLTRIL 407

Query: 372 QDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNI-----KNKPQLGSVIMKDILV 426
           Q +L G +    I TI        ET +T+++A++AKN+     +N+ +L     KD L+
Sbjct: 408 QPALSGESIVTTICTIDTRLDAMSETVNTIRFASRAKNVSMTVKRNEAELAH--EKDALI 465

Query: 427 KNITGELAKIKADLLSTKSKEGIYMSQDNYK--ELTNDLESYKTEVKECKRAIETLTSQN 484
            N+  +L          + +E I+  + N +  E T DL   + E    KR ++      
Sbjct: 466 HNLRRQL---------DEQQELIWELKRNQEKCEQTPDLYLLRKESDALKRKLQLC---E 513

Query: 485 TLLLKDKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGTMQ 544
            LL KD+ A   V D Q +++  M                      A  + L++ +  +Q
Sbjct: 514 RLLDKDEAA---VQDDQLVEIVEMLPP-------------------AVGALLESKIQGLQ 551

Query: 545 SIIKEHERRERDIESKMGDL 564
           S ++ H      +E ++ DL
Sbjct: 552 SQLRSHRDYSSQLERQLSDL 571

>ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {ON}
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 778

 Score =  155 bits (393), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 112/356 (31%), Positives = 172/356 (48%), Gaps = 77/356 (21%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           +  D +F   + Q  V++    PL    + G+N TV  YG T  GKTYT++G        
Sbjct: 128 FVFDRLFDVDSTQKDVYESTMIPLLDSVLDGFNGTVFAYGATGCGKTYTISGS------- 180

Query: 129 LSESAGIIPRILFKLFETLELQKED--YVVKCSFVELYNEELKDLLGDSQEIASSRKLRI 186
             E+ GII + + +LF  +E  K+   + +  SF+E+YNE ++DLL       SS+KL I
Sbjct: 181 -PENPGIIFQAMQELFNRIENLKDTKHFELSLSFLEIYNESIRDLLCPE---TSSKKLVI 236

Query: 187 FDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQDQN 246
            + +  S   +++                                      SH N Q   
Sbjct: 237 LEDSNESIRVSNL--------------------------------------SHYNPQK-- 256

Query: 247 AGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEI 306
               ++++ D  I           KG  +R  + T  N+ SSRSH +  I + +      
Sbjct: 257 ----VEDVMDLVI-----------KGNMNRTTSATDANEASSRSHAVLQIHIMQHNRTAD 301

Query: 307 FR----VSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSL-----TDKS 357
            +     + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L     T +S
Sbjct: 302 LKSDHTFATLSIIDLAGSERAATTKNRGNRLYEGANINRSLLALGNCINALCLNDGTRRS 361

Query: 358 LHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNK 413
            HVP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 362 CHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLKYANRAKEIKTK 417

>Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON}
           (11880..13742) [1863 nt, 621 aa]
          Length = 620

 Score =  153 bits (387), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 112/357 (31%), Positives = 176/357 (49%), Gaps = 76/357 (21%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           YT D VF P A+   V+    +PL      G+N TV  YGMT +GKTYTM+G     DG 
Sbjct: 104 YTYDNVFHPDASNFDVYAATCKPLIDKLFDGFNSTVFAYGMTGSGKTYTMSG----VDG- 158

Query: 129 LSESAGIIP----RILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASSRKL 184
              +AG+IP     +  K+F++   + + Y    S++E+YNE                  
Sbjct: 159 ---NAGLIPLSVAYMYSKIFDSTIHENKKYDTLVSYLEIYNE------------------ 197

Query: 185 RIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQD 244
           +I+D                              L    F  K  +++ +V +  +   D
Sbjct: 198 KIYD------------------------------LLETDFDPKPLRSSIAVPE-LKIRDD 226

Query: 245 QNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKE--Y 302
            N G+ +  L +    + +E +  ++ G KHR+ ++T  N  SSRSH I  I L      
Sbjct: 227 PNYGVRVIGLTEKRCQSHEELLNWIKLGDKHRKTSSTDFNTRSSRSHAIILIRLISSDLS 286

Query: 303 NGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDK------ 356
           +GE+   S ++L DLAGSE ++   AQH+R +E   IN+SLL LG VI+ L+ +      
Sbjct: 287 SGEVV-TSTLSLCDLAGSERVT---AQHERRQEGSFINKSLLALGTVISKLSAEVNNSTE 342

Query: 357 ---SLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNI 410
              + H+P+R+SKLTR+LQ +L GN+    I TI  +   + E+ +TL++A++AKN+
Sbjct: 343 SVNNSHIPYRDSKLTRILQPALSGNSIVTTICTIDTSVDATNESVNTLRFASRAKNV 399

>Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  154 bits (390), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 111/356 (31%), Positives = 177/356 (49%), Gaps = 78/356 (21%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           +  D++F  +++QS V+++   PL    + G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQSRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 129 LSESAGIIPRILFKLFETL-ELQKE-DYVVKCSFVELYNEELKDLLGDSQEIASSRKLRI 186
                GII   + +LF  + +L+ E ++ +  S++E+YNE ++DLL        S++L I
Sbjct: 206 -PSQPGIIFLAMEELFNKIADLRDEKNFEISLSYLEIYNERIRDLLKPE---TPSKRLVI 261

Query: 187 FDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQDQN 246
            +                                               TQSH       
Sbjct: 262 RED----------------------------------------------TQSH------- 268

Query: 247 AGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEI 306
             I + NL   H T  ++ + L+ +G  +R  + T+ N+ SSRSH +  I +  + N  +
Sbjct: 269 --IKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIM-QTNKLV 325

Query: 307 FRVSK-----MNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLT----DKS 357
              S+     ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L      +S
Sbjct: 326 DLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRS 385

Query: 358 LHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNK 413
            H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 386 CHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

>KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 678

 Score =  151 bits (382), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 107/362 (29%), Positives = 171/362 (47%), Gaps = 71/362 (19%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           +  D+VF P  N   V+++I +P+     +GYN T+  YGMT +GKT+TM+G        
Sbjct: 140 FWFDKVFSPQTNNYGVYEEIGKPMIDKLFQGYNATIFAYGMTGSGKTFTMSGTR------ 193

Query: 129 LSESAGIIPRILFKLFETL---ELQKEDYVVKCSFVELYNEELKDLLGDSQEIASSRKLR 185
             + AG+I   + ++F  +    +  + Y V+ S++E+YNE++ DLL             
Sbjct: 194 --DEAGLILLSVEQIFSQIMKESVNNKSYEVRVSYLEIYNEKIYDLL------------- 238

Query: 186 IFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQDQ 245
               N  SA +                       P  T+   + K  P          D 
Sbjct: 239 ----NYPSAKS-----------------------PGGTYGSFQSKNVPGAGAELPVRDDA 271

Query: 246 NAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLY-KEYNG 304
             G+ +  L +  + ++++ ++ ++ G  +R+   T  N  SSRSH I TI +   E   
Sbjct: 272 RHGVRVVGLTEQQVHSSEDVLRKIELGNSNRRTGETDYNTRSSRSHAIVTIKVTCTELLS 331

Query: 305 EIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKS------- 357
                S ++L DLAGSE   R+  QH+R KE   IN+SLL LG VI+ L+  S       
Sbjct: 332 GTDTTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSAVSGASGGGA 388

Query: 358 ---------LHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAK 408
                     HVP+R+SKLTR+LQ +L G++    I TI        ET +T+++A++AK
Sbjct: 389 ATPPPTFGNSHVPYRDSKLTRILQPALSGDSIVTTICTIDTKPDAMSETVNTIRFASRAK 448

Query: 409 NI 410
           N+
Sbjct: 449 NV 450

>SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 809

 Score =  152 bits (385), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 109/355 (30%), Positives = 175/355 (49%), Gaps = 76/355 (21%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           +  D++F   A Q+ V++    PL    + G+N TV  YG T  GKT+T++G        
Sbjct: 136 FVFDKLFDEDATQTEVYESTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISG-------- 187

Query: 129 LSESAGIIPRILFKLFETLELQKED--YVVKCSFVELYNEELKDLLGDSQEIASSRKLRI 186
             E  G+I   + +LF+ +E  K+   + +  S++E+YNE ++DLL  S +I SS+KL I
Sbjct: 188 TPEQPGVIFLTMQELFQRIEDLKDSKHFDLTLSYLEIYNESIRDLL--SPDI-SSKKLVI 244

Query: 187 FDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQDQN 246
            + +    +  ++                                      SH   Q   
Sbjct: 245 REDSIKGISVANL--------------------------------------SHHTPQ--- 263

Query: 247 AGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYN--- 303
               +Q++ D           L+ +G  +R  + T  N+ SSRSH +  I + ++     
Sbjct: 264 ---TVQDVMD-----------LVVRGNMNRTTSPTDANETSSRSHAVLQINVVQKNRTAE 309

Query: 304 -GEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLT----DKSL 358
             E    + ++++DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L       + 
Sbjct: 310 LSEAHTFATLSIIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRRSTC 369

Query: 359 HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNK 413
           HVP+R+SKLTRLL+ SLGGN KT +I  I+P+  + +ET +TL+YA +AK IK K
Sbjct: 370 HVPYRDSKLTRLLKFSLGGNCKTVMIVCIAPSSAHYDETLNTLKYANRAKEIKTK 424

>TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.678
           YPL155C
          Length = 696

 Score =  149 bits (376), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 112/399 (28%), Positives = 189/399 (47%), Gaps = 72/399 (18%)

Query: 37  VVVSV-PDVTGSNEVSINTTGDVGITAQINSKTYTVDEVFGPSANQSLVFQKIAEPLFAD 95
           ++V++ P    +NE  +    D    A  +   + +D +F    +   ++ ++ +PL   
Sbjct: 76  IIVAIRPKPISNNEKKVWNIVDNKRIAHDDVGEFRLDRIFDCDVSNLEIYSELCKPLIDK 135

Query: 96  FIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSESAGIIPRILFKLFETLE----LQK 151
              GYN T+  YGMT +GKT+TM+G +        E  G+IP  +  LF T+     L K
Sbjct: 136 LAMGYNATLFAYGMTGSGKTFTMSGTQ--------EDTGLIPLSISHLFNTINEENLLGK 187

Query: 152 EDYVVKCSFVELYNEELKDLLGDSQEIASSRKLRIFDSNTMSAATNSMSTGXXXXXXXXX 211
           + Y +  S++E+YNE+L DLL  + E  +      + SN  +                  
Sbjct: 188 KKYEMLVSYMEIYNEKLYDLLDTNVEGVNFG----YSSNLQTPP---------------- 227

Query: 212 XXXXXXELPTATFLRKRWKTAPSVTQSHQNSQDQNAGIYIQNLQDFHITNAKEGIKLLQK 271
                           R+  + +  Q  +   D   GI +  L +   ++  + +K ++ 
Sbjct: 228 ----------------RFGNSFNSAQDLRIRDDAQYGIKVVGLSEHRCSSKDDLMKWVRI 271

Query: 272 GLKHRQVATTKMNDFSSRSHTIFTITLYK-EYNGEIFRVSKMNLVDLAGSENISRSGAQH 330
           G K+++++ T+ N  SSRSH+I  + L   +    I   S ++L DLAGSE   ++ +Q 
Sbjct: 272 GDKNKKISETEYNSRSSRSHSILLVRLIATDLETGIVTTSTLSLCDLAGSE---KATSQQ 328

Query: 331 QRAKEAGSINQSLLTLGRVINSLTDKS-------------------LHVPFRESKLTRLL 371
           +R KE   IN+SLL LG VI  L+ +S                    H+P+R+SKLTR+L
Sbjct: 329 ERRKEGAFINKSLLALGTVIAKLSSESNQHRNADNVNHQETSNPNNSHIPYRDSKLTRIL 388

Query: 372 QDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNI 410
           Q +L GN+    I T+      S ET +TL++A++AKN+
Sbjct: 389 QPALSGNSIITTICTVDIRSDASSETLNTLRFASRAKNV 427

>NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {ON}
           Anc_3.479 YPR141C
          Length = 698

 Score =  149 bits (375), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 132/426 (30%), Positives = 196/426 (46%), Gaps = 80/426 (18%)

Query: 3   AMPQASGEDVEELNITVAVRCRGRNE-REIKAKSSVVVSVPDVTGSNEVSINTTGDV--G 59
            M ++   +++EL   + V CR R     I++K +  + V D    N +    + +V  G
Sbjct: 333 TMRRSLHNELQELRGKIRVYCRIRPPLPNIESKDTAHIKVEDFDDDNGIQ---SMEVMKG 389

Query: 60  ITAQINSKT-----YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGK 114
           I    N+ T     +  D++F  +   + VF+++ + L    + GYN  +  YG T +GK
Sbjct: 390 IEVNNNNATQIPQRFKFDKIFNQTDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGK 448

Query: 115 TYTMTGDEKLYDGELSESAGIIPRILFKLFETLELQKE---DYVVKCSFVELYNEELKDL 171
           TYTM          L    GIIP  +  +F   +  KE    Y + C FVE+YNE + DL
Sbjct: 449 TYTM----------LRPKDGIIPSTIKHIFNWTKNLKERGWHYEIDCQFVEIYNENIIDL 498

Query: 172 LGDSQEIASSRKLRIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKT 231
           L  S    S+   R  DSN                            +PT          
Sbjct: 499 LRSS----SNDDTRNIDSN----------------------------IPTK--------- 517

Query: 232 APSVTQSHQNSQDQ-NAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRS 290
                  H+   DQ N    I N+   ++ + +    +L++  K R  A+T  N+ SSRS
Sbjct: 518 -------HEIRHDQENRNTTITNIVTRNLDSEETADNILKRANKLRSTASTGSNEHSSRS 570

Query: 291 HTIFTITLY--KEYNGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGR 348
           H+IF I L       GE      +NLVDLAGSE I+ S     R +E  +IN+SL  LG 
Sbjct: 571 HSIFIIHLRGSNSLTGE-ESYGILNLVDLAGSERINSSQVTGDRLRETQNINRSLSCLGD 629

Query: 349 VINSLTDK---SLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAA 405
           VI++L        H+PFR SKLT LLQ SL GN+KT +   ISP+  +  ET ++L++A+
Sbjct: 630 VIHALGGPDQGKRHIPFRNSKLTYLLQYSLTGNSKTLMFVNISPSANHINETINSLRFAS 689

Query: 406 KAKNIK 411
           K  + K
Sbjct: 690 KVNSTK 695

>TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {ON}
           Anc_3.528 YGL216W
          Length = 847

 Score =  149 bits (377), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 109/356 (30%), Positives = 175/356 (49%), Gaps = 77/356 (21%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           +  D++F  +ANQ+ V+      L    + G+N TV  YG T  GKT+T++G        
Sbjct: 128 FVFDKLFDETANQTNVYNSTTSSLLDSVLDGFNGTVFAYGATGCGKTFTISG-------- 179

Query: 129 LSESAGIIPRILFKLFETLELQKE--DYVVKCSFVELYNEELKDLLGDSQEIASSRKLRI 186
             E  GII   + +LF+ +E  K+  +  +  S++E+YNE ++DLL  +    SS+KL I
Sbjct: 180 TPEQPGIIFLTMDELFKRIESLKDTKNIELTLSYLEIYNETIRDLLNPN---VSSKKLVI 236

Query: 187 FDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQDQN 246
            + +      +++                                      SH   Q   
Sbjct: 237 REDSDQKITVSNL--------------------------------------SHHKPQT-- 256

Query: 247 AGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYK-EYNGE 305
               +Q + DF I           +G  +R  + T  N+ SSRSH +  I + + +   +
Sbjct: 257 ----VQEVMDFVI-----------RGNMNRTTSPTDANETSSRSHAVLQIHIAQTDRTPD 301

Query: 306 IFR---VSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSL-----TDKS 357
           +      + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L     T ++
Sbjct: 302 LISNSTFATLSIIDLAGSERAASTKNRGERLIEGANINKSLLALGNCINALCISDGTRRT 361

Query: 358 LHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNK 413
            HVP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL YA +AK+IK K
Sbjct: 362 CHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLTYANRAKDIKTK 417

>CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa]
           {ON} similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155c KIP2 kinesin-related protein
          Length = 672

 Score =  148 bits (374), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 116/373 (31%), Positives = 180/373 (48%), Gaps = 83/373 (22%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           +T D VF    +   ++ K  +PL    I+GYN T+  YGMT +GKT+TM+G E      
Sbjct: 133 FTFDHVFSTGCSNFDIYGKTTQPLIDRLIEGYNATIFAYGMTGSGKTFTMSGTE------ 186

Query: 129 LSESAGIIPRILFKLFETL----ELQKEDYVVKCSFVELYNEELKDLLGDSQEIASSRKL 184
             E  G+IP  +  LF +L      + E   V  S++E+YNE++ DLL    ++AS   +
Sbjct: 187 --EEKGLIPLSVSYLFSSLLEKTNTENEKSEVWVSYLEIYNEKINDLL----DVASGSNV 240

Query: 185 RIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQD 244
           +   S   ++ T++ S+G                      L+ R               D
Sbjct: 241 QNTPSRLFTS-THTSSSGD---------------------LKIR--------------DD 264

Query: 245 QNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKE--Y 302
              G+ +  L       ++E +  + KG K+R+ + T+ N  SSRSH I  I L  +   
Sbjct: 265 SECGVRVVGLTQKRCDTSEEVLDWINKGNKNRKTSETEFNTRSSRSHAIVMIRLISKDIR 324

Query: 303 NGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLT-------- 354
            GE   +  ++L DLAGSE   R   Q++R KE   IN+SLL LG VI+ L+        
Sbjct: 325 TGEQ-NIRTLSLCDLAGSE---RGVGQNERRKEGAFINRSLLALGTVISRLSAENNGSHH 380

Query: 355 -------DKSL----------HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEET 397
                   +SL          H+P+R+SKLTRLLQ +L G++    + TI  A  +S ET
Sbjct: 381 TGRAANSQQSLASPNGSSSGNHIPYRDSKLTRLLQPALSGDSVVVALCTIDLAHESSSET 440

Query: 398 CSTLQYAAKAKNI 410
            +TL++A+++KN+
Sbjct: 441 LNTLRFASRSKNV 453

>Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON}
           (11134..13554) [2421 nt, 807 aa]
          Length = 806

 Score =  149 bits (376), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 110/358 (30%), Positives = 174/358 (48%), Gaps = 81/358 (22%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           +  D++F   ++Q  V++     L    + G+N TV  YG T  GKTYT++G        
Sbjct: 146 FIFDKLFNEGSSQLAVYRSTTSLLLDSVLDGFNGTVFAYGATGCGKTYTISGT------- 198

Query: 129 LSESAGIIPRILFKLFETLELQKE--DYVVKCSFVELYNEELKDLLGDSQEIASSRKLRI 186
             E  GII   + +LF+ +E  K+  ++ +  S++E+YNE ++DLL        S+KL I
Sbjct: 199 -PEQPGIIFLAMEELFQKIENIKDTKNFELTLSYLEIYNESIRDLLNPD---TPSKKLVI 254

Query: 187 FDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQDQN 246
            + N                           ++  A     R KT               
Sbjct: 255 REDN-------------------------ESKISVANLSHHRPKT--------------- 274

Query: 247 AGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKE----- 301
               +Q++ D           L+ KG  +R  + T  N+ SSRSH +  I + +      
Sbjct: 275 ----VQDVMD-----------LIIKGNINRTTSATDANETSSRSHAVLQIHISQTNRTVD 319

Query: 302 -YNGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSL-----TD 355
             +  +F  + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L     T 
Sbjct: 320 LTSSHVF--ATLSIIDLAGSERAASTKNRGERLYEGANINKSLLALGNCINALCLNDGTR 377

Query: 356 KSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNK 413
           +S HVP+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK IK K
Sbjct: 378 RSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKTK 435

>SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {ON}
           similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155C KIP2 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 657

 Score =  146 bits (369), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 121/443 (27%), Positives = 206/443 (46%), Gaps = 81/443 (18%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           ++ D VF P+ +   V+++ A P+     +G+N T+  YGMT +GKT+TM+G        
Sbjct: 147 FSFDHVFHPTNDNFAVYEETARPMIEKLFQGFNSTIFAYGMTGSGKTFTMSGT------- 199

Query: 129 LSESAGIIPRILFKLFETL---ELQKEDYVVKCSFVELYNEELKDLLGDSQEIASSRKLR 185
            S   G+IP  +  +F  +    L  + + VK S++E+YNE                  +
Sbjct: 200 -SNEPGLIPLSVNDIFSNIMSKSLNNQRFDVKVSYLEIYNE------------------K 240

Query: 186 IFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQDQ 245
           I+D      +  S  T                   T   L+ R               D 
Sbjct: 241 IYDLLNYQVSKGSFGTKT-----------------TGIELKIR--------------DDS 269

Query: 246 NAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLY-KEYNG 304
             G+ +  L +  +  +++ +K +  G  +R+   T  N  SSRSH I  I L   +   
Sbjct: 270 KYGVKVIGLTEQEVDTSEDVMKWIALGNSNRKTGETDFNSRSSRSHAIVLIRLTCTDLKS 329

Query: 305 EIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSL------ 358
            +   S ++L DLAGSE   R+ AQ +R KE   IN+SLL LG VI+ L+ +S       
Sbjct: 330 GLETTSTLSLCDLAGSE---RATAQRERRKEGAFINKSLLALGTVISKLSAESTQNMGVG 386

Query: 359 ---HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIK---N 412
              H+P+R+SKLTR+LQ +L G+     I T+     +S ET +T+++A++AKNI     
Sbjct: 387 GGHHIPYRDSKLTRILQPALSGDGIVTTICTVDAHAESSAETINTIRFASRAKNISLVVK 446

Query: 413 KPQLGSVIMKDILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEVKE 472
           + ++     KD +++N+  +L +    +   KS  G   + D     + D  S ++E K 
Sbjct: 447 RNEMDISNEKDHIIENLRRQLEQQNETIAVLKSNNGTCRTTD--AGASEDALSLQSENKV 504

Query: 473 CKRAI---ETLTSQNTLLLKDKK 492
            K  +   E L  +++++L+D++
Sbjct: 505 LKLRLEHCEKLLDKDSMILQDQE 527

>ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 654

 Score =  144 bits (363), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 118/373 (31%), Positives = 177/373 (47%), Gaps = 69/373 (18%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           +  D VF  + N   V+ + ++P+     +G N TV  YGMT +GKT+TM G E      
Sbjct: 122 FKYDHVFKTACNNVEVYAQTSKPMIDRVFEGLNATVFAYGMTGSGKTFTMAGTE------ 175

Query: 129 LSESAGIIPRILFKLFETL---ELQKED-YVVKCSFVELYNEELKDLLGDSQEIASSRKL 184
             E+ G+IP  +  L+  +    LQ +  + +  S++E+YNE++ DLL    E+    K 
Sbjct: 176 --ETLGLIPLSVAYLYSRVMEESLQGDSRFEIAVSYLEIYNEKIYDLLDCENEL----KP 229

Query: 185 RIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQD 244
               S+ M A   + S+                + P    LR                +D
Sbjct: 230 TAATSSRMFAHMGTRSS----------------KTPVELKLR----------------ED 257

Query: 245 QNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNG 304
              G+ I  L +    ++ E +K ++ G K R+   T  N  SSRSH I  I L K    
Sbjct: 258 SKYGVKIVGLTERRCESSDELLKWIRIGDKSRKTGETTYNTRSSRSHAIVMIRLTKTDLK 317

Query: 305 EIFRVSK-MNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSL----- 358
           E   VS  ++L DLAGSE   ++   ++R KE   IN+SLL LG VI+ L+ +S      
Sbjct: 318 EGTSVSSTLSLCDLAGSE---KAVTHNERRKEGAFINKSLLALGTVISKLSAESTSHRNG 374

Query: 359 --------HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNI 410
                   H+P+R+SKLTR+LQ +L GN     I TI      S ET +TL++A++AKN+
Sbjct: 375 GSSSPVTGHIPYRDSKLTRILQPALSGNGVVTTICTIDTRPDASSETLNTLRFASRAKNV 434

Query: 411 K----NKPQLGSV 419
                 KP L S+
Sbjct: 435 SLHIFRKPLLPSM 447

>TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON}
           Anc_8.678 YPL155C
          Length = 637

 Score =  143 bits (361), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 132/457 (28%), Positives = 217/457 (47%), Gaps = 85/457 (18%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           +T D VF  +     +++  + P+    ++G+N TV  YGMT +GKT+TMTG E      
Sbjct: 112 FTFDRVFPANCTNLDIYEASSRPMIDKLLQGFNATVFAYGMTGSGKTFTMTGTE------ 165

Query: 129 LSESAGIIP----RILFKLFETLELQKEDYVVKCSFVELYNEELKDLLG-DSQEIASSRK 183
             + AG+IP     +  K+ E        Y V  S++E+YNE++ DLL  +S+   +S  
Sbjct: 166 --DEAGLIPLSVTYLFSKILEHSMRGTSKYEVVVSYLEIYNEKIYDLLDCESENKFNSTP 223

Query: 184 LRIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQ 243
            R+F S T  ++   +                         LR R               
Sbjct: 224 SRMFLSGTPRSSGGPVE------------------------LRIR--------------D 245

Query: 244 DQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKE-- 301
           D   G+ I  L +    +++E  + +Q G K+R+ + T  N  SSRSH I  + L     
Sbjct: 246 DLKYGVRITGLTEKRCESSEELSRWIQIGDKNRKTSETIYNTRSSRSHAIVLVRLNNTDL 305

Query: 302 YNGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVI----------- 350
            +GE    S ++L DLAGSE   ++ +Q++R KE   IN+SLL LG VI           
Sbjct: 306 RSGETVS-STLSLCDLAGSE---KAVSQYERRKEGAFINKSLLALGTVISKLSSESLSKN 361

Query: 351 -------NSLTDKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQY 403
                   + T+ + H+P+R+SKLTR+LQ +L GN+    I TI      + ET +T+++
Sbjct: 362 GPPTFTSTNPTEPNTHIPYRDSKLTRILQPALSGNSIITTICTIDTRNEAASETVNTIRF 421

Query: 404 AAKAKN----IKNKPQL--GSVIMKDILVKNITGELAKIKADLLSTKSKEGIYMSQ---D 454
           A++AKN    +  +P +  GS   KD  ++N+T +L K    ++  K +  +  S    D
Sbjct: 422 ASRAKNVTLQVAKRPAVGTGSYNEKDQTIENLTQQLEKQHQLVMRLKQRTSMTSSSHNDD 481

Query: 455 NYKELTNDLESYKTEVKECKRA-IETLTSQNTLLLKD 490
           +  +  + L   +  V +CK +  E L  ++T+ L+D
Sbjct: 482 STVDPNSTLLKAENRVLKCKLSNCEKLLDKDTIELED 518

>Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {ON}
           YPL155C (REAL)
          Length = 706

 Score =  144 bits (362), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 112/378 (29%), Positives = 173/378 (45%), Gaps = 83/378 (21%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           +  D VF        V+++  +P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTGKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 129 LSESAGIIPRILFKLFETLELQKED----YVVKCSFVELYNEELKDLLGDSQEIASSRKL 184
           L    G+IP  +  LF  +  Q  D    + V  S++E+YNE + DLL    E + SR  
Sbjct: 219 L----GLIPLSVSYLFSNIMEQSMDGDKKFDVIISYLEIYNERIYDLLESGLEESGSRP- 273

Query: 185 RIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQD 244
                                              P+ +++ K    A  V    ++  D
Sbjct: 274 ---------------------------------GTPSRSYMGKSNSNAMGVELKIRD--D 298

Query: 245 QNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYK-EYN 303
              G+ +  L +    + +E ++ +  G K R++  T  N  SSRSH I  I L   + N
Sbjct: 299 SKYGVKVIGLTERRCESTEELLRWIGIGDKSRKIGETDYNTRSSRSHAIVLIRLTSTDVN 358

Query: 304 GEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLT-DK------ 356
               R S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+ DK      
Sbjct: 359 NGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTTSVDS 415

Query: 357 ------------------------SLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKI 392
                                   S H+P+R+SKLTRLLQ +L G++    I T+     
Sbjct: 416 NISTTPTGSSGSSSGSITGNSGIPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRND 475

Query: 393 NSEETCSTLQYAAKAKNI 410
            + ET +TL++A++AKN+
Sbjct: 476 AAAETMNTLRFASRAKNV 493

>NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {ON}
           Anc_8.678
          Length = 655

 Score =  142 bits (357), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 106/358 (29%), Positives = 169/358 (47%), Gaps = 56/358 (15%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           +  D V+ P  +   +++ I +P+     +G+N TV  YGMT +GKTYTM G       +
Sbjct: 135 FKFDHVYSPHVSNLEIYESINKPMIDKLFQGFNATVFAYGMTGSGKTYTMMGSGGDGGDD 194

Query: 129 LSESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASSRKLRIFD 188
                  +  +  K+ E   + +  + V  S++E+YNE + DLL DS+ +          
Sbjct: 195 DGLIPLSVSYLFSKVIEVGLVGERKFDVLLSYLEIYNERIYDLL-DSESLVGGTTTPSRG 253

Query: 189 SNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQDQNAG 248
             +      S+ST                       L+ R               D   G
Sbjct: 254 FGSGGGRNESVSTNE---------------------LKIR--------------DDSKYG 278

Query: 249 IYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKE--YNGEI 306
           + +  L++    +++E +K +++G  HR+ A T  N  SSRSH I  I L      +G  
Sbjct: 279 VRVMGLREQRCESSEELMKWIRRGDSHRKTAETDYNARSSRSHAIVLIRLTNTNVIDGTS 338

Query: 307 FRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSL-------- 358
              S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+ +S         
Sbjct: 339 IS-STLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSAESTAASHGNSP 394

Query: 359 ------HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNI 410
                 H+P+R+SKLTR+LQ +L G++    I TI   K ++ ET +TL++A++AKN+
Sbjct: 395 NANGNGHIPYRDSKLTRILQPALSGDSIVTTICTIDTQKESAAETLNTLRFASRAKNV 452

>SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 706

 Score =  142 bits (358), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 121/412 (29%), Positives = 189/412 (45%), Gaps = 81/412 (19%)

Query: 11  DVEELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYT 70
           +++EL   + V CR R   + +   S  V + ++   +E     T  + IT       + 
Sbjct: 360 ELQELRGNIRVFCRIRPLLQGEGSESCHVHI-NLFNDDE----GTQSMNITRDSKKHEFK 414

Query: 71  VDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELS 130
            D++F P  +   +F++I + L    + GYN  +  YG T +GKTYTM          L 
Sbjct: 415 FDKIFDPENSNDDIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM----------LH 463

Query: 131 ESAGIIPRILFKLFETLELQKE---DYVVKCSFVELYNEELKDLLGDSQEIASSRKLRIF 187
              G+IP  L  +F+ + L KE   +Y +   F+E+YNE + DL            LR  
Sbjct: 464 PQNGMIPSTLDHIFQWIHLLKERGWEYEISSQFIEIYNETIIDL------------LRGL 511

Query: 188 DSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQS--HQNSQDQ 245
           +++T                                           +T+S  H+   DQ
Sbjct: 512 NNDT-----------------------------------------EDITESLKHEIRHDQ 530

Query: 246 NA-GIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITL--YKEY 302
            +   ++ N+    +T+      LL++  K R  A T  N+ SSRSH++F I L  Y   
Sbjct: 531 ESQTTHVTNVTTCKLTDRDMVDTLLKRAAKLRSTAATGSNERSSRSHSVFIIKLRGYNSN 590

Query: 303 NGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSL---H 359
            GE  +   +NLVDLAGSE I+ S     R +E  +IN+SL  LG VI++L        H
Sbjct: 591 TGEECQ-GTLNLVDLAGSERINASQVTGDRLRETQNINKSLSCLGDVIHALASPDASKRH 649

Query: 360 VPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIK 411
           +PFR SKLT LLQ SL G++KT +   ISP   +  ET ++L++A+K  + +
Sbjct: 650 IPFRNSKLTYLLQYSLLGDSKTLMFVNISPCLDHFNETLNSLRFASKVNSTR 701

>TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {ON}
           Anc_3.479 YPR141C
          Length = 739

 Score =  142 bits (359), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 115/367 (31%), Positives = 167/367 (45%), Gaps = 87/367 (23%)

Query: 65  NSKTYTV--DEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDE 122
           N+ TY+   D VF      S VF +I E L    + GYN  +  YG T +GKTYTM    
Sbjct: 438 NNATYSFEFDHVFKQDEGNSEVFNEI-EQLIQSALDGYNVCIFAYGQTGSGKTYTM---- 492

Query: 123 KLYDGELSESAGIIP---RILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIA 179
                 L+ + G+IP   + +F   ++L+    +Y V C F                   
Sbjct: 493 ------LNPNDGVIPMTIKYIFNSMDSLKKNGWEYNVSCEF------------------- 527

Query: 180 SSRKLRIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSH 239
               + +++ N +                                 R    T  S+  SH
Sbjct: 528 ----IELYNENIID------------------------------LFRDNGPTKDSI--SH 551

Query: 240 QNSQDQNAGI-YIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITL 298
           +   D  + I Y+ N++ F I N  + I L+ K    R  ++T +N  SSRSH IF I L
Sbjct: 552 EIRHDDQSKITYVTNIKRFKIENISDTIGLINKSKIKRMTSSTGLNSHSSRSHGIFIIYL 611

Query: 299 YKEYNGEIFR--VSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLT-- 354
            + YN +     +SK+NLVDLAGSE I+ S  Q  R KE  SIN+SL  LG VI++L   
Sbjct: 612 -EGYNHKTNEKCISKLNLVDLAGSERINFSKVQGDRLKETQSINKSLSCLGDVIHALNRG 670

Query: 355 ----------DKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYA 404
                      K+ H+PFR SKLT LL+ SL G++KT +   +S  + +  ET ++L++A
Sbjct: 671 NKNHLNSNDLQKTRHIPFRNSKLTYLLKYSLIGDSKTLMFVNVSSNEAHLNETINSLRFA 730

Query: 405 AKAKNIK 411
            K  N K
Sbjct: 731 TKVNNTK 737

>Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}
           similar to Ashbya gossypii ACR145W
          Length = 687

 Score =  142 bits (357), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 115/390 (29%), Positives = 181/390 (46%), Gaps = 82/390 (21%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           +  D VF      S V+  + +P+     +GYN T+  YGMT +GKT+TM+G +      
Sbjct: 145 FQFDHVFTKEVTNSEVYMALGQPIVDKLFQGYNATIFAYGMTGSGKTFTMSGTK------ 198

Query: 129 LSESAGIIPRILFKLF-----ETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASSRK 183
             +  G+IP  +  +F     ET +  +  Y VK S++E+YNE++ DLL           
Sbjct: 199 --QDPGLIPLCVGNMFDRVMEETSKSTEHKYEVKVSYLEIYNEKIYDLLS---------- 246

Query: 184 LRIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQ 243
             I ++N    A  S   G                   ++ L+ R               
Sbjct: 247 --ITEAN---GAVASRQLGR-----------------NSSGLKIR--------------D 270

Query: 244 DQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYK-EY 302
           D   G+ + +L +  + +  E IK +  G K+R+   T  N  SSRSH I  + L + E 
Sbjct: 271 DSKYGVKVVDLTEQQVESHGEVIKWIAAGDKNRKTGETDFNSRSSRSHAIVLLRLTRCEL 330

Query: 303 NGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSL---- 358
                  S ++L DLAGSE   R+  Q  R KE   IN+SLL LG VI  L+  S     
Sbjct: 331 KTGTEVTSTLSLCDLAGSE---RAVTQLVRRKEGAFINKSLLALGTVIAKLSANSAGSGS 387

Query: 359 ------------HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAK 406
                       H+P+R+SKLTR+LQ +L G++    I TI     ++ ET +T+++A++
Sbjct: 388 GSNGQPPSAMGGHIPYRDSKLTRILQPALTGDSIITTICTIDSKSESNSETTNTVRFASR 447

Query: 407 AKNIK---NKPQLGSVIMKDILVKNITGEL 433
           AKNI     K ++ +   KD +++N+  +L
Sbjct: 448 AKNISLNVRKNEMDTSNEKDSIIQNLRKQL 477

>TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON}
           Anc_3.479 YPR141C
          Length = 676

 Score =  141 bits (356), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 109/351 (31%), Positives = 168/351 (47%), Gaps = 71/351 (20%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           Y+ D+VF  +     +F++++E L    + G+N  +  YG T +GKT+TM          
Sbjct: 383 YSFDKVFSQTDTNQEIFKEVSE-LIQSSLDGFNVCIFAYGQTGSGKTFTM---------- 431

Query: 129 LSESAGIIPRILFKLFETLELQKED---YVVKCSFVELYNEELKDLLGDSQEIASSRKLR 185
           L+   GIIP     +F+ ++   ++   Y V C F+E+YN+E+ DL            LR
Sbjct: 432 LNPKDGIIPSTAKHIFDWIDNSAKNGWKYNVTCEFLEIYNDEIYDL------------LR 479

Query: 186 IFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQDQ 245
             D+ + S+                                      P     H    D 
Sbjct: 480 SDDNKSNSS------------------------------------NGPRHKIHHD---DA 500

Query: 246 NAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLY--KEYN 303
           +    ++NL+   +T+ +    +L+  +K R  A+T  N+ SSRSH+IF I ++   E  
Sbjct: 501 SKTTVVENLETITLTSKESVDAVLKNAMKLRATASTSSNERSSRSHSIFIIKIHGINEGL 560

Query: 304 GEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDK---SLHV 360
           GE  R   +NL+DLAGSE +S S  Q +R KE   IN+SL  LG V+NSL      + H+
Sbjct: 561 GE-ERNGLLNLIDLAGSERLSVSKVQSERIKETQHINKSLSFLGNVMNSLGSPDATTRHI 619

Query: 361 PFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIK 411
            FR+SKLT LLQ SL GN+KT ++  IS +  +  ET  +L +A K  + K
Sbjct: 620 SFRDSKLTYLLQYSLTGNSKTLMVVNISSSSDHINETIKSLNFAKKVNSTK 670

>ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL155C (KIP2)
          Length = 685

 Score =  140 bits (354), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 112/388 (28%), Positives = 182/388 (46%), Gaps = 84/388 (21%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           +  D VF        V+Q +  P+     +GYN T+  YGMT +GKT+TM+G++      
Sbjct: 146 FQFDHVFTKGVCNQEVYQALGVPIIDKLFEGYNATIFAYGMTGSGKTFTMSGNK------ 199

Query: 129 LSESAGIIPRILFKLFETLELQKED----YVVKCSFVELYNEELKDLLG--DSQEIASSR 182
             +  G+IP+ +  +F+ +  +       Y VK S++E+YNE++ DLL   D Q  ++ +
Sbjct: 200 --QEPGLIPQCVGNIFDRISSEHHGASLAYEVKVSYLEIYNEKIYDLLNYVDRQAGSTGQ 257

Query: 183 KLRIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNS 242
             R                                    AT L+ R              
Sbjct: 258 PSR-----------------------------------NATGLKIR-------------- 268

Query: 243 QDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTI--FTITLYK 300
            D   G+ + +L +  +++ ++ +K +  G ++R+   T  N  SSRSH I    +T Y 
Sbjct: 269 DDSKYGVKVVDLTEQLVSSHEDVMKWIATGDRNRKTGETDFNTRSSRSHAIVLLRLTRYD 328

Query: 301 EYNGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLT------ 354
              G     S ++L DLAGSE   R+  Q  R KE   IN+SLL LG VI  L+      
Sbjct: 329 LKTGS-EATSTLSLCDLAGSE---RAVTQIVRRKEGAFINKSLLALGTVIAKLSMLGSQA 384

Query: 355 ------DKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAK 408
                   + H+P+R+SKLTR+LQ +L G++    I TI     +S ET +T+++A++AK
Sbjct: 385 NGLQPSPAAGHIPYRDSKLTRILQPALTGDSIITTICTIDSKAESSTETTNTVRFASRAK 444

Query: 409 NIK---NKPQLGSVIMKDILVKNITGEL 433
           NI     K ++ S   KD +++N+  +L
Sbjct: 445 NIALNVRKNEMDSHAEKDTIIQNLRKQL 472

>YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON}
           KIP2Kinesin-related motor protein involved in mitotic
           spindle positioning, stabilizes microtubules by
           targeting Bik1p to the plus end; Kip2p levels are
           controlled during the cell cycle
          Length = 706

 Score =  140 bits (353), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 112/379 (29%), Positives = 174/379 (45%), Gaps = 85/379 (22%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           +  D VF        V+++ ++P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 129 LSESAGIIPRILFKLFETLELQK----EDYVVKCSFVELYNEELKDLLGDSQEIASSRKL 184
           L    G+IP  +  LF  +  Q     + + V  S++E+YNE + DLL    E + SR  
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLLESGLEESGSR-- 272

Query: 185 RIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQD 244
                         +ST                  P+  ++ K       V    ++  D
Sbjct: 273 --------------IST------------------PSRLYMSKSNSNGLGVELKIRD--D 298

Query: 245 QNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKE--Y 302
              G+ +  L +    +++E ++ +  G K R++  T  N  SSRSH I  I L      
Sbjct: 299 SQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTNVK 358

Query: 303 NGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSL--------- 353
           NG   R S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L         
Sbjct: 359 NG-TSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKMNSVG 414

Query: 354 ----------------------TDKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAK 391
                                 T  S H+P+R+SKLTRLLQ +L G++    I T+    
Sbjct: 415 SNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRN 474

Query: 392 INSEETCSTLQYAAKAKNI 410
             + ET +TL++A++AKN+
Sbjct: 475 DAAAETMNTLRFASRAKNV 493

>Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar to
           Ashbya gossypii AGR253W
          Length = 711

 Score =  139 bits (351), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 109/355 (30%), Positives = 167/355 (47%), Gaps = 70/355 (19%)

Query: 66  SKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 125
           S  +  D++F P    + VFQ+I + L    + GYN  +  YG T +GKTYTM       
Sbjct: 414 SYNFHFDKIFEPHNTNADVFQEICQ-LVQCSLDGYNVCIFAYGQTGSGKTYTM------- 465

Query: 126 DGELSESAGIIPRILFKLFETLELQKED---YVVKCSFVELYNEELKDLLGDSQEIASSR 182
              L+   G+IP  L  +F+  E   E    Y + C ++E+YNE + DL           
Sbjct: 466 ---LNPGDGMIPMTLSHIFQWTEDLMEHGWRYEMDCEYIEIYNETILDL----------- 511

Query: 183 KLRIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNS 242
            LR F+SN                                  L          +Q H+  
Sbjct: 512 -LREFNSND----------------------------NIDDILE---------SQKHEIR 533

Query: 243 QDQ-NAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITL--Y 299
            D  N    I N+    +T+ ++   +L++  + R  A T+ N+ SSRSH++F + +  +
Sbjct: 534 HDHDNHATSITNVTKMKMTSQEQVDSMLKRASRMRSTACTRSNERSSRSHSVFMVHINGH 593

Query: 300 KEYNGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVI---NSLTDK 356
            +  GE+    K+NL+DLAGSE I+ S     R +E  +IN+SL  LG VI   NS    
Sbjct: 594 NDQTGEVSH-GKLNLIDLAGSERINSSLVTGDRLRETQNINKSLSCLGDVIYALNSPDAA 652

Query: 357 SLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIK 411
             H+PFR SKLT LLQ SL G++KT +   I   + ++ ET ++L++A+K  + K
Sbjct: 653 KRHIPFRNSKLTYLLQYSLIGDSKTLMFVNIPSDQKHTNETLNSLRFASKVNSTK 707

>SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 504

 Score =  136 bits (343), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 75/175 (42%), Positives = 117/175 (66%), Gaps = 8/175 (4%)

Query: 250 YIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKE---YNGEI 306
           +++ L +F +   +E ++ +++G + R V  T MN+ SSRSH IFTI++ +      G++
Sbjct: 198 FVEGLNEFKVCKVEEILEYMKQGDRLRTVGVTNMNNSSSRSHAIFTISIKQSETTLAGDL 257

Query: 307 F-RVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLH--VPFR 363
             R S + LVDLAGSE +S +GA+  R KE  +IN+SL TLGRV++ L  K+    +P+R
Sbjct: 258 TERRSSIKLVDLAGSERVSTTGARGDRLKEGSNINKSLTTLGRVVSVLAKKNRPKLIPYR 317

Query: 364 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGS 418
           +S LT +L+++LGGN+KT +IA +SP   + EET STL+YA  AK +KN  ++ S
Sbjct: 318 DSALTWVLKENLGGNSKTVMIACVSPC--DYEETISTLRYATTAKEVKNTARVNS 370

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 83/180 (46%), Gaps = 22/180 (12%)

Query: 16  NITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVDEVF 75
           NI VAVR R    RE        V+ P  +   +  I+T+  +        K +T D  F
Sbjct: 4   NIKVAVRLRSPLPREHGQPIITQVTSP-TSFVIQQHISTSSLLATEEFTQGKIFTFDHCF 62

Query: 76  GPSAN----QSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDE--------- 122
             S N    Q +++  I        + GYN  +L YG T +GK++TM G E         
Sbjct: 63  KYSENASHDQEVIYDTIGREYLLHTLDGYNTCILAYGQTGSGKSFTMMGPEVSKHFHNNQ 122

Query: 123 KLYDGELSESA-GIIPRILFKLFETLELQ-------KEDYVVKCSFVELYNEELKDLLGD 174
              D  + +SA GIIPR+   LF+   +        K  + + CS++E+YNE+++DLL +
Sbjct: 123 TALDRAIEDSAIGIIPRVCCDLFDICNMCNSEEDGIKTQFEIYCSYLEIYNEQVRDLLSE 182

>SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]
           {ON} weakly similar to uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a
           kinesin, colocalizes with Myo2p; kinesin heavy chain
           homolog
          Length = 649

 Score =  137 bits (346), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 118/358 (32%), Positives = 192/358 (53%), Gaps = 30/358 (8%)

Query: 245 QNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNG 304
           +++GIY++ L   ++T+ +E +  +++G   R V++T MN  SSRSH+I  I L K  N 
Sbjct: 193 KDSGIYVKGLNTNYVTSEQELLDYIKQGESQRNVSSTSMNLESSRSHSIVRINLEKR-NA 251

Query: 305 --EIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTD------- 355
             E  + S + LVDLAGSE + ++ A     +EA  IN SL  LG VIN+LT        
Sbjct: 252 LEENIQHSFLYLVDLAGSEKVGKTNAAGVTLEEAKKINSSLSALGNVINALTQVESKSKR 311

Query: 356 KSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQ 415
            S H+P+R+SKLTRLLQDSLGGN+KT LI   S ++ N +ET STL++ ++AK IKN   
Sbjct: 312 TSAHIPYRDSKLTRLLQDSLGGNSKTTLILNCSTSRFNEQETLSTLRFGSRAKKIKNFAI 371

Query: 416 L--GSVIMKDILVKNI-------TGELAKIKA---DLLSTKSKEGIYMSQDNYKELTNDL 463
           L   ++  +++L + +       TG L +I     +LL +K++  I          T DL
Sbjct: 372 LNKNNLSSRNLLEQQLEELKSRETGYLLRISTLEKELLESKAQNDIEDPSQKPLPPTPDL 431

Query: 464 ESYKTEVKECKRAIETLTSQNTLLLKDKKASNEVNDLQRI--KLQNMRDAMSDLYSKAEK 521
                ++K    ++  L S +     D  + +  + +Q +  + +N+ +  + L  + E 
Sbjct: 432 LEENKKLKSQVESLAGLISHSNSGATDDPSISYDDLIQNLMNRCENVVEIQASLDEQVEL 491

Query: 522 QNKREQNLVATASTLKTTVGTMQSIIKEHERRERDIESKMGDLF--NNEFARVKQTIL 577
             K +Q+L +T   + T     Q ++  ++ +E  IE++  DL   NN  AR  +T L
Sbjct: 492 NKKFQQSLASTTERMYTLEDRSQRLL--YQLQETQIENQ--DLMNTNNSLARDLKTTL 545

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 73/129 (56%), Gaps = 11/129 (8%)

Query: 61  TAQINSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTG 120
           + Q N + +T D VF   + Q  V++ +A  +   F +GYN T+L YG T +GK++TM G
Sbjct: 67  STQNNDRLFTFDRVFDTGSTQESVYEFVAGDMLKSFFQGYNGTILAYGQTGSGKSHTMFG 126

Query: 121 DEKLYDGELSESAGIIPRI---LFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQE 177
            +        E+ G+IPRI   +FK  ET + +   + V  SF+E+Y E++ DLL  S E
Sbjct: 127 PK--------ENRGVIPRICHDIFKQIETPDYEDCIFTVSVSFMEVYLEKIYDLLAQSLE 178

Query: 178 IASSRKLRI 186
             + +++ +
Sbjct: 179 KPADKRISL 187

>KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W
          Length = 473

 Score =  134 bits (338), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 114/175 (65%), Gaps = 8/175 (4%)

Query: 250 YIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYN---GEI 306
           +++ LQ+F + +  E +  L++G + + V  T +N+ SSRSHTIFTI + ++ N   G +
Sbjct: 169 FVEGLQEFEVNSVDEILDYLRQGSERKTVGATLVNEQSSRSHTIFTINVEQKENSPLGHV 228

Query: 307 F-RVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLH--VPFR 363
             R S + L+DLAGSE  + SGA  +R KE  +IN+SL TLGRVI  L  K     +P+R
Sbjct: 229 LERRSSIRLIDLAGSERANASGATGERLKEGSNINKSLSTLGRVIAMLAKKKQPRLIPYR 288

Query: 364 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGS 418
           ++ LT +L++SLGGN+KT +IA +SP     EET STL+YA  A+++K   QL +
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACVSPCDF--EETMSTLRYATLARSVKTFAQLNT 341

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 59/101 (58%), Gaps = 15/101 (14%)

Query: 80  NQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSESAGIIPRI 139
           +Q+ +++++A       + GYN  +  YG T +GK++TMTG  +L         GI+PR+
Sbjct: 62  DQAQLYEQLARDYLLHALDGYNTCIFAYGQTGSGKSHTMTGSAEL--------PGIVPRM 113

Query: 140 LFKLFETLELQKED-------YVVKCSFVELYNEELKDLLG 173
             +LFE  E+ +         + ++CS++E+YNE ++DLLG
Sbjct: 114 CQELFEVREMYESSDDQASTQFKIRCSYLEIYNETVRDLLG 154

>TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {ON}
           Anc_3.479 YPR141C
          Length = 704

 Score =  137 bits (346), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 132/427 (30%), Positives = 189/427 (44%), Gaps = 87/427 (20%)

Query: 3   AMPQASGEDVEELNITVAVRCRGRNE--REIKAKSSVVVSVPDVTGSNEVSINTTGDVGI 60
           +M +    +++EL   + V CR R    RE    + + V   +    N+V        G 
Sbjct: 339 SMRRTLHNELQELRGNIRVFCRVRPPLPRENATSNHLKVREFNDDAGNQVIEVAKNGYGS 398

Query: 61  TAQINSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTG 120
             QI    +  D +F        VFQ+I + L    + GYN  +  YG T +GKTYTM  
Sbjct: 399 GPQI----FKFDRIFNEKETNYDVFQEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM-- 451

Query: 121 DEKLYDGELSESAGIIPRILFKLFETLELQKED---YVVKCSFVELYNEELKDLLGDSQE 177
                   L+ + GIIP  +  +F   +  KE    Y V C FVE+YNE +         
Sbjct: 452 --------LNPTDGIIPATITHIFNWTKNLKERGWRYDVSCQFVEIYNETI--------- 494

Query: 178 IASSRKLRIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQ 237
                                                       A  LR+  K A S + 
Sbjct: 495 --------------------------------------------ADLLRREEKPAGSASG 510

Query: 238 SHQNSQDQNAGIYIQNLQDFHITN-------AKEGI-KLLQKGLKHRQVATTKMNDFSSR 289
              NS  +    + Q  ++  ITN       +K  + +LL++  K R  A+T  N+ SSR
Sbjct: 511 DDTNSNTKLEIRHNQETKETTITNVTTVPLTSKNTVDELLKRANKLRSTASTACNERSSR 570

Query: 290 SHTIFTITLYKE--YNGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLG 347
           SH+IF + L  E    GE      +NLVDLAGSE I+ S    +R +E  SIN+SL  LG
Sbjct: 571 SHSIFIVHLSGENVLTGERSH-GILNLVDLAGSERINTSQVIGERLRETQSINKSLSCLG 629

Query: 348 RVINSL--TDKS-LHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYA 404
            VI++L   D S  H+PFR SKLT LLQ SL GN+KT +   IS    ++ ET ++L++A
Sbjct: 630 DVIHALGSADASKRHIPFRNSKLTYLLQYSLTGNSKTLMFVNISGNPNHTNETLNSLRFA 689

Query: 405 AKAKNIK 411
           +K  + K
Sbjct: 690 SKVNSTK 696

>Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C
           (REAL)
          Length = 715

 Score =  137 bits (345), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 111/384 (28%), Positives = 176/384 (45%), Gaps = 89/384 (23%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           +  D VF        V++K ++P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYEKTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 129 LSESAGIIPRILFKLFETLELQK----EDYVVKCSFVELYNEELKDLLGDSQEIASSRKL 184
           L    G+IP  +  LF  +  Q     + + V  S++E+YNE + DLL    E + SR  
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVVISYLEIYNERIYDLLESGLEESGSR-- 272

Query: 185 RIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQD 244
                         + T                  P+ +++ K    A  V    ++  D
Sbjct: 273 --------------LGT------------------PSRSYMSKNNSNALGVELKIRD--D 298

Query: 245 QNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYK-EYN 303
              G+ +  L +    ++++ ++ +  G K R++  T  N  SSRSH I  I L   +  
Sbjct: 299 SQYGVKVIGLTERRCESSEDLLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTDVR 358

Query: 304 GEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLT-DK------ 356
               R S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+ DK      
Sbjct: 359 DGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTNSVGS 415

Query: 357 ------------------------------SLHVPFRESKLTRLLQDSLGGNTKTALIAT 386
                                         S H+P+R+SKLTRLLQ +L G++    I T
Sbjct: 416 IIPTTPTSSGNSSSSSSSSSGSIVSNSNTSSNHIPYRDSKLTRLLQPALSGDSIVTTICT 475

Query: 387 ISPAKINSEETCSTLQYAAKAKNI 410
           +      + ET +TL++A++AKN+
Sbjct: 476 VDTRNDAAAETMNTLRFASRAKNV 499

>CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216w KIP3
           kinesin-related protein required for nuclear migration
          Length = 705

 Score =  137 bits (344), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 106/359 (29%), Positives = 162/359 (45%), Gaps = 82/359 (22%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           +  D++F   A Q  V+Q     L    + G+N TV  YG T  GKTYT++G        
Sbjct: 156 FVFDKLFDTDATQREVYQSTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSG-------- 207

Query: 129 LSESAGIIPRILFKLFETLELQKE--DYVVKCSFVELYNEELKDLLGDSQEIASSRKLRI 186
             E+ GI+ + + +LF+ +E  K+   + +  SF+E+YNE ++DLL        S+KL I
Sbjct: 208 TPENPGIVFQAMEELFQKMEDLKDTKSFQISLSFLEIYNERIRDLLKPE---TPSQKLII 264

Query: 187 FDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTAT------FLRKRWKTAPSVTQSHQ 240
            +         ++S                   PT         +R  +    S T++++
Sbjct: 265 REDTDNKITVANLS----------------QHFPTTVQEVMDLVIRGNFNRTTSPTEANE 308

Query: 241 NSQDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYK 300
            S   +A + I  +Q     + KE                          HT  T++   
Sbjct: 309 VSSRSHAVLQIHIVQKNRTPDIKE-------------------------EHTFGTLS--- 340

Query: 301 EYNGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLT------ 354
                        ++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L       
Sbjct: 341 -------------IIDLAGSERAAATKNRGARLHEGANINRSLLALGNCINALCINGNDE 387

Query: 355 DKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNK 413
               HVP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 388 RPRCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 446

>NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {ON}
           Anc_3.528
          Length = 868

 Score =  136 bits (342), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 108/363 (29%), Positives = 173/363 (47%), Gaps = 73/363 (20%)

Query: 62  AQINSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGD 121
           A+ N   +  D++F  +++Q  V+      L    + G+N TV  YG T  GKTYT++G 
Sbjct: 184 AKKNEMKFVFDKIFDENSSQDEVYLGTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSGT 243

Query: 122 EKLYDGELSESAGIIPRILFKLFETLELQKED--YVVKCSFVELYNEELKDLLGDSQEIA 179
           +        E+ GII R++ +LFE +E  K++  + +  S++E+YNE + DLL       
Sbjct: 244 Q--------ENPGIIFRVMQELFERMEDLKDEKTFQLSISYLEIYNEMIYDLLKPD---T 292

Query: 180 SSRKLRIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSH 239
            S+KL I +      + +++S                        +R     + S T+++
Sbjct: 293 PSKKLIIREDKDSKISVSNLSYHYPKSVQDV----------IDLVIRGNINRSTSSTEAN 342

Query: 240 QNSQDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLY 299
           + S   +A + I  +Q    TN K                     D +S  HT  T+++ 
Sbjct: 343 EVSSRSHAVLQIHIMQ----TNTKI--------------------DLTS-EHTFATLSI- 376

Query: 300 KEYNGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKS-- 357
                          +DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L   +  
Sbjct: 377 ---------------IDLAGSERAAATKNRGERLYEGANINKSLLALGNCINALCIPTNN 421

Query: 358 -------LHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNI 410
                   H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK I
Sbjct: 422 TRRRNIRYHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEI 481

Query: 411 KNK 413
           K K
Sbjct: 482 KTK 484

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
           similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141c KAR3 kinesin-related protein
          Length = 692

 Score =  134 bits (338), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 111/374 (29%), Positives = 171/374 (45%), Gaps = 85/374 (22%)

Query: 56  GDVGITA-QINSKT--YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTST 112
           GD G+T  + NS+   +  D++F        +F+++ + L    + GYN  +  YG T +
Sbjct: 381 GDQGMTINRGNSQVIPFKFDKIFDQQETNDEIFKEVGQ-LIQSSLDGYNVCIFAYGQTGS 439

Query: 113 GKTYTMTGDEKLYDGELSESAGIIPRIL---FKLFETLELQKEDYVVKCSFVELYNEELK 169
           GKTYTM          L+   GI+P  +   F   + L  +   Y V C F         
Sbjct: 440 GKTYTM----------LNPGDGIVPATINHIFSWIDKLAARGWSYKVSCEF--------- 480

Query: 170 DLLGDSQEIASSRKLRIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRW 229
                         + I++ N +                                LR   
Sbjct: 481 --------------IEIYNENIVD------------------------------LLRS-- 494

Query: 230 KTAPSVTQSHQNSQDQNAGIYIQNLQDFHITNAKEGI--------KLLQKGLKHRQVATT 281
             APS   + +N+  ++   + Q L+  +ITN    +        K+L++  K R  A+T
Sbjct: 495 -GAPSQENNDRNADSKHEIRHDQELKTTYITNITTCVLDSRDTVDKVLKRANKLRSTAST 553

Query: 282 KMNDFSSRSHTIFTITLYKEYNGEIFRVSK-MNLVDLAGSENISRSGAQHQRAKEAGSIN 340
             N+ SSRSH+IF I L  +  G   +    +NLVDLAGSE ++ S    +R +E  SIN
Sbjct: 554 AANEHSSRSHSIFIIHLEGKNEGTGEKSQGILNLVDLAGSERLNSSMVVGERLRETQSIN 613

Query: 341 QSLLTLGRVINSLTD---KSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEET 397
           +SL  LG VI++L     +  H+PFR SKLT LLQ SL G++KT +   ISPA ++  ET
Sbjct: 614 KSLSCLGDVIHALNSPDGQKRHIPFRNSKLTYLLQYSLIGSSKTLMFVNISPAALHLNET 673

Query: 398 CSTLQYAAKAKNIK 411
            ++L++A+K  N K
Sbjct: 674 INSLRFASKVNNTK 687

>TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa]
           {ON} Anc_3.528 YGL216W
          Length = 733

 Score =  134 bits (338), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 106/354 (29%), Positives = 163/354 (46%), Gaps = 73/354 (20%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           +  D++F  +A Q  V+      L    + G+N TV  YG T  GKTYT++G        
Sbjct: 129 FVFDKLFDENATQEEVYSGTTSELLDAVLDGFNGTVFAYGATGCGKTYTVSGT------- 181

Query: 129 LSESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASSRKLRIFD 188
             E  G+I   + +LF  +                  EEL+D      EI+ S  L I++
Sbjct: 182 -PERPGVIFLAMQELFARM------------------EELED--TRKFEISVS-YLEIYN 219

Query: 189 SNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQDQNAG 248
                  +  MS                   P    +R                +D    
Sbjct: 220 ETIRDLLSPEMS-------------------PKKLVIR----------------EDSENR 244

Query: 249 IYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKE-YNGEI- 306
           I + NL        ++ + L+  G  +R  + T  N+ SSRSH +  I + +     EI 
Sbjct: 245 ISVANLSHHRPKTVEDVMDLVVLGNTNRTTSATDANETSSRSHAVLQINIVQSSRTAEIT 304

Query: 307 --FRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSL-----TDKSLH 359
                +K++++DLAGSE  + +  + +R +E  +IN+SLL LG  IN+L     T ++ H
Sbjct: 305 SDHTFAKLSIIDLAGSERAASTKNRGERLQEGANINRSLLALGNCINALCISDGTRRTCH 364

Query: 360 VPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNK 413
           VP+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK IK K
Sbjct: 365 VPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKTK 418

>KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1 Kinesin-related motor protein
           required for mitotic spindle assembly and chromosome
           segregation; functionally redundant with Cin8p
          Length = 456

 Score =  128 bits (321), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 114/175 (65%), Gaps = 7/175 (4%)

Query: 250 YIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITL-YKEYNGEIFR 308
           ++Q++  F +   +E ++ L  G   R VA+T+MN  SSRSH IFT+++  +E +G I R
Sbjct: 149 FVQDITTFKVNRVEEVLEYLSIGDSKRSVASTRMNMESSRSHAIFTLSIKQQEPDGSI-R 207

Query: 309 VSKMNLVDLAGSE--NISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLH-VPFRES 365
            S + LVDLAGSE  N +      +R KE  +IN+SL TLGR I+ L   S H +P+R+S
Sbjct: 208 ESDLKLVDLAGSERANATMGIDNGKRMKEGANINKSLSTLGRCISQLAKNSKHLIPYRDS 267

Query: 366 KLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVI 420
            LT +L+++LGGN+KT +IA ISP  I+ EE+ STL+YA  AK IK +  +  ++
Sbjct: 268 LLTWVLKENLGGNSKTCMIACISP--IDLEESLSTLRYATTAKEIKLRATMNEIV 320

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 61/110 (55%), Gaps = 9/110 (8%)

Query: 67  KTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYD 126
           +++  D +F  S++Q+ +  ++        ++GYN  +  YG T +GKTYTM G      
Sbjct: 35  RSFNFDHIFDTSSSQTDIPGELCSKYVLHALEGYNACIFAYGQTGSGKTYTMRGT----- 89

Query: 127 GELSESAGIIPRILFKLFETLELQKEDY-VVKCSFVELYNEELKDLLGDS 175
              + + GIIP +   LF+ LEL K     V  ++ E+YNE+L DLLGD+
Sbjct: 90  ---NSNPGIIPLLCRDLFDALELDKTTVSSVSITYFEIYNEKLIDLLGDT 136

>Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {ON}
           YGL216W (KIP3) - kinesin-related protein involved in
           mitosis [contig 192] FULL
          Length = 479

 Score =  127 bits (319), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 115/175 (65%), Gaps = 8/175 (4%)

Query: 250 YIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGE---- 305
           +++ L++F +++ ++ +  +++G + R + +T +N++SSRSHTIFTI++ ++        
Sbjct: 169 FVEGLREFDVSSVEDILNYVKQGNEKRMMGSTLVNEYSSRSHTIFTISIKQKEKSALGHV 228

Query: 306 IFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLH--VPFR 363
           I R S + L+DLAGSE    +     R KE  +IN+SL TLGRVI+ L  +     +P+R
Sbjct: 229 IERHSSIKLIDLAGSERAKAAKTSGDRLKEGSNINKSLSTLGRVISMLAKRKQPKLIPYR 288

Query: 364 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGS 418
           ++ LT +L++SLGGN+KT +IA +SP   + EET STL+YA  A+N+K   QL +
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACVSPC--DYEETLSTLRYATLARNVKTCAQLNA 341

 Score = 77.0 bits (188), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 85/175 (48%), Gaps = 41/175 (23%)

Query: 16  NITVAVRCRGRNEREI------KAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTY 69
           NI VAVR R   ERE+      + +   V+ V D    NE                ++++
Sbjct: 4   NIKVAVRLRRPLEREVDESIIARVEDGNVIQVKDRNQKNE----------------TRSF 47

Query: 70  TVDEVFGPS----ANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 125
             D+ F  S    A+Q  ++++++       + GY+  V  YG T +GK++TMTG     
Sbjct: 48  HFDQCFAYSENIEADQLELYEQLSREYLLHALDGYHTCVFAYGQTGSGKSHTMTGS---- 103

Query: 126 DGELSESAGIIPRILFKLFETLELQKED-------YVVKCSFVELYNEELKDLLG 173
                ES GI+ R+  +LFE  E+ +         + ++CS++E+YNE ++DLLG
Sbjct: 104 ----PESPGIVSRMCQELFEVREIYESSDDQVNTQFKIRCSYLEIYNETVRDLLG 154

>Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii ACR228C - AER441C - ADR145C
          Length = 478

 Score =  126 bits (316), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 73/174 (41%), Positives = 112/174 (64%), Gaps = 7/174 (4%)

Query: 250 YIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYK----EYNGE 305
           YI+ L D  + + +E +K +++G   R VA T +N+ SSRSH I TI + +     +   
Sbjct: 173 YIEGLSDRIVNSCEELLKCIEEGSARRSVAGTAVNENSSRSHAICTINIQQTEIDSFGDT 232

Query: 306 IFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLT-DKSLHVPFRE 364
           + RVS + LVDLAGSE    S  + +R KE  +IN+SL+TL RV+  L+ +K   VP+RE
Sbjct: 233 VERVSSIKLVDLAGSERTKVSKTKDERFKEGTNINKSLMTLRRVVTMLSNNKVTGVPYRE 292

Query: 365 SKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGS 418
           S LTR+L+D+L GN+ T ++A ISP   + EE+ STL+YA+ AK+++ +  L +
Sbjct: 293 SLLTRVLRDNLDGNSITCILACISPC--DYEESISTLRYASTAKHVRTEAHLNT 344

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 87/168 (51%), Gaps = 27/168 (16%)

Query: 16  NITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSI--NTTGDVGITAQINSKTYTVDE 73
           NI VA+R R +  RE    S     V     SNE+++  + T +V  T +    T+  D+
Sbjct: 4   NIKVAIRIRDKISRETSRPS-----VIKRKTSNEITLQKDNTANVITTVE---HTFYFDQ 55

Query: 74  VFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSESA 133
           VF  S+NQ  ++ ++A       ++GY+  V+ YG T  GKTYTM G E        +  
Sbjct: 56  VFDESSNQKQIYHELAREYILKALEGYHTCVIAYGQTGAGKTYTMMGTE--------QEP 107

Query: 134 GIIPRILFKLFETLELQKED---------YVVKCSFVELYNEELKDLL 172
           GIIP +  +LF+ +++ +++         + V  S+ ++YNE++ D+L
Sbjct: 108 GIIPLVSHELFKIIDMCQDEGPDEDALVHFKVTVSYFQIYNEQIYDML 155

>Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {ON}
           YPL155C (REAL)
          Length = 704

 Score =  129 bits (323), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 107/378 (28%), Positives = 171/378 (45%), Gaps = 83/378 (21%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           +  D VF        V+++ ++P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FEFDHVFASHCTNLEVYERTSKPMIDKLLVGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 129 LSESAGIIPRILFKLFE-TLELQ---KEDYVVKCSFVELYNEELKDLLGDSQEIASSRKL 184
           L    G+IP  +  LF   +EL     + + V  S++E+YNE + DLL    E + SR  
Sbjct: 219 L----GLIPLSVSYLFSNVMELSMNGDKKFDVIISYLEIYNERIYDLLESGLEESLSRP- 273

Query: 185 RIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQD 244
                                              P+  ++ K    +  ++   +   D
Sbjct: 274 ---------------------------------STPSRLYMGK--GNSNGLSAELKIRDD 298

Query: 245 QNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYK-EYN 303
              G+ +  L +    +++E +K +  G K R++  T  N  SSRSH I  I L   +  
Sbjct: 299 TQYGVKVIGLTERRCESSEELLKWIAIGDKSRKIGETDYNARSSRSHAIVLIRLTSTDLE 358

Query: 304 GEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSL-------TDK 356
               R S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L       T  
Sbjct: 359 SGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKINPTGS 415

Query: 357 SLHVP------------------------FRESKLTRLLQDSLGGNTKTALIATISPAKI 392
           ++H                          +R+SKLTRLLQ +L G++    I T+     
Sbjct: 416 NIHTTPTNTGSSSSGTVTSNNNIPNNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRND 475

Query: 393 NSEETCSTLQYAAKAKNI 410
            + ET +TL++A++AKN+
Sbjct: 476 AAAETINTLRFASRAKNV 493

>KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {ON}
           Anc_3.528 YGL216W
          Length = 672

 Score =  123 bits (309), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 73/179 (40%), Positives = 113/179 (63%), Gaps = 8/179 (4%)

Query: 243 QDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTI---TLY 299
           +DQN+ I + NL      N ++ I L+ +G  +R  + T+ N+ SSRSH++  I    + 
Sbjct: 205 EDQNSKISVTNLSYHRPENVQDVIDLVIRGNLNRSSSPTEANEVSSRSHSVLQIHVKQVL 264

Query: 300 KEYN--GEIFRV-SKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSL--T 354
           K ++  G   ++ S ++++DLAGSE    +  +  R  E  +IN+SLL LG  IN+L   
Sbjct: 265 KNFDDIGSTNQIDSTLSIIDLAGSERAITTKNRGIRLYEGANINKSLLALGNCINALCIN 324

Query: 355 DKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNK 413
            KS H+P+R+SKLTRLL+ SLGGN KT +I  +SP+ ++ +ET +TL+YA +AK IK K
Sbjct: 325 KKSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSLHYDETLNTLKYANRAKEIKTK 383

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 68/135 (50%), Gaps = 17/135 (12%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           +  D++F   + Q  +F+    PL    + G+N TV  YG T  GKTYT+ G        
Sbjct: 92  FIFDKLFDDDSTQEQIFEDTTRPLLDSVLDGFNGTVFAYGATGCGKTYTING-------- 143

Query: 129 LSESAGIIPRILFKLFETLELQKED-----YVVKCSFVELYNEELKDLLGDSQEIASSRK 183
            SE  GII R + +LF  +E+  +D       +  S++E+YNE ++DLL        S+K
Sbjct: 144 TSEDPGIIFRTMNELFGKIEILLQDSNRSKIEISLSYLEIYNETIRDLLKPE---TPSKK 200

Query: 184 LRIF-DSNTMSAATN 197
           L I  D N+  + TN
Sbjct: 201 LIIREDQNSKISVTN 215

>Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  122 bits (305), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 116/409 (28%), Positives = 178/409 (43%), Gaps = 79/409 (19%)

Query: 11  DVEELNITVAVRCRGRNERE-IKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTY 69
           +++EL   + V CR R   E ++   + ++ V +   +  V       +  T Q++   +
Sbjct: 379 ELQELRGNIRVYCRIRPPLETLENLDTSLIRVNEFDDNRGVQSMEVTKIQSTTQVHE--F 436

Query: 70  TVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTM--TGDEKLYDG 127
             D++F        VF+++ + L    + GYN  +  YG T +GKT+TM  TGD      
Sbjct: 437 KFDKIFDQQNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTMLNTGD------ 489

Query: 128 ELSESAGIIPRIL---FKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASSRKL 184
                 GIIP  +   F     L+ +  DY V C F                       +
Sbjct: 490 ------GIIPSTISHIFSWINKLKTKGWDYKVNCEF-----------------------I 520

Query: 185 RIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQD 244
            I++ N +    N  S G                           K   +    H+   D
Sbjct: 521 EIYNENIVDLLRND-SIG---------------------------KDDTNTNSKHEIRHD 552

Query: 245 QNA-GIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYN 303
           Q      I N+    + + +    +L+K  K R  A+T  N+ SSRSH+IF I L    N
Sbjct: 553 QETKTTMITNVTSCQLESEERVDMILKKANKLRSTASTASNEHSSRSHSIFMIHLSGS-N 611

Query: 304 GEIFRVS--KMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDK---SL 358
            +    S   +NLVDLAGSE I+ S     R +E  +IN+SL  LG VI++L        
Sbjct: 612 AKTGAQSYGTLNLVDLAGSERINISQVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKR 671

Query: 359 HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKA 407
           H+PFR SKLT LLQ SL G++KT +   ISP+  +  ET ++L++A+K 
Sbjct: 672 HIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNSLRFASKV 720

>Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]
           {ON} YGL216W (KIP3) - 1:1 [contig 188] FULL
          Length = 819

 Score =  119 bits (299), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 106/180 (58%), Gaps = 9/180 (5%)

Query: 243 QDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEY 302
           +D +  I + NL    ++  ++ + L+ KG  +R  + T  N+ SSRSH +  + + +  
Sbjct: 235 EDSHRHITVANLSHHPLSTVEDVMDLVIKGNTNRTTSATDANETSSRSHAVLQVHITQRN 294

Query: 303 NG----EIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLT---- 354
                 E  + + ++L+DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L     
Sbjct: 295 RTAELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGR 354

Query: 355 -DKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNK 413
                HVP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 355 KRGGYHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSNHYDETLNTLKYATRAKEIKTK 414

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 58/106 (54%), Gaps = 10/106 (9%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           +  D VF   ++Q  V++    PL    + G+N TV  YG T  GKTYT++G        
Sbjct: 125 FVFDRVFDMDSSQIEVYEATTRPLLDSVLDGFNGTVFAYGATGCGKTYTVSG-------- 176

Query: 129 LSESAGIIPRILFKLFETL-ELQ-KEDYVVKCSFVELYNEELKDLL 172
             E+ GII   + +LF  + ELQ  + + +  S++E+YNE ++DLL
Sbjct: 177 TPENPGIIFLTMQELFAKMEELQDTKRFELSASYLEIYNETIRDLL 222

>NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}
           Anc_3.528
          Length = 784

 Score =  119 bits (298), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 109/182 (59%), Gaps = 12/182 (6%)

Query: 243 QDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYK-- 300
           +D    I + NL   +    +E I L+ KG  +R  + T+ N+ SSRSH +  I + +  
Sbjct: 261 EDGANKISVSNLSYHNPQTVQEVIDLVIKGNINRTTSPTEANEVSSRSHAVLQIHIMQTN 320

Query: 301 ---EYNGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSL---- 353
              +   E    + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L    
Sbjct: 321 RTADLTSE-HTFATLSIIDLAGSERAAATKNRGERLYEGANINRSLLALGNCINALCLTD 379

Query: 354 --TDKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIK 411
             T++S H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK
Sbjct: 380 GGTNRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIK 439

Query: 412 NK 413
            K
Sbjct: 440 TK 441

 Score = 72.0 bits (175), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 59/106 (55%), Gaps = 10/106 (9%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           +  D++F   A+Q  V+Q     L    + G+N TV  YG T  GKTYT++G        
Sbjct: 151 FVFDKLFDQDASQETVYQSTTSGLLDSVLDGFNGTVFAYGATGCGKTYTVSGT------- 203

Query: 129 LSESAGIIPRILFKLFETLELQKED--YVVKCSFVELYNEELKDLL 172
             E  GII R++ +LFE +E  K+   + +  S++E+YNE ++DLL
Sbjct: 204 -PEQPGIIFRVMQELFERMEDLKDTKRFELSLSYLEIYNETIRDLL 248

>TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.678
           YPL155C
          Length = 468

 Score =  115 bits (288), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 98/336 (29%), Positives = 153/336 (45%), Gaps = 83/336 (24%)

Query: 84  VFQKIAEPLF----ADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSESAGIIPRI 139
           +F +  +PL      D I G   T++ YG T +GKTYTM G +           GI+   
Sbjct: 122 IFVRDCKPLVHRVATDCISG---TIIAYGATGSGKTYTMHGTKA--------EGGIVQLS 170

Query: 140 LFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASSRKLRIFDSNTMSAATNSM 199
           +  L   L    ++  +  S++E+YNE L DLL D      +++LRI D +         
Sbjct: 171 IRDLLTQL---SKNCQITISYLEIYNERLHDLLCDG-----TKELRILDDSA-------- 214

Query: 200 STGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQDQNAGIYIQNLQDFHI 259
                               P A  L    +T  ++  S Q+                  
Sbjct: 215 --------------------PIACRLHGLKETTITLDDSEQS------------------ 236

Query: 260 TNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEIFRVSKMNLVDLAG 319
                 ++L+ +G ++R+V +T+ N  SSRSH +  + +     G   RV  + L DLAG
Sbjct: 237 --VSRVLELVAQGNRNRRVRSTQHNTGSSRSHAVLRLRITDSM-GSKARV--LTLCDLAG 291

Query: 320 SENISRSGAQHQRA--KEAGSINQSLLTLG---RVINSLTDKSLHVPFRESKLTRLLQDS 374
           SE  S     H R    E G+IN+SL+ LG   R++N     S HVP+R+SKLTRLL+ S
Sbjct: 292 SERAS----VHDRGLRAEGGAINKSLMALGTVVRLLNETGPSSTHVPYRDSKLTRLLKPS 347

Query: 375 LGGNTKTALIATISPAKINSEETCSTLQYAAKAKNI 410
           L GN    ++ T+S +  + E++  TL++A +A  +
Sbjct: 348 LSGNGLVTMVCTVSLSGTDYEQSLGTLRFARRASGV 383

>KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 819

 Score =  117 bits (294), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 70/180 (38%), Positives = 105/180 (58%), Gaps = 9/180 (5%)

Query: 243 QDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLY-KE 301
           +D +  I + NL    +   ++ + L+ KG  +R  + T  N+ SSRSH +  + +  K 
Sbjct: 235 EDVHRHITVANLSHHPLFTVEDVMDLVVKGNINRTTSATDANETSSRSHAVLQVHITQKN 294

Query: 302 YNGEI---FRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLT---- 354
              E+    + + ++L+DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L     
Sbjct: 295 RTAELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCAGGK 354

Query: 355 -DKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNK 413
                HVP+R+SKLTRLL+ SLGGN KT +I  ISP   + +ET +TL+YA +AK IK K
Sbjct: 355 RGGGFHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPTSNHYDETLNTLKYATRAKEIKTK 414

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 58/106 (54%), Gaps = 10/106 (9%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           +  D VF   A+Q  V++    PL    + G+N TV  YG T  GKTYT++G        
Sbjct: 125 FVFDRVFDMHASQEEVYEATTRPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 177

Query: 129 LSESAGIIPRILFKLFETLELQKE--DYVVKCSFVELYNEELKDLL 172
            +E+ GII   + +LF  +E  K+   + +  S++E+YNE ++DLL
Sbjct: 178 -AENPGIIFLTMQELFAKMEQLKDTKKFELTASYLEIYNESIRDLL 222

>ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1
          Length = 478

 Score =  114 bits (286), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 69/179 (38%), Positives = 108/179 (60%), Gaps = 11/179 (6%)

Query: 250 YIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITL-----YKEYNG 304
           +++ L++  + N +E I  + KG ++R V +T MN  SSRSH IF I++     +K+   
Sbjct: 179 FVEGLEEIAVHNVEELISCIHKGNENRTVRSTNMNQESSRSHAIFHISVNQKETHKKTGT 238

Query: 305 EIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTD----KSLHV 360
            +   S   LVDLAGSE +  + A  +  +E  SIN+SL  LGRVI+ L +    +S  +
Sbjct: 239 VVECHSTCKLVDLAGSERLGSAAADGKIRQEGTSINKSLSILGRVISLLAEGDRQRSQMI 298

Query: 361 PFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSV 419
           P+RES LT +L+++LGGN+ T L+A +SP   N  E+ STL+YA+  K +K    + S+
Sbjct: 299 PYRESALTWILKENLGGNSNTCLVACVSPE--NYYESLSTLRYASLTKKVKTNATINSM 355

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 69/134 (51%), Gaps = 25/134 (18%)

Query: 66  SKTYTVDEVFGPS----ANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGD 121
           +K +  D  FG +     +QS++++ +        ++GYN  +L YG T +GKT+TM G+
Sbjct: 49  AKEFRYDHCFGSTDSVDRDQSIIYESLVRGYVLHTLEGYNSCILAYGQTGSGKTFTMMGE 108

Query: 122 EKLYDGELSESAGIIPRILFKLFETLELQKE---------DYVVKCSFVELYNEELKDLL 172
           +         + GI+PR   +LFE   +  +         D+ VKCSF E+YNE++ DLL
Sbjct: 109 KG--------NEGIVPRFCRELFEVFHMCHQDDQESDIITDFQVKCSFFEIYNEQVIDLL 160

Query: 173 GDSQEIASSRKLRI 186
                  S RK +I
Sbjct: 161 SS----LSQRKCKI 170

>Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  117 bits (292), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 70/180 (38%), Positives = 109/180 (60%), Gaps = 10/180 (5%)

Query: 243 QDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEY 302
           +D    I + NL   H T  ++ + L+ +G  +R  + T+ N+ SSRSH++  I +  + 
Sbjct: 263 EDTQNHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHSVLQIHIM-QT 321

Query: 303 NGEIFRVSK-----MNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLT--- 354
           N  +   S+     ++++DLAGSE  S +  +  R  E  +IN+SLL LG  IN+L    
Sbjct: 322 NKLVDLTSQHTFATLSIIDLAGSERASATRNRGIRLHEGANINRSLLALGNCINALCLND 381

Query: 355 -DKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNK 413
             ++ H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 382 GSRTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 59/106 (55%), Gaps = 10/106 (9%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           +  D++F  +++Q  V+++   PL    + G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQVRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 129 LSESAGIIPRILFKLFETL-ELQKE-DYVVKCSFVELYNEELKDLL 172
                GII   + +LF  + +L+ E ++ +  S++E+YNE + DLL
Sbjct: 206 -PSQPGIIFLAMEELFNKISDLKDEKNFEISLSYLEIYNERISDLL 250

>TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa]
           {ON} Anc_3.528 YGL216W
          Length = 801

 Score =  116 bits (290), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 104/347 (29%), Positives = 156/347 (44%), Gaps = 55/347 (15%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           +  D++   ++ Q  VFQ   EPL    + GYN TV  YG T  GKTYT++G        
Sbjct: 110 FIFDKLLDQNSTQQHVFQSTTEPLLDSILDGYNGTVFAYGATGCGKTYTISGT------- 162

Query: 129 LSESAGIIPRILFKLFETLELQKE--DYVVKCSFVELYNEELKDLLGDSQEIASSRKLRI 186
             E+ GII   L  LF  +E  K+  +  +  S++E+YNE +KDLL  +    SS+KL I
Sbjct: 163 -PENPGIIFLTLQSLFNKIENLKDTKEISISLSYLEIYNESIKDLLDPT---ISSKKLVI 218

Query: 187 FDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQDQN 246
            +      + +++ST                 L   T          S T +++ S   +
Sbjct: 219 REDANNKISVSNLSTYSPATIEEVMDLIIQGNLNRTT----------SSTHANETSSRSH 268

Query: 247 AGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEI 306
           A + I      H+T         Q  L          ND +S      T+++      E 
Sbjct: 269 AVLQI------HLTQ--------QNKLN---------NDINSTEQLFSTLSIIDLAGSER 305

Query: 307 FRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFRESK 366
              +K     L    NI++S         A  IN S         S + + +H+P+R+SK
Sbjct: 306 AASTKNRGETLLEGANINKSLLALGNCINALCINTS---------SHSQQQIHIPYRDSK 356

Query: 367 LTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNK 413
           LTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK IK K
Sbjct: 357 LTRLLKFSLGGNCKTVMIVCVSPSSKHYDETLNTLKYANRAKEIKTK 403

>TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {ON} 
          Length = 672

 Score =  115 bits (288), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 116/409 (28%), Positives = 181/409 (44%), Gaps = 81/409 (19%)

Query: 12  VEELNITVAVRCRGRNEREIKAKSS-----VVVSVPDVTGSNEVSINTTGDVGITAQINS 66
           ++EL   + V CR R   + +A +S     + +   D     +  I     V    Q+++
Sbjct: 329 IQELRGNIRVYCRLRPYIKDEAATSNSDGYIFIKPFDANAGQQRII-----VNDLKQLHA 383

Query: 67  KTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYD 126
             +T D++FG   +   VF  I + L    + GYN  +  YG T +GKTYTM        
Sbjct: 384 --FTFDKIFGMQDDNYEVFDDI-KNLVQSSLDGYNVCIFTYGQTGSGKTYTM-------- 432

Query: 127 GELSESAGIIPRILFKLFE---TLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASSRK 183
             L+E  GII + +  +      L     +Y ++  F+E+YNE ++DLL    E      
Sbjct: 433 --LNEKDGIIMQTIEYIVHFAGNLHKLGWEYELEVEFIEIYNETIRDLLNP--EAKHQHV 488

Query: 184 LRIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELPTATFLRKRWKTAPSVTQSHQNSQ 243
           +R  D                                         K    VT +H+   
Sbjct: 489 IRHDDK----------------------------------------KGTTEVTNTHK--- 505

Query: 244 DQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFT--ITLYKE 301
                I + + +D  I  + +  +L++ G   R   +T MN+ SSRSH++F   IT +  
Sbjct: 506 ---ITIKLTHNEDDEIAKSAQIRQLIRNGNNTRNTKSTHMNNASSRSHSVFMMKITGHNR 562

Query: 302 YNGEIFRVSKMNLVDLAGSENISRSG--AQHQRAKEAGSINQSLLTLGRVINSLTDKSLH 359
              E     ++NLVDLAGSE + +       +  KE  SIN+SL  L  VI+S+  +  +
Sbjct: 563 ITQE-HSTGRLNLVDLAGSERLQQQEQITSQETLKETTSINKSLTCLADVIHSMKHRQPY 621

Query: 360 VPFRESKLTRLLQDSLGGNTKTALIATISPAKINS-EETCSTLQYAAKA 407
           +PFR SKLT LL++SL   +KT +   ISP  INS  ET ++L+ A K 
Sbjct: 622 IPFRNSKLTYLLKNSLINKSKTLMYVNISP-NINSIRETINSLRLARKV 669

>Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  115 bits (289), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 108/180 (60%), Gaps = 10/180 (5%)

Query: 243 QDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEY 302
           +D    I + NL   H T  ++ + L+ +G  +R  + T+ N+ SSRSH +  I +  + 
Sbjct: 263 EDTQNHIKVANLSYHHPTTVEDVMNLVVQGNINRTTSPTEANEVSSRSHAVLQIHIM-QT 321

Query: 303 NGEIFRVSK-----MNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLT--- 354
           N  +   S+     ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L    
Sbjct: 322 NKLVDLTSQHTFATLSVIDLAGSERAAATRNRGLRLHEGANINRSLLALGNCINALCLND 381

Query: 355 -DKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNK 413
             ++ H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 382 GSRTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 60/106 (56%), Gaps = 10/106 (9%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           +  D++F  +++Q+ V+++   PL    + GYN TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQTQVYKETTSPLLDSVLDGYNSTVFAYGATGCGKTYTVSGT------- 205

Query: 129 LSESAGIIPRILFKLFETLELQKED--YVVKCSFVELYNEELKDLL 172
                G+I   + +LF  ++  K++  + +  S++E+YNE ++DLL
Sbjct: 206 -PSQPGVIFLAMEELFNKIDDLKDEKNFEISLSYLEIYNERIRDLL 250

>KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528
           YGL216W
          Length = 723

 Score =  115 bits (287), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 68/180 (37%), Positives = 106/180 (58%), Gaps = 9/180 (5%)

Query: 243 QDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEY 302
           +D N  I + NL      + ++ + L+ +G  +R  + T+ N  SSRSH +  I + +  
Sbjct: 253 EDSNEKISVSNLSYHSPRSVQDVLDLVIRGNDNRTTSPTEANSVSSRSHAVLQIHIMQRN 312

Query: 303 N----GEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSL----- 353
                 E      ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L     
Sbjct: 313 KLVDLKEHQTFGTLSIIDLAGSERAAATKNRGRRLHEGANINRSLLALGNCINALCSNDG 372

Query: 354 TDKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNK 413
           + ++ HVP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 373 SHRNQHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSAHYDETLNTLKYANRAKEIKTK 432

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 58/114 (50%), Gaps = 10/114 (8%)

Query: 61  TAQINSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTG 120
           T   +   +  D++F    +Q  V++     L    + G+N TV  YG T  GKTYT++G
Sbjct: 135 TGSADETKFVFDKLFDTDVSQEDVYRGTTSTLLDSVLDGFNGTVFAYGATGCGKTYTVSG 194

Query: 121 DEKLYDGELSESAGIIPRILFKLFETLE--LQKEDYVVKCSFVELYNEELKDLL 172
                     E+ GII R + +LF  ++     +D+ +  SF+E+YNE + DLL
Sbjct: 195 TR--------ENPGIIFRTMEELFVKMDALAGTKDFELTVSFLEIYNETIHDLL 240

>KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 769

 Score =  115 bits (287), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 103/174 (59%), Gaps = 10/174 (5%)

Query: 250 YIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEIFR- 308
           ++ NL      N +E + L+ KG  +R  + T  N+ SSRSH +  I + +       + 
Sbjct: 241 FVSNLSKHSPENVEEVMDLVIKGNMNRTTSPTDANETSSRSHAVLQIHVAQMNRTADIKQ 300

Query: 309 ---VSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSL------TDKSLH 359
               + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L      T  S H
Sbjct: 301 DQTFATLSIIDLAGSERAAVTKNRGERLLEGANINRSLLALGNCINALCVSSTRTGFSCH 360

Query: 360 VPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNK 413
           VP+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK IK K
Sbjct: 361 VPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSGHYDETLNTLKYANRAKEIKTK 414

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 63/120 (52%), Gaps = 13/120 (10%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           +  D +F     Q  V++    PL    + G+N TV  YG T  GKT+T++G        
Sbjct: 124 FIFDRIFDMDVTQQEVYENTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISGT------- 176

Query: 129 LSESAGIIPRILFKLFETLELQKE--DYVVKCSFVELYNEELKDLLGDSQEIASSRKLRI 186
            SE  GII   + +LF  +E  K+   + ++ SF+E+YNE++ DLL  +    SS+KL I
Sbjct: 177 -SEQPGIIFLTMQELFIRMEQLKDTKKFQLQLSFLEIYNEQIHDLLDPN---ISSKKLVI 232

>YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}
           KIP3Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 805

 Score =  115 bits (287), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 107/180 (59%), Gaps = 10/180 (5%)

Query: 243 QDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEY 302
           +D    I + NL   H    ++ + L+ +G  +R  + T+ N+ SSRSH +  I +  + 
Sbjct: 263 EDTQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIM-QT 321

Query: 303 NGEIFRVSK-----MNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLT--- 354
           N  +   S+     ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L    
Sbjct: 322 NKLVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLND 381

Query: 355 -DKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNK 413
             +S H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 382 GSRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 68.6 bits (166), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 61/106 (57%), Gaps = 10/106 (9%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           +  D++F  +++Q+ V+++   PL    + G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 129 LSESAGIIPRILFKLFETL-ELQKE-DYVVKCSFVELYNEELKDLL 172
                GII   + +LF  + +L+ E D+ +  S++E+YNE ++DLL
Sbjct: 206 -PSQPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNERIRDLL 250

>AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL216W
           (KIP3)
          Length = 818

 Score =  112 bits (281), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 68/180 (37%), Positives = 105/180 (58%), Gaps = 10/180 (5%)

Query: 243 QDQNAGIYIQNLQDFHITNAKEGI-KLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKE 301
           +D ++   + NL  +H     E +  L+ +G  +R  + T  N+ SSRSH +  + + + 
Sbjct: 238 EDSDSTTTVANLS-YHTPETVEDVMDLVIRGNVNRTTSPTDANETSSRSHAVLQVHVVQS 296

Query: 302 YNGEIFRVSKM----NLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLT--- 354
                 +  KM    +++DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L    
Sbjct: 297 SRTVDLKEDKMYATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMTG 356

Query: 355 -DKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNK 413
                HVP+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK+IK K
Sbjct: 357 RRAVCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIKTK 416

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 68/128 (53%), Gaps = 11/128 (8%)

Query: 48  NEVSINTTGDVGITAQINS-KTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLV 106
           N + + + G+V    + N  + +  D++F   A+Q  VFQ    PL    + G+N TV  
Sbjct: 106 NTMLVGSRGEVRRRMRRNGEQKFMFDKLFDVDASQQDVFQCTTMPLLDSILDGFNGTVFA 165

Query: 107 YGMTSTGKTYTMTGDEKLYDGELSESAGIIPRILFKLFETLELQKE--DYVVKCSFVELY 164
           YG T  GKT+T++G          +S GII   + +LF+ +   K+   + +  S++E+Y
Sbjct: 166 YGATGCGKTFTISG--------TPDSPGIIFLTMQELFQRINNLKDTKTFELTVSYLEIY 217

Query: 165 NEELKDLL 172
           NE ++DLL
Sbjct: 218 NETIRDLL 225

>Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar to
           Ashbya gossypii AER441C
          Length = 833

 Score =  112 bits (279), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 104/179 (58%), Gaps = 8/179 (4%)

Query: 243 QDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEY 302
           +D +    + NL      + ++ + L+ KG  +R  + T  N+ SSRSH +  I + +  
Sbjct: 240 EDTDNTTTVANLSYHTPRSVQDVMDLVIKGNINRTTSPTDANETSSRSHAVLQIHVVQSS 299

Query: 303 NGEIFRVSK----MNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKS- 357
                +  K    ++++DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L     
Sbjct: 300 RSVDLKEDKTYATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMTGR 359

Query: 358 ---LHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNK 413
               HVP+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK+IK K
Sbjct: 360 RTYCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIKTK 418

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 67/128 (52%), Gaps = 11/128 (8%)

Query: 48  NEVSINTTGDVGITAQINS-KTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLV 106
           N + + + G++    + N  + +  D++F   A Q  VF     PL    I G+N TV  
Sbjct: 108 NTMLVGSRGEIRRRMRRNGEQKFMFDKLFDVEATQQDVFLGTTRPLLDSIIDGFNGTVFA 167

Query: 107 YGMTSTGKTYTMTGDEKLYDGELSESAGIIPRILFKLFETLELQKE--DYVVKCSFVELY 164
           YG T  GKT+T++G          E+ GII   + +LF+ +E  K+   + +  S++E+Y
Sbjct: 168 YGATGCGKTFTISG--------TPENPGIIFLTMQELFQRIENLKDTKTFQLTVSYLEIY 219

Query: 165 NEELKDLL 172
           NE ++DLL
Sbjct: 220 NEMIRDLL 227

>KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa]
           {ON} Anc_3.479 YPR141C
          Length = 764

 Score =  109 bits (272), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 96/153 (62%), Gaps = 4/153 (2%)

Query: 259 ITNAKEGI-KLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYK-EYNGEIFRVSKMNLVD 316
           +  +KE + K+L++  K R  A+T  N+ SSRSH+IF I L+   +  +      +NLVD
Sbjct: 602 VLESKESVDKVLKRATKLRSTASTLSNEHSSRSHSIFIIELHGVNHKTKEESCGVLNLVD 661

Query: 317 LAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSL--HVPFRESKLTRLLQDS 374
           LAGSE +  S    +R +E  +IN+SL  LG VI +L DK+   H+PFR SKLT LLQ S
Sbjct: 662 LAGSERVHSSQVTGERLRETQNINRSLSCLGDVIYALNDKNTKRHIPFRNSKLTYLLQYS 721

Query: 375 LGGNTKTALIATISPAKINSEETCSTLQYAAKA 407
           L GN+KT +   ISP+  +  ET ++L++A+K 
Sbjct: 722 LVGNSKTLMFVNISPSSSHINETINSLRFASKV 754

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 58/108 (53%), Gaps = 14/108 (12%)

Query: 68  TYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDG 127
           ++  D++F    +   VF+++ + L    + GYN  +  YG T +GKTYTM         
Sbjct: 471 SFKFDKIFDTGESNDEVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM--------- 520

Query: 128 ELSESAGIIPRILFKLFETLELQKE---DYVVKCSFVELYNEELKDLL 172
            L  + G+IP  +  +F+ +E  KE   +Y + C FVE+YNE + DLL
Sbjct: 521 -LHPNDGVIPATISHIFDWVENLKERGWEYKISCQFVEIYNENIVDLL 567

>Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}
           complement(87351..89429) [2079 nt, 693 aa]
          Length = 692

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 93/149 (62%), Gaps = 6/149 (4%)

Query: 268 LLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYN--GEIFRVSKMNLVDLAGSENISR 325
           L++K  K R  ATT  N+ SSRSH+IF I L    N  GE      +NLVDLAGSE ++ 
Sbjct: 539 LIKKATKLRATATTAANERSSRSHSIFIIHLRGSNNITGE-SSYGILNLVDLAGSERLNS 597

Query: 326 SGAQHQRAKEAGSINQSLLTLGRVINSL--TDKS-LHVPFRESKLTRLLQDSLGGNTKTA 382
           S  +  R +E  +IN+SL  LG VI++L  +D S  H+PFR SKLT LLQ SL GN+KT 
Sbjct: 598 SQVEGARLRETQNINKSLSCLGDVIHALGSSDASKRHIPFRNSKLTYLLQYSLTGNSKTL 657

Query: 383 LIATISPAKINSEETCSTLQYAAKAKNIK 411
           +   ISP +   +ET ++L++A+K    K
Sbjct: 658 MFVNISPTQQQIQETLNSLRFASKVNTTK 686

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 81/173 (46%), Gaps = 17/173 (9%)

Query: 3   AMPQASGEDVEELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITA 62
            M ++   D++EL   + V CR R    +K+   +  +   V   N+   N + ++    
Sbjct: 334 TMRRSLHNDLQELRGNIRVFCRIR--PPLKSVEDINTNHIKVQPFNDNHGNQSMEIVKDH 391

Query: 63  QINSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDE 122
           +   K +  D +F        VF +I + L    + GYN  +  YG T +GKT+TM    
Sbjct: 392 RCIQK-FQFDRIFDQHEVNKDVFDEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM---- 445

Query: 123 KLYDGELSESAGIIPRILFKLFETLELQKE---DYVVKCSFVELYNEELKDLL 172
                 L+ + G+IP  +  +F+  +  KE   +Y V C FVE+YNE + DLL
Sbjct: 446 ------LNPNDGMIPATIDHIFDWTDSLKERGWEYEVSCQFVEIYNENIIDLL 492

>AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR141C (KAR3)
          Length = 709

 Score =  107 bits (267), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 69/182 (37%), Positives = 104/182 (57%), Gaps = 7/182 (3%)

Query: 236 TQSHQNSQD-QNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIF 294
           +Q H    D +  G YI N+    +T+  +   +L+K  K R  A T+ N+ SSRSH++F
Sbjct: 525 SQKHDIRHDHEKQGTYITNVTRMKMTSTSQVDTILKKASKMRSTAATRSNERSSRSHSVF 584

Query: 295 TITLYKE--YNGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINS 352
            + +     + GE  +  K+NLVDLAGSE I+ S    +R +E  +IN+SL  LG VI +
Sbjct: 585 MVHINGRNLHTGETSQ-GKLNLVDLAGSERINSSAVTGERLRETQNINKSLSCLGDVIYA 643

Query: 353 LTDKSL---HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKN 409
           L        ++PFR SKLT LLQ SL G++KT +   I P   +  ET ++L++A+K  +
Sbjct: 644 LNTPDAGKRYIPFRNSKLTYLLQYSLVGDSKTLMFVNIPPDPNHISETLNSLRFASKVNS 703

Query: 410 IK 411
            K
Sbjct: 704 TK 705

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 83/170 (48%), Gaps = 22/170 (12%)

Query: 11  DVEELNITVAVRCRGRNE--REIKAKSSVVVS-VPDVTGSNEVSINTTGDVGITAQINSK 67
           +++EL   + V CR R     E +  S +++    +  G+  ++IN         +I S 
Sbjct: 359 ELQELRGNIRVYCRVRPPLLNEPQDMSHILIEKFNEAKGAQSLTINRN-----EGRILSY 413

Query: 68  TYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDG 127
            +  D +F PS     +F++I + L    + GYN  +  YG T +GKTYTM         
Sbjct: 414 NFQFDMIFEPSHTNKEIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM--------- 463

Query: 128 ELSESAGIIPRIL---FKLFETLELQKEDYVVKCSFVELYNEELKDLLGD 174
            L+   G+IP  L   FK    L+ +  +Y ++C ++E+YNE + DLL D
Sbjct: 464 -LNAGDGMIPMTLSHIFKWTANLKERGWNYEMECEYIEIYNETILDLLRD 512

>KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]
           {ON} similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141C KAR3 Minus-end-directed microtubule motor that
           functions in mitosis and meiosis localizes to the
           spindle pole body and localization is dependent on
           functional Cik1p required for nuclear fusion during
           mating potential Cdc28p substrate
          Length = 702

 Score =  107 bits (266), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 100/167 (59%), Gaps = 14/167 (8%)

Query: 258 HITN-------AKEGI-KLLQKGLKHRQVATTKMNDFSSRSHTIFTITL--YKEYNGEIF 307
           HITN       ++E + ++L++ LK R  A T  N  SSRSH++F I L  Y   +GE  
Sbjct: 532 HITNITVCKLTSREMVNRMLRRALKMRSTAATVANSRSSRSHSVFIIKLDGYNTISGEK- 590

Query: 308 RVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSL--TDKS-LHVPFRE 364
               +NLVDLAGSE I     Q +R +E  +IN+SL  LG VI++L   D S  H+PFR 
Sbjct: 591 STGTLNLVDLAGSERIHSLQPQAERLRETQNINKSLSCLGDVIHALGSADASKRHIPFRN 650

Query: 365 SKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIK 411
           SKLT LLQ SL G++KT +   +SP   +  ET ++L++AAK  + K
Sbjct: 651 SKLTYLLQYSLMGDSKTLMFVNVSPCANSMLETLNSLRFAAKVNSTK 697

 Score = 70.9 bits (172), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 53/167 (31%), Positives = 78/167 (46%), Gaps = 23/167 (13%)

Query: 11  DVEELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSK--T 68
           +++EL   + V CR R   E +  SS  + +   +       + TG   IT + +SK   
Sbjct: 356 ELQELRGNIRVFCRLRPALENENYSSSSIEIEKFS-------DETGMQSITIKRDSKQHK 408

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           +T D  F        VF +I + L    + GYN  +  YG T +GKT+TM          
Sbjct: 409 FTFDRCFSAQETNGDVFSEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTFTM---------- 457

Query: 129 LSESAGIIPRILFKLFETLELQKE---DYVVKCSFVELYNEELKDLL 172
           L+ + GIIP  L  +F  +E  KE    Y +   FVE+YNE +KDL 
Sbjct: 458 LNPNDGIIPSTLNHIFLWVEKLKELGWVYEITSQFVEIYNENIKDLF 504

>Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]
           {ON} complement(235625..237718) [2094 nt, 698 aa]
          Length = 697

 Score =  106 bits (265), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 104/158 (65%), Gaps = 6/158 (3%)

Query: 255 QDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEIFRVSK--M 312
           +D   +N +E  +L+Q+  K R+ A T MN+ SSRSH++F + + + +N +     K  +
Sbjct: 538 EDLIESNRRELQELVQRLNKVRRTAKTAMNNRSSRSHSVFIVEV-EGFNKDSEERCKGVL 596

Query: 313 NLVDLAGSENISRSG-AQHQRAKEAGSINQSLLTLGRVINSLTDKS--LHVPFRESKLTR 369
           NLVDLAGSE ++RSG    +R +E   IN+SL ++G VI++L   S  LH+PFR +KLT 
Sbjct: 597 NLVDLAGSERMNRSGLVDKERIEETKQINKSLSSVGDVIHALRQGSGSLHIPFRNTKLTY 656

Query: 370 LLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKA 407
           LL+ SL G++KT ++ T+SP+  +  ET ++L++A K 
Sbjct: 657 LLKHSLQGSSKTLMLVTVSPSNSSRNETMNSLRFATKV 694

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 56/114 (49%), Gaps = 14/114 (12%)

Query: 66  SKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 125
           S  +  D++F    +   VF ++ E L    + G+N  +  YG T +GKTYTM       
Sbjct: 405 SVNFQFDKIFNYDESNRQVFGEVKE-LVQSALDGHNVCIFTYGQTGSGKTYTM------- 456

Query: 126 DGELSESAGIIPRILFKLFETLELQKE---DYVVKCSFVELYNEELKDLLGDSQ 176
              L+E  GIIP  L  + +     K+    Y +K  FVE+YN+ + DLL D +
Sbjct: 457 ---LNEEDGIIPSTLDHIIDWTSSMKKLGWQYGLKIKFVEIYNDRIFDLLNDGK 507

>KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa]
           {ON} Anc_3.479 YPR141C
          Length = 706

 Score =  106 bits (265), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 94/151 (62%), Gaps = 8/151 (5%)

Query: 267 KLLQKGLKHRQVATTKMNDFSSRSHTIFTITLY---KEYNGEIFRVSKMNLVDLAGSENI 323
           K+L +  K R  A+TK N+ SSRSH+IF I L+    + N + + +  +NLVDLAGSE I
Sbjct: 554 KVLHRATKLRSTASTKSNEHSSRSHSIFIIHLHGKNSKTNEDSYGI--LNLVDLAGSERI 611

Query: 324 SRSGAQHQRAKEAGSINQSLLTLGRVINSLTD---KSLHVPFRESKLTRLLQDSLGGNTK 380
           + S    +R +E   IN+SL  LG VI++L     K  H+PFR SKLT LL+ SL GN+K
Sbjct: 612 NSSQVSGERLRETQHINKSLSCLGDVIHALNSSEHKERHIPFRNSKLTHLLKYSLSGNSK 671

Query: 381 TALIATISPAKINSEETCSTLQYAAKAKNIK 411
           T +   IS +  +  ET ++L++A+K  + K
Sbjct: 672 TLMFVNISASLNHVNETINSLRFASKVNSTK 702

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 47/149 (31%), Positives = 77/149 (51%), Gaps = 15/149 (10%)

Query: 55  TGDVGITAQINSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGK 114
           T  + IT   N+  Y  D++F    + S +F+++ + L    + GYN  +  YG T +GK
Sbjct: 407 TQTMEITKNNNTNKYKFDKIFDQFESNSEIFKEVGQ-LVQSALDGYNVCIFAYGQTGSGK 465

Query: 115 TYTMTGDEKLYDGELSESAGIIP---RILFKLFETLELQKEDYVVKCSFVELYNEELKDL 171
           T+TM          L+ S GIIP   R +F   + L+ +  +Y + C FVE+YNE + DL
Sbjct: 466 TFTM----------LNPSDGIIPSTVRHIFTWIDNLKERGWEYQINCQFVEIYNENIIDL 515

Query: 172 LGDSQEIASSRKLRIFDSNTMSAATNSMS 200
           L + Q  +    +R  D +  ++ TN M+
Sbjct: 516 LREKQ-TSQKHDIRHDDESQTTSITNVMT 543

>KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 690

 Score =  103 bits (257), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 91/147 (61%), Gaps = 4/147 (2%)

Query: 268 LLQKGLKHRQVATTKMNDFSSRSHTIFTITLY--KEYNGEIFRVSKMNLVDLAGSENISR 325
           +L+   K + +A T  N+ SSRSH++FTI ++      GE      +NLVDLAGSE I  
Sbjct: 541 VLRTANKTKSIAATNSNERSSRSHSVFTIRIHGTNSITGEA-SDGVLNLVDLAGSERIDT 599

Query: 326 SGAQHQRAKEAGSINQSLLTLGRVINSLTDKSL-HVPFRESKLTRLLQDSLGGNTKTALI 384
           S     R +E  +IN+SL  LG VI +L  K + H+PFR SKLT LLQ SL G++KT + 
Sbjct: 600 SNVTGDRLRETQNINKSLSCLGDVIYALNGKDMKHIPFRNSKLTYLLQYSLIGDSKTLMF 659

Query: 385 ATISPAKINSEETCSTLQYAAKAKNIK 411
             +SP+  + +ET ++L++A+K  + K
Sbjct: 660 VNVSPSSNHVKETLNSLRFASKVNSTK 686

 Score = 77.4 bits (189), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 84/167 (50%), Gaps = 23/167 (13%)

Query: 11  DVEELNITVAVRCRGRN--EREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKT 68
           +++EL   + V CR R   E E++  S + VS  D       + N +  + I+ +  +  
Sbjct: 351 ELQELRGNIRVYCRIRPPLENEVQDISHIHVSNFD-------NRNGSQAIEISNEDRNSR 403

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           +  D+VF  +A+   VF+++ + L    + GYN  +  YG T +GKTYTM  D       
Sbjct: 404 FLFDKVFSSNASNRDVFEEVGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTMMND------- 455

Query: 129 LSESAGIIPRILFKLFETLELQKE---DYVVKCSFVELYNEELKDLL 172
                G+IP  L  +F+   L KE   DY  +  F+E+YNE++ DLL
Sbjct: 456 ---PDGVIPMTLDHIFDWTHLLKERGWDYSFEAQFIEIYNEQIVDLL 499

>NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa]
           {ON} Anc_3.479
          Length = 763

 Score =  103 bits (257), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 92/154 (59%), Gaps = 11/154 (7%)

Query: 268 LLQKGLKHRQVATTKMNDFSSRSHTIFTITL--YKEYNGEIFRVSKMNLVDLAGSENISR 325
           +L++  K R  A+T  N+ SSRSH+IF I L    E  GE      +NLVDLAGSE I+ 
Sbjct: 603 ILRRANKLRSTASTLSNEHSSRSHSIFIIHLKGTNEITGEK-SYGILNLVDLAGSERINS 661

Query: 326 SGAQHQRAKEAGSINQSLLTLGRVINSLTD--------KSLHVPFRESKLTRLLQDSLGG 377
           S    +R +E  +IN+SL  LG VI++LT         K  H+PFR SKLT LLQ SL G
Sbjct: 662 SQVTGERLRETQNINRSLSCLGDVIHALTGSEKDKENAKKRHIPFRNSKLTYLLQYSLIG 721

Query: 378 NTKTALIATISPAKINSEETCSTLQYAAKAKNIK 411
           N+KT +   ISP+     ET ++L++A+K  + K
Sbjct: 722 NSKTLMFVNISPSINYVNETLNSLRFASKVNSAK 755

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 76/168 (45%), Gaps = 18/168 (10%)

Query: 12  VEELNITVAVRCRGRNE---REIKAKSSVVVS-VPDVTGSNEVSINTTGDVGITAQINSK 67
           ++EL   + V CR R     +E    S + VS   D  G+  + I    +   +    + 
Sbjct: 392 LQELRGNIRVYCRIRPPILPQESNNTSHLKVSEFDDNNGTQTLEIQKALNNNSSNNSTTL 451

Query: 68  TYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDG 127
            +  D++F  +     VF+++ + L    + GYN  +  YG T +GKTYTM         
Sbjct: 452 KFKFDKIFNQNETNDDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM--------- 501

Query: 128 ELSESAGIIPRILFKLFETLELQKE---DYVVKCSFVELYNEELKDLL 172
            L    GIIP  +  +F      KE    Y ++C FVE+YNE + DLL
Sbjct: 502 -LHPKDGIIPATISHIFNWTNNLKERGWKYEIECEFVEIYNENIVDLL 548

>TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {ON}
           Anc_3.479 YPR141C
          Length = 724

 Score =  103 bits (256), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 92/150 (61%), Gaps = 8/150 (5%)

Query: 268 LLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEIFRVSK---MNLVDLAGSENIS 324
           +L+K  K R  A T  N+ SSRSH++F I  Y +   EI   S    +NLVDLAGSE ++
Sbjct: 571 VLKKATKLRATAATNSNERSSRSHSVFMI--YLKGKNEITGDSSEGILNLVDLAGSERLN 628

Query: 325 RSGAQHQRAKEAGSINQSLLTLGRVINSL---TDKSLHVPFRESKLTRLLQDSLGGNTKT 381
            S A   R +E  +IN+SL  LG VI++L    +   H+PFR SKLT LLQ SL G++KT
Sbjct: 629 SSQAVGARLRETQNINKSLSCLGDVIHALGQNDNTKRHIPFRNSKLTYLLQYSLTGSSKT 688

Query: 382 ALIATISPAKINSEETCSTLQYAAKAKNIK 411
            +   ISP K +  ET ++L++A+K  + K
Sbjct: 689 LMFVNISPTKSHLNETINSLRFASKVNSTK 718

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 74/144 (51%), Gaps = 19/144 (13%)

Query: 66  SKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 125
           S+ Y  D +F  + + + VF++I + L    + G+N  +  YG T +GKTYTM       
Sbjct: 427 SQIYKFDRIFDQADSNTEVFKEIGQ-LVQSSLDGHNVCIFAYGQTGSGKTYTM------- 478

Query: 126 DGELSESAGIIPRILFKLFETLELQKED---YVVKCSFVELYNEELKDLL----GDSQEI 178
              L+++ G+IP  +  +F+  E  KE    Y + C F+E+YNE + DLL     D  E 
Sbjct: 479 ---LNDNDGMIPATISHIFDWTESMKEKGWIYDISCQFIEIYNEGIIDLLRDNSTDGNEA 535

Query: 179 ASSRKLRI-FDSNTMSAATNSMST 201
            S  K  I  D  TM+ +  +++T
Sbjct: 536 GSPNKHEIRHDKETMTTSVTNINT 559

>Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {ON}
           complement(20458..22401) [1944 nt, 648 aa]
          Length = 647

 Score =  102 bits (254), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 117/442 (26%), Positives = 193/442 (43%), Gaps = 119/442 (26%)

Query: 51  SINTTGDVGITA----QINSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLV 106
           SIN T D  +T     Q+ +  Y  D+VF  S +  +  Q+  E      ++GYN +++ 
Sbjct: 52  SINFT-DTQLTGFSKDQVVNTQYKFDKVFA-SNDTGVEHQEFIESNLESLLQGYNTSIVT 109

Query: 107 YGMTSTGKTYTMTGDEKLYDGELSESAGIIPRILFKLFETLELQKED------YVVKCSF 160
           YG + TGK++ + G+++          G+I ++L KLF  ++ +  +      Y VK SF
Sbjct: 110 YGQSGTGKSFELYGEQQ---------DGLIFQLLTKLFNRIDEEMGNNNKNIHYTVKFSF 160

Query: 161 VELYNEELKDLLGDSQEIASSRKLRIFDSNTMSAATNSMSTGXXXXXXXXXXXXXXXELP 220
           +E+Y E++ D L DS  +   + L+I D      +T +M+                    
Sbjct: 161 LEVYQEKMFD-LMDSPSVK--KHLKIND------STYAMN-------------------- 191

Query: 221 TATFLRKRWKTAPSVTQSHQNSQDQNAGIYIQNLQDFHITNAKE-----GIKLLQKGLKH 275
                                      G  ++NL+   +   +E      I LL +  +H
Sbjct: 192 ---------------------------GFQVENLRTTQVLTLEELKILINICLLNQKERH 224

Query: 276 RQVATTKMNDFSSRSHTIFTITLYKEYN-GEIFRVSKMNLVDLAGSENISRSGAQHQRAK 334
                   N+   RSHTI  +++ K     E   +S + +VDLAGS+ I ++ +     +
Sbjct: 225 --------NNLIQRSHTIMEVSIEKRNKLDESITMSSLYIVDLAGSDPIGKNSSSGITTE 276

Query: 335 EAGSINQSLLTLGRVINSL----------TDKS--LH-VPFRESKLTRLLQDSLGGNTKT 381
           +A  IN  + ++  VIN L          TD S  +H VP++ S LTRLL D LGGN KT
Sbjct: 277 DAKKINHQIKSVNDVINGLVVMNREGGIMTDISTLMHKVPYKSSILTRLLLDPLGGNCKT 336

Query: 382 ALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKDILVKNITGELAKIKADLL 441
             + T S  K +  ET STL++    K+    P++           N  G  +K   D+ 
Sbjct: 337 TFLLTSSLKKNDWNETLSTLKFGYNCKSANTNPRI-----------NRFGLNSKATMDIF 385

Query: 442 STKSKEGIYMSQDNYKELTNDL 463
            T  K    + +DN+  +TN+L
Sbjct: 386 LTDMK----LKEDNFISITNNL 403

>YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON}
           KAR3Minus-end-directed microtubule motor that functions
           in mitosis and meiosis, localizes to the spindle pole
           body and localization is dependent on functional Cik1p,
           required for nuclear fusion during mating; potential
           Cdc28p substrate
          Length = 729

 Score = 98.6 bits (244), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 85/144 (59%), Gaps = 4/144 (2%)

Query: 268 LLQKGLKHRQVATTKMNDFSSRSHTIFTITLY-KEYNGEIFRVSKMNLVDLAGSENISRS 326
           +L+K  K R  A+T  N+ SSRSH+IF I L              +NLVDLAGSE I+ S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNAKTGAHSYGTLNLVDLAGSERINVS 636

Query: 327 GAQHQRAKEAGSINQSLLTLGRVINSLTDK---SLHVPFRESKLTRLLQDSLGGNTKTAL 383
                R +E  +IN+SL  LG VI++L        H+PFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 384 IATISPAKINSEETCSTLQYAAKA 407
              ISP+  +  ET ++L++A+K 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 81/166 (48%), Gaps = 17/166 (10%)

Query: 11  DVEELNITVAVRCRGRNE-REIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTY 69
           +++EL   + V CR R   + ++   + +++V +   ++ V       +  TAQ++   +
Sbjct: 379 ELQELRGNIRVYCRIRPALKNLENSDTSLINVNEFDDNSGVQSMEVTKIQNTAQVHE--F 436

Query: 70  TVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGEL 129
             D++F        VF+++ + L    + GYN  +  YG T +GKT+TM          L
Sbjct: 437 KFDKIFDQQDTNVDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM----------L 485

Query: 130 SESAGIIPRIL---FKLFETLELQKEDYVVKCSFVELYNEELKDLL 172
           +   GIIP  +   F     L+ +  DY V C F+E+YNE + DLL
Sbjct: 486 NPGDGIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLL 531

>Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {ON}
           YPR141C (REAL)
          Length = 731

 Score = 98.2 bits (243), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 89/146 (60%), Gaps = 6/146 (4%)

Query: 267 KLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEIFRVS--KMNLVDLAGSENIS 324
           ++L++  K R  A+T  N+ SSRSH+IF I L    N +    S   +NLVDLAGSE I+
Sbjct: 575 RVLKRANKLRSTASTASNEHSSRSHSIFIIHL-SGLNAKTGAQSYGTLNLVDLAGSERIN 633

Query: 325 RSGAQHQRAKEAGSINQSLLTLGRVINSLTDK---SLHVPFRESKLTRLLQDSLGGNTKT 381
            S     R +E  +IN+SL  LG VI++L        H+PFR SKLT LLQ SL G++KT
Sbjct: 634 ISQVVGDRLRETQNINKSLSCLGDVIHALGQPDSAKRHIPFRNSKLTYLLQYSLTGDSKT 693

Query: 382 ALIATISPAKINSEETCSTLQYAAKA 407
            +   ISP+  +  ET ++L++A+K 
Sbjct: 694 LMFVNISPSSSHINETLNSLRFASKV 719

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 79/166 (47%), Gaps = 17/166 (10%)

Query: 11  DVEELNITVAVRCRGRNERE-IKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTY 69
           +++EL   + V CR R   E ++   + +++V +   +  V       +  T Q++   +
Sbjct: 379 ELQELRGNIRVYCRIRPPLESLENLDTSLINVNEFDDNRGVQSMEVTKIQNTPQVHE--F 436

Query: 70  TVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGEL 129
             D++F        VF+++ + L    + GYN  +  YG T +GKT+TM          L
Sbjct: 437 KFDKIFDQRNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM----------L 485

Query: 130 SESAGIIPRIL---FKLFETLELQKEDYVVKCSFVELYNEELKDLL 172
           +   GIIP  +   F     L+ +  DY V C F+E+YNE + DLL
Sbjct: 486 NPGDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLL 531

>ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 731

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 64/149 (42%), Positives = 90/149 (60%), Gaps = 6/149 (4%)

Query: 268 LLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEIFRVSK--MNLVDLAGSENISR 325
           LL+K  + R  A+T  N+ SSRSH++F I L K  N      S   +NLVDLAGSE I+ 
Sbjct: 566 LLRKANRLRSTASTSANERSSRSHSVFIIFL-KGSNHLTGEQSDGILNLVDLAGSERINS 624

Query: 326 SGAQHQRAKEAGSINQSLLTLGRVINSLTDKSL---HVPFRESKLTRLLQDSLGGNTKTA 382
           S    +R +E  +IN+SL  LG V+++L        H+PFR SKLT LLQ SL GN+KT 
Sbjct: 625 SQVLGERLRETQNINKSLSCLGDVVHALGSNDAAKRHIPFRNSKLTYLLQYSLTGNSKTL 684

Query: 383 LIATISPAKINSEETCSTLQYAAKAKNIK 411
           +   IS  + +  ET ++L++A+K  + K
Sbjct: 685 MFVNISACESHLNETLNSLRFASKVNSTK 713

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 86/181 (47%), Gaps = 20/181 (11%)

Query: 3   AMPQASGEDVEELNITVAVRCRGRNEREIKAKSSVVVSV---PDVTGSNEVSINTTGDVG 59
            M ++   +++EL   + V CR R   + +  ++  ++V    D  G   + I  + + G
Sbjct: 362 TMRRSLHNELQELRGNIRVFCRIRPPLKYENPNTAHLTVNKFDDENGCQTMEIVKSNNTG 421

Query: 60  ITAQINSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMT 119
            +   N   +  D +F  +     VF++I + L    + GYN  +  YG T +GKTYTM 
Sbjct: 422 NSIPQN---FKFDRIFDQNETNENVFEEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM- 476

Query: 120 GDEKLYDGELSESAGIIPRILFKLFETLELQKE---DYVVKCSFVELYNEELKDLLGDSQ 176
                    L+   GIIP  +  +F  +E  KE   +Y + C F+E+YNE + DLL   Q
Sbjct: 477 ---------LNPRNGIIPATISHIFSWIENLKERGWNYEINCQFIEIYNENIADLLRSDQ 527

Query: 177 E 177
           +
Sbjct: 528 D 528

>Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score = 97.8 bits (242), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 88/148 (59%), Gaps = 12/148 (8%)

Query: 268 LLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEIFRVSK-----MNLVDLAGSEN 322
           +L+K  K R  A+T  N+ SSRSH+IF I L    +G   +        +NLVDLAGSE 
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHL----SGSNTKTGAQSYGTLNLVDLAGSER 632

Query: 323 ISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDK---SLHVPFRESKLTRLLQDSLGGNT 379
           I+ S     R +E  +IN+SL  LG VI++L        H+PFR SKLT LLQ SL G++
Sbjct: 633 INISQVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDS 692

Query: 380 KTALIATISPAKINSEETCSTLQYAAKA 407
           KT +   ISP+  +  ET ++L++A+K 
Sbjct: 693 KTLMFVNISPSSSHINETLNSLRFASKV 720

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 81/166 (48%), Gaps = 17/166 (10%)

Query: 11  DVEELNITVAVRCRGRNERE-IKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTY 69
           +++EL   + V CR R   E ++   + +++V +   +  +       +  TAQ++   +
Sbjct: 379 ELQELRGNIRVYCRIRPALETLEDSDTSLINVNEFDDNCGIQSMEVTKIHNTAQVHE--F 436

Query: 70  TVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGEL 129
             D++F      + VF+++ + L    + GYN  +  YG T +GKT+TM          L
Sbjct: 437 KFDKIFDQKDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM----------L 485

Query: 130 SESAGIIPRIL---FKLFETLELQKEDYVVKCSFVELYNEELKDLL 172
           +   GIIP  +   F     L+ +  DY V C F+E+YNE + DLL
Sbjct: 486 NPGDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLL 531

>NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 100/195 (51%), Gaps = 31/195 (15%)

Query: 244 DQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYN 303
           D   G+ +  L +    +++E +  + KG K R+ A T  N  SSRSH I  I L     
Sbjct: 276 DSKYGVRVIGLTEKRCESSEELMNWIIKGDKIRKTAETDFNARSSRSHAIVLIRLTTSDM 335

Query: 304 GEIFRVSK-MNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKS----- 357
            +   +S  ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+ +S     
Sbjct: 336 KDGTSISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSTESNKNRS 392

Query: 358 ----------------------LHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSE 395
                                  H+P+R+SKLTRLLQ +L G++    I TI     +S 
Sbjct: 393 PTLPSPPLSSSSSSTSINSSVPGHIPYRDSKLTRLLQPALSGDSIVTTICTIDTKNESSA 452

Query: 396 ETCSTLQYAAKAKNI 410
           ET +TL++A++AKNI
Sbjct: 453 ETLNTLRFASRAKNI 467

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 61/111 (54%), Gaps = 11/111 (9%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           +  D VF    +   ++Q I  P+     +G+N T+  YGMT +GKTYTM G       E
Sbjct: 137 FKFDHVFNSFVSNLEIYQVINRPMIDKLFQGFNSTIFAYGMTGSGKTYTMMGCP-----E 191

Query: 129 LSESAGIIPRILFKLF-----ETLELQKEDYVVKCSFVELYNEELKDLLGD 174
             +  G+IP  +  LF     ETL+  K+  +V  S++E+YNE++ DLLGD
Sbjct: 192 REQKDGLIPLSVSYLFTKIMEETLDGDKKFEIV-LSYLEIYNEKIYDLLGD 241

>TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa]
           {ON} Anc_2.633 YKL079W
          Length = 644

 Score = 93.6 bits (231), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 81/259 (31%), Positives = 128/259 (49%), Gaps = 38/259 (14%)

Query: 247 AGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYN-GE 305
           + I I+NL+  ++T+  E +   +KG   R +A       SSRS  I  IT+ +  N  E
Sbjct: 187 SSISIKNLRCVYVTSLLEALSYCEKG---RSLA-------SSRSSVIIRITVEQRDNVKE 236

Query: 306 IFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSL--TDKSL----- 358
           +F+     LVDL  S+ I +        +    INQS++TL  V  SL  T++S+     
Sbjct: 237 VFKTGSFQLVDLGSSDKIDKQNNLGISPENTKKINQSMVTLENVARSLAGTEQSVKNGRP 296

Query: 359 -----HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNK 413
                ++P++ES LT+LLQ+++GGN KT L+   S AK + EET +TL + A  K +KN 
Sbjct: 297 RSGNYYIPYKESCLTQLLQETIGGNCKTTLVLMCSTAKQDEEETLNTLNFGANMKLVKN- 355

Query: 414 PQLGSVIMKDILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEVKEC 473
                     +  +N  G  +K   DLL     +     + NY+     LE     +K+ 
Sbjct: 356 ----------LFQQNKAGTNSKAMLDLL----MKDFDAKEKNYQSHIQLLEKELMNLKKL 401

Query: 474 KRAIETLTSQNTLLLKDKK 492
           +   ET   QN ++L++KK
Sbjct: 402 QYGSETADKQNEIMLENKK 420

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 52/112 (46%), Gaps = 11/112 (9%)

Query: 65  NSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKL 124
           N K + VD++F P A        I     A    GYN  ++ YG T +GKT TM G  K 
Sbjct: 67  NLKLFRVDQIFNPGAQTKDTTSSIIGDSVAQLFNGYNVAIMAYGQTDSGKTSTMFGYNK- 125

Query: 125 YDGELSESAGIIPRILFKLFETLELQKE---DYVVKCSFVELYNEELKDLLG 173
                    G+I  +  ++F T+E   E   DY +  S +E+  E ++DLL 
Sbjct: 126 -------GDGVINGVCKQIFTTVETGSENNIDYSISLSIIEVNCESIRDLLA 170

>KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8.678
           YPL155C
          Length = 625

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 66/184 (35%), Positives = 95/184 (51%), Gaps = 21/184 (11%)

Query: 244 DQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKE-- 301
           D   G+ +  + +     A+E +K +  G   R+   T  N  SSRSH I  + L     
Sbjct: 238 DPVLGVKVHGVLEQKCDTAEELMKWVSVGEAVRKTGKTDYNMRSSRSHAIIQVKLITTNL 297

Query: 302 YNGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKS---- 357
            NG     + ++L DLAGSE  S    Q +R KE   IN+SLL LG VI+ L+ +S    
Sbjct: 298 LNGTTH-FNTLSLCDLAGSEKASE---QLERRKEGSFINKSLLALGTVISKLSAESNAHD 353

Query: 358 -----------LHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAK 406
                       H+P+R+SKLTRLLQ +L  ++    I TI P K    ET +TL++A++
Sbjct: 354 SSRPSSGSLNNSHIPYRDSKLTRLLQPALCNDSVVTAICTIDPTKEAMTETVNTLRFASR 413

Query: 407 AKNI 410
           AKN+
Sbjct: 414 AKNV 417

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 72/172 (41%), Gaps = 25/172 (14%)

Query: 1   MVAMPQASGEDVEELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGI 60
            ++ P A+        ITVAVR        IK  +  V       G   ++    GD   
Sbjct: 78  FLSSPAATATRTNRATITVAVR--------IKPTAPNVDPQWHALGPRCIAHWDQGD--- 126

Query: 61  TAQINSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTG 120
                   +  D VFGP+A    +F ++   L      G N T+L YG T +GKTYTM G
Sbjct: 127 --------FQFDHVFGPTATNEDLFAELGGGLVEKLFDGCNATLLAYGTTGSGKTYTMVG 178

Query: 121 DEKLYDGELSESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLL 172
                DG +         +  ++    + ++    V  S++E+YNE++ DLL
Sbjct: 179 HN---DGIVKMCGDC---VFTRMLNAADERQVKRSVTVSYLEIYNEKICDLL 224

>Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa]
           {OFF} YPR141C (KAR3) - kinesin-like nuclear fusion
           protein [contig 452] PARTIAL
          Length = 588

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 77/167 (46%), Gaps = 19/167 (11%)

Query: 11  DVEELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYT 70
           +++EL   + V CR R   + + + S  +S+   +  N      T  + I  +     +T
Sbjct: 355 ELQELRGNIRVFCRLRPHLDNEKEDSSSISIDGFSDEN-----GTQCITIKREAKYHKFT 409

Query: 71  VDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELS 130
            D  FG   +   +F +I + L    + GYN  +  YG T +GKTYTM          L+
Sbjct: 410 FDRCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM----------LN 458

Query: 131 ESAGIIPRILFKLFETLELQKE---DYVVKCSFVELYNEELKDLLGD 174
              GIIP  L  +F  +E  KE    Y +   F+E+YNE +KDL  D
Sbjct: 459 PEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLFKD 505

>Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)
           [1974 bp, 657 aa] {ON} ANNOTATED BY YGOB -
          Length = 657

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 77/167 (46%), Gaps = 19/167 (11%)

Query: 11  DVEELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYT 70
           +++EL   + V CR R   + + + S  +S+   +  N      T  + I  +     +T
Sbjct: 355 ELQELRGNIRVFCRLRPHLDNEKEDSSSISIDGFSDEN-----GTQCITIKREAKYHKFT 409

Query: 71  VDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELS 130
            D  FG   +   +F +I + L    + GYN  +  YG T +GKTYTM          L+
Sbjct: 410 FDRCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM----------LN 458

Query: 131 ESAGIIPRILFKLFETLELQKE---DYVVKCSFVELYNEELKDLLGD 174
              GIIP  L  +F  +E  KE    Y +   F+E+YNE +KDL  D
Sbjct: 459 PEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLFKD 505

>YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Protein
           that interacts with Myo2p, proposed to be involved in
           exocytosis; N-terminal domain is related to the motor
           domain of kinesins
          Length = 656

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 65/129 (50%), Gaps = 12/129 (9%)

Query: 48  NEVSINTTGDVGITAQINSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVY 107
           N V   T   +  T +    T+  D+VF  +A Q  V + +  P+  D + GYN TV+ Y
Sbjct: 54  NTVLFRTNNPLHETTKETHSTFQFDKVFDANATQEDVQKFLVHPIINDVLNGYNGTVITY 113

Query: 108 GMTSTGKTYTMTGDEKLYDGELSESAGIIPRILFKLFETLELQKE----DYVVKCSFVEL 163
           G + +GK+Y++ G +        ES GI+P I   LF+TLE  +E     + V     E+
Sbjct: 114 GPSFSGKSYSLIGSK--------ESEGILPNICKTLFDTLEKNEETKGDSFSVSVLAFEI 165

Query: 164 YNEELKDLL 172
           Y E+  DLL
Sbjct: 166 YMEKTYDLL 174

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 60/217 (27%), Positives = 106/217 (48%), Gaps = 28/217 (12%)

Query: 288 SRSHTIFTITL-YKEYNGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTL 346
           SRSH +F + +  +    +I + S + LVDL G+E   +             +NQS+  L
Sbjct: 233 SRSHLVFQLHVEQRNRKDDILKNSSLYLVDLHGAEKFDKRTESTLSQDALKKLNQSIEAL 292

Query: 347 GRVINSLTDK----------SLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEE 396
              + SL+ K          S    +RES+LT +L+DSLGGN KT +I T   + + +  
Sbjct: 293 KNTVRSLSMKERDSAYSAKGSHSSAYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT-- 350

Query: 397 TCSTLQYAAKAKNIKNK----------PQLGSVIMKDILVK--NITGELAKIKADLLSTK 444
           T STL++    + I NK           +   + ++D+ +K  N   ++  +KA++ S K
Sbjct: 351 TLSTLEFGDSIRQINNKVTDNTTGLNLKKKMDLFIQDMKIKDDNYVAQINILKAEIDSLK 410

Query: 445 SKEGIYMSQDNYKELTNDLESYKTEVKECKRAIETLT 481
           S     + +D+ K++   LE+ K E  + K  ++++T
Sbjct: 411 SLHNKSLPEDDEKKM---LENTKKENIKLKLQLDSIT 444

>TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {ON}
           Anc_2.633 YKL079W
          Length = 682

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 70/271 (25%), Positives = 125/271 (46%), Gaps = 27/271 (9%)

Query: 245 QNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYK-EYN 303
           ++ G+ + NL+  H+ + KE +    + +    V  +K ++   R++TIF I + K +  
Sbjct: 205 EHKGLPVDNLRQVHVASFKETLYYFNQAM---SVLNSKHDNSFPRTNTIFNINIEKLDKL 261

Query: 304 GEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLH---- 359
            E    S + LVDLAGS+ I R  +    +++   IN S+ ++  +I SL+  S      
Sbjct: 262 DESTTSSSIYLVDLAGSDLIDRKNSSGVNSEDVKRINSSIKSVQNIITSLSKLSYSDYKN 321

Query: 360 --------VPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIK 411
                   VP+  SKL +LL++ LGGN KT  + TIS      ++    LQ     ++ K
Sbjct: 322 YEFSLENSVPYDSSKLGKLLKEPLGGNCKTNFLFTISMNPEQYDDIIEALQLGTILQDSK 381

Query: 412 NKPQLGSVIMKDILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTN--------DL 463
             PQ+    + +    +I  E  K+K +    +  E +   ++    +TN        +L
Sbjct: 382 TVPQINKFGLNENKTLSIALENFKLKENNFKIQQAESVKQIEELKSIITNKEESIVLEEL 441

Query: 464 ESYKTEVKECKRAIETLTSQNTLLLKDKKAS 494
              ++E  + K  + TLT    L++  K AS
Sbjct: 442 NKLRSENAKLKAQVNTLTQ---LMVSPKLAS 469

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 59/113 (52%), Gaps = 14/113 (12%)

Query: 68  TYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDG 127
           ++    +F   +N  L+   I   +  + ++GYN  ++ YG   +GKTY+      LY  
Sbjct: 83  SFEFTHIFDRDSNIDLIGNTIVTGMIDEAMEGYNTALVTYGPKYSGKTYS------LYGN 136

Query: 128 ELSESAGIIPRILFK-LFETLELQKED------YVVKCSFVELYNEELKDLLG 173
           ++ +S G + +I+FK LF  +     D      ++VK SF+E++ +++ DLL 
Sbjct: 137 DVDDSFG-LGQIIFKDLFSRINKSVTDSNAKYTFIVKISFLEVWLDKVVDLLA 188

>Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079W
           (REAL)
          Length = 657

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 43/124 (34%), Positives = 64/124 (51%), Gaps = 19/124 (15%)

Query: 53  NTTGDVGITAQINSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTST 112
           NTTGD          T+  D+VF  +A Q  V   + +P   D + GYN T+L YG + +
Sbjct: 67  NTTGDT-------HSTFQFDKVFDANATQKDVQDFLLDPTINDVLSGYNSTILTYGPSFS 119

Query: 113 GKTYTMTGDEKLYDGELSESAGIIPRILFKLFETLELQKE----DYVVKCSFVELYNEEL 168
           GK+Y++ G +   DG      GI+P I   LF TLE +++    ++ V     E+Y E+ 
Sbjct: 120 GKSYSLIGPQ---DG-----GGILPNICKALFSTLEDREKNKGNNFSVSVLAFEIYMEKT 171

Query: 169 KDLL 172
            DLL
Sbjct: 172 YDLL 175

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 85/181 (46%), Gaps = 26/181 (14%)

Query: 288 SRSHTIFTITL-YKEYNGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTL 346
           SRSH +F + +  +    +I + S + L+DL G+E   +             +NQS+  L
Sbjct: 234 SRSHVVFQLHVEQRNRRHDILKNSSLYLIDLHGAEKFDKRIENTLSQDSLKKLNQSIEAL 293

Query: 347 GRVINSLTDKSL----------HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEE 396
              + SL  KS+             +RES+LT +L+DSLGGN KT +I T   + + +  
Sbjct: 294 KNTVQSLEIKSMDSVYSAKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT-- 351

Query: 397 TCSTLQYAAKAKNIKNKPQLGSVIMKDILVKNITGELAKIKADLL--STKSKEGIYMSQD 454
           T STL++    + I N+           ++ N +G   + K DL     K K+  Y+SQ 
Sbjct: 352 TLSTLKFGDSIRQINNR-----------VMDNTSGLNLRKKMDLFVQDMKIKDDNYISQI 400

Query: 455 N 455
           N
Sbjct: 401 N 401

>Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 65/130 (50%), Gaps = 19/130 (14%)

Query: 47  SNEVSINTTGDVGITAQINSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLV 106
           ++E S  TTGD          T+  D+VF  +A Q  V   +  P   D + GYN T++ 
Sbjct: 60  TSEPSHETTGDT-------YSTFKFDKVFDTNATQEDVQDFLVRPSIDDVLSGYNGTIIT 112

Query: 107 YGMTSTGKTYTMTGDEKLYDGELSESAGIIPRILFKLFETLELQKE----DYVVKCSFVE 162
           YG + +GK+Y++ G +        E  GI+P I   LFETLE  KE    ++ V     E
Sbjct: 113 YGPSFSGKSYSLLGSQ--------EGEGILPNICKVLFETLEKNKETKGNNFSVSVLAFE 164

Query: 163 LYNEELKDLL 172
           ++ E+  DLL
Sbjct: 165 IFMEKTYDLL 174

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 95/210 (45%), Gaps = 31/210 (14%)

Query: 288 SRSHTIFTITL-YKEYNGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTL 346
           S+SH +F + +  +  N +I R S + L+DL G+E   +             +NQS+  L
Sbjct: 233 SKSHLVFQLHVEQRNRNADILRKSSLYLIDLHGAERFDKRTEVTLSQDALKKLNQSIEAL 292

Query: 347 GRVINSLTDK----------SLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEE 396
             ++  L+ K          S    +RES+LT +L+DSLGGN KT +I T   + +++  
Sbjct: 293 KNIVRLLSVKDRDSAYSVKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVST-- 350

Query: 397 TCSTLQYAAKAKNIKNKPQLGSVIMKDILVKNITGELAKIKADLLSTKSKEGIYMSQDNY 456
           T STL++    + I NK           ++ N TG   K K DL      E + +  +NY
Sbjct: 351 TLSTLEFGECIRQITNK-----------VIDNTTGLNLKKKMDLFI----EDMKIRDNNY 395

Query: 457 KELTNDLESYKTEVKECKRAIETLTSQNTL 486
               N L   K E+   K     L SQ  +
Sbjct: 396 ASRINIL---KAEIDSLKTPSGELVSQGDM 422

>Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 58/109 (53%), Gaps = 12/109 (11%)

Query: 68  TYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDG 127
           T+  D+VF  +A Q  V   +  P   D + GYN T+L YG + +GK+Y++ G +  Y+ 
Sbjct: 74  TFQFDKVFDANATQKDVQDFLVNPTIKDILSGYNSTILTYGPSFSGKSYSLLGSQ--YN- 130

Query: 128 ELSESAGIIPRILFKLFETLELQKE----DYVVKCSFVELYNEELKDLL 172
                 G++P I   LFETLE  +E    ++ V     E+Y E+  DLL
Sbjct: 131 -----EGVLPNICQVLFETLEENEETKGTNFCVSVLAFEIYMEKSYDLL 174

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 62/225 (27%), Positives = 103/225 (45%), Gaps = 44/225 (19%)

Query: 288 SRSHTIFTITLYKEYNGE-IFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTL 346
           S+SH +F + + +    E I + S + L+DL G+E   +             +NQS+  L
Sbjct: 233 SKSHLVFQLHVEQRNRREDILKNSSLYLIDLHGAEKFEKRTENTLSQDALKKLNQSIEAL 292

Query: 347 GRVINSL----------TDKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEE 396
             ++  L          T  S    +RES+LT +L+DSLGGN K  +I T   + + +  
Sbjct: 293 KNIVQLLAVKNPDSAYSTKASHSSTYRESQLTEVLRDSLGGNRKMKVILTCFLSNVPT-- 350

Query: 397 TCSTLQYAAKAKNIKNKPQLGSVIMKDILVKNITGELAKIKADLL--STKSKEGIYMSQ- 453
           T STL++    + I NK           ++ + TG   K K DL     K K+  Y+SQ 
Sbjct: 351 TISTLEFGDNIRQIINK-----------VMSSTTGLNMKKKMDLFVQDMKIKDDNYVSQI 399

Query: 454 -------DNYKELTN----------DLESYKTEVKECKRAIETLT 481
                  D+ K+L+N          +LE+Y+ E  + K  ++++T
Sbjct: 400 NILKSELDSLKDLSNESSSREDMKTELENYEKENVKLKLQLDSIT 444

>KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2.633
           YKL079W
          Length = 522

 Score = 61.2 bits (147), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 74/141 (52%), Gaps = 18/141 (12%)

Query: 42  PDVTGS------NEVSINTTGDVGITAQINS--KTYTVDEVFGPSANQSLVFQKIAEPLF 93
           PD  GS        V+  +   VG +  ++   +T+++D+VF PSA+Q+ V   +  P+ 
Sbjct: 9   PDSEGSALDISETSVTFRSHASVGGSHGVDPHERTFSLDKVFPPSASQADVTAVLLGPIV 68

Query: 94  ADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSESAGIIPRILFKLFETLELQKED 153
            +   G N  +   G + TGKT+TM G + +       S G++ RIL K+F+ +  + E 
Sbjct: 69  DNLAHGVNVQMASLGDSQTGKTHTMLGQQGV-------SQGLLQRILTKVFQLMN-ENEG 120

Query: 154 YVVKCSF--VELYNEELKDLL 172
             V+ S   VEL N+++ DLL
Sbjct: 121 VTVQYSLSAVELVNDKVYDLL 141

>NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633
          Length = 660

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 74/285 (25%), Positives = 127/285 (44%), Gaps = 34/285 (11%)

Query: 248 GIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEIF 307
           G +I++L   H+T+  E    L+ G K+     + ++   S+    F +    +   ++ 
Sbjct: 196 GDHIRDLHQIHVTSPIEIKDTLKNGYKN----ISPLHHSKSQIFVRFEVQCI-DRKDDVT 250

Query: 308 RVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDK----SLHVPFR 363
           R S +  +DL GS+ +++  A    + +    NQ +  L  +I +L ++    S H  F+
Sbjct: 251 RCSSITFIDLCGSDLLTKQNASKLSSDDIKKFNQMIYLLQNLIKTLPEEQSTNSSH--FK 308

Query: 364 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKD 423
           +S L ++L D LGG+TK  L+  I       E+    ++  AKAK IKN P +  +    
Sbjct: 309 DSSLNKILMDYLGGDTKMTLVVAIDGNTGGYED---AVKLGAKAKLIKNYPTMNKI---- 361

Query: 424 ILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEVKECKRAIETLTSQ 483
                  G  AK K DLL     + + + + NY    N L+   TE+K  K   ++ T+ 
Sbjct: 362 -------GLNAKRKMDLLV----QDMNVKEQNYLAKINLLQ---TEIKTLKTENDSTTNS 407

Query: 484 NTLLLKDKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQN 528
            +  L++    N    LQ   LQ +   MS   +     NK E N
Sbjct: 408 TSNSLENALQENSKLKLQLESLQQILGTMS--LANPSSSNKNEMN 450

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 58/113 (51%), Gaps = 14/113 (12%)

Query: 64  INSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGD-E 122
           +++  Y  D +F   + ++  +  I + L  D  KGYN T++ YG TS+GK++ + GD +
Sbjct: 81  VSNNEYQFDSIFDVDSKETEFYDSITDNLIDDISKGYNTTIMTYGPTSSGKSHALFGDPD 140

Query: 123 KLYDGELSESAGIIPRILFKLFETLELQKED---YVVKCSFVELYNEELKDLL 172
              DG ++  A    R+LF        Q ED    +   S  ELY +++ DLL
Sbjct: 141 STNDGLINHIAD---RLLFP-------QCEDNLKTLCSISMWELYIDKVYDLL 183

>CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa]
           {ON} similar to uniprot|P32364 Saccharomyces cerevisiae
           YKL079w SMY1 kinesin-related protein
          Length = 675

 Score = 58.9 bits (141), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 83/379 (21%), Positives = 162/379 (42%), Gaps = 64/379 (16%)

Query: 248 GIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIF--TITLYKEYNGE 305
           G+Y Q   + +I + KE  ++++    +++ +  KM+   S SH +   ++      +G 
Sbjct: 205 GLYYQEANNEYINSIKEFDRVMKLIQDNKEASEKKMDSKRSTSHVVIRCSVEQLDRVHGT 264

Query: 306 IFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSL------------ 353
           I   S +   DL GS    +   Q    +    +N S+  L  V+NS+            
Sbjct: 265 ITS-SNIMFADLCGSNRFEKDVDQKLGVENIKKLNLSISNLESVVNSVLQNQQKNHLYIE 323

Query: 354 --------TDKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAA 405
                   +     VP+++S+LT L+Q++LGGN++T ++      K + EET +TL++  
Sbjct: 324 NKLVPSVNSSDLQRVPYKDSQLTGLIQEALGGNSRTRVVLNCFDDKSHHEETIATLRFGV 383

Query: 406 KAKNIKNKPQ-----LGSVIMKDILVKN--------------ITGELAKIKADLLSTKSK 446
           + +NI N  +     L S    D+L+ N              +  EL K+   +   K  
Sbjct: 384 QLQNILNFVRADVTGLNSKKTLDLLIDNMKVIENNYDQKITLLESELNKLADTVKKAKVT 443

Query: 447 E----GIYMSQDNYKELTNDLESY--------KTEVKECKRAIETL------TSQNTLLL 488
           E     I    D  K+L   LE+           E ++ K+ I+TL       +Q  L L
Sbjct: 444 EELETEIVEKNDEIKKLREQLETMTQLFNNIDPKESEDTKKIIQTLMEKCESVAQLQLEL 503

Query: 489 KDKKASNEV----NDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGTMQ 544
           + +   N +     +++  K++ +    S L  + + Q    Q+++ +   LK  +  + 
Sbjct: 504 EGQLHENSILKGDGEIKDAKIRTLETMNSRLVEQLQNQESSTQDILKSNGILKKELEALS 563

Query: 545 SIIKEHERRERDIESKMGD 563
           +I K  + + + +E+K+ D
Sbjct: 564 NISKSQQEKIKILEAKLRD 582

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 59/124 (47%), Gaps = 12/124 (9%)

Query: 53  NTTGDVGITAQINSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTST 112
           NT     IT   +   +  ++V+        + + ++E +  D   GY+ +++ YG   +
Sbjct: 71  NTIIHYPITNFADESIFNFEKVYDVGVPLVDIHKSLSESVLKDIYDGYDVSIISYGEAGS 130

Query: 113 GKTYTMTGDEKLYDGELSESAGIIPRILFKLFE-TLELQKEDYV---VKCSFVELYNEEL 168
           GK++T+ G+E        +S GII      + +   EL+K+      ++ S +E+  E++
Sbjct: 131 GKSFTLFGNE--------DSDGIIALTFQDIIQKKRELEKDQNTIVNIQISALEISLEKV 182

Query: 169 KDLL 172
            D+L
Sbjct: 183 YDML 186

>TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.633
           YKL079W
          Length = 803

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 85/176 (48%), Gaps = 18/176 (10%)

Query: 241 NSQDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYK 300
           N +  N+ + I+NL+  ++ + +E    L +G  +R      M   +SRS+ +  I L +
Sbjct: 229 NFKKNNSSLEIENLRQVYVESFEELNSYLIEGRSNRN-----MKHLTSRSNIVIKINLEQ 283

Query: 301 EY-NGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLH 359
            +   ++ + S + L+D+A S+ I ++ +    AKEA  +N  + +    IN L +    
Sbjct: 284 VFLEDQLMKCSSLILLDMAASDYIDKNDSLGISAKEAKKLNYPMESFTSYINLLAETGTS 343

Query: 360 VPFRE-----------SKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYA 404
            P+ +           S L  ++   +GGN KT  I+TISP   N  ET  TL+ +
Sbjct: 344 -PYDQQINGKKSNDYNSNLVDIMSIPIGGNCKTLFISTISPLLANQNETFITLRIS 398

 Score = 40.4 bits (93), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 69  YTVDEVFGPSANQS-LVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKL 124
           + VD+VF     QS L+   I +   ++   G+N +++ +G + TGK++TM G+  L
Sbjct: 51  FQVDKVFDRFTKQSDLLSSDIVKNKISELFDGFNSSIIAFGQSGTGKSFTMFGNNSL 107

>NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}
           Anc_2.633
          Length = 598

 Score = 54.7 bits (130), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 63/113 (55%), Gaps = 6/113 (5%)

Query: 305 EIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTD-KSLHVP-- 361
           +++++S ++ +DL G +  ++   Q     E   +N  + +   +I +L+D KSL     
Sbjct: 263 QLYKLSTLSFIDLYGIDKFTKKDIQLTN-DEMKKLNTLMSSFQNLITTLSDPKSLPYTSS 321

Query: 362 -FRESKLTRLLQDSLGGNTKTALIATI-SPAKINSEETCSTLQYAAKAKNIKN 412
            +++S L ++LQD +GGN+KT  I    SP+ I  EE    L++A   K+IKN
Sbjct: 322 LYKDSALNKILQDYIGGNSKTTFIIPFPSPSIIQHEELIEMLKFAMGLKSIKN 374

 Score = 33.1 bits (74), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 47/89 (52%), Gaps = 15/89 (16%)

Query: 61  TAQINSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTG 120
           T +++S+ +  D +F  ++ Q+   + +      D   GYN + + YG +++GK+ T+  
Sbjct: 61  TLKLDSQDFKFDNIFPTNSEQN---EMLTVSTIKDLFDGYNQSFITYGKSNSGKSDTL-- 115

Query: 121 DEKLYDGELSESAGIIPRILF-KLFETLE 148
                    +E  G+I R+LF +LF+ ++
Sbjct: 116 --------FNEKDGLI-RLLFEQLFKKVQ 135

>TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {ON}
           Anc_2.633 YKL079W
          Length = 693

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 74/133 (55%), Gaps = 5/133 (3%)

Query: 289 RSHTIFTITLYK-EYNGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLG 347
           RS TI  I L + + + ++   S +  VDLAGS+  S+   +    + A   N+ + +L 
Sbjct: 265 RSSTILRIKLLQLDEDEDLETQSTICFVDLAGSDRASKDIEKGITREAASKYNRVMDSLN 324

Query: 348 RVINSLTD-KSLHVP---FRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQY 403
            ++ +L + +S+ +    +R S LTR+L D L GN KT LI + S  K +  ET STL +
Sbjct: 325 SMVYTLANSESISINKSIYRNSHLTRILYDLLAGNHKTNLIFSCSLNKDDEYETFSTLGF 384

Query: 404 AAKAKNIKNKPQL 416
           ++ A ++ N+ ++
Sbjct: 385 SSYASSMSNQIKI 397

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 60/151 (39%), Gaps = 44/151 (29%)

Query: 66  SKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTG----- 120
           S  Y  D++F P      +   ++     D  KGYN T + YG T TGKTYT+ G     
Sbjct: 55  SNQYRFDKIFEPEKPDDEINSTLSFACINDLFKGYNSTYISYGQTGTGKTYTLYGTAFND 114

Query: 121 -----DEKLYDGELS-----------------------------ESAGIIPRILFKLFET 146
                D K  +   +                             ++ G+I ++   LFE 
Sbjct: 115 TPTDLDSKNINTNKNVKNDSNISSNSNIQTSASSNKSANSILQKKNYGLISKVGNDLFEM 174

Query: 147 LELQKE-----DYVVKCSFVELYNEELKDLL 172
           ++  +       ++V  SFVE+Y EE+ DLL
Sbjct: 175 IDQIRAIRKGITFLVNISFVEVYKEEVYDLL 205

>ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar to
           uniprot|Q759X8 Ashbya gossypii ADR145C ADR145Cp and
           weakly similar to YKL079W uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a kinesin
           colocalizes with Myo2p kinesin heavy chain homolog
          Length = 668

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 75/159 (47%), Gaps = 18/159 (11%)

Query: 288 SRSHTIFTITL-YKEYNGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTL 346
           SRS     IT+  +    E  + S + L+DLA S+ + ++        E  S N S+  L
Sbjct: 224 SRSSAFLNITVEQRNKKEETLKHSVLQLIDLASSDKLDKNLKYDISTDEMKSTNSSMQNL 283

Query: 347 GRVINSLTDKSLHVP----------FRESKLTRLLQDSLGGNTKTALIATISPAKINSEE 396
            +V+  L++  L  P           R S+L + LQ ++GG++KT  +   S  K + E 
Sbjct: 284 HQVVYGLSE--LESPSSKNHSSKHTHRTSRLAKFLQQAIGGDSKTTAVMLSSTDKADREN 341

Query: 397 TCSTLQYAAKAKNIKNKP-----QLGSVIMKDILVKNIT 430
           T  TL   ++ ++I N P      L S  + D+ +KN++
Sbjct: 342 TVITLSLGSRLRSIHNFPVQNKMGLNSKALLDLRLKNMS 380

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 52/108 (48%), Gaps = 12/108 (11%)

Query: 69  YTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 128
           +  ++V+     Q  V + I      + + G+N +++ +G   +GKTYTM G++      
Sbjct: 68  FRFNKVYDVGVRQQEVCEDIIGDNVMELLAGFNVSIMAFGSEGSGKTYTMFGND------ 121

Query: 129 LSESAGIIPRILFKLFETLELQKED----YVVKCSFVELYNEELKDLL 172
                GI+ R+   +F+ L+   ED      +  +F EL+ E + DLL
Sbjct: 122 --HEEGIVQRMCQSIFDQLDKLHEDSGNESTISINFFELFAENVYDLL 167

>KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.633
           YKL079W
          Length = 667

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 101/229 (44%), Gaps = 30/229 (13%)

Query: 239 HQNSQDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDF--SSRSHTIFTI 296
           H+  QD     Y ++L    +T+  E I  +     +R   +    ++   S+SH I  I
Sbjct: 170 HETKQDDE--YYFKDLHVAFVTSRDELINYIMDAESNRFSGSCLHTNYVQRSKSHLITKI 227

Query: 297 TL-YKEYNGEIFRVSKMNLVDLAGSENISRSG--AQHQRAKEAGSINQSLLTLGRVINSL 353
            +  +  N ++ +   ++  DLA  + I +    +    + E   +N    TL   I S+
Sbjct: 228 NVEQRNLNEDVVKRGSISFFDLAAIDFIDKDSMVSLGLTSDEVKKLNLESTTLKNSIISM 287

Query: 354 TDKSLH----VPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKN 409
           ++ S +    +P++ S LT+LL     GN KT +I T S  K N  ET  TL+   K ++
Sbjct: 288 SELSENPNAVIPYKNSNLTKLLNQCFMGNMKTTVILTCSMLKSNEAETLETLKMGLKLES 347

Query: 410 IK-----NKPQLGSVIMKDILVKNITGELAKIKADLLSTKSKEGIYMSQ 453
           I      NK  L S    D++V+++              KSKE  YM++
Sbjct: 348 ISSNVHMNKHALNSKKKLDLIVEDM--------------KSKEANYMNR 382

 Score = 40.8 bits (94), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 45/91 (49%), Gaps = 8/91 (8%)

Query: 84  VFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSESAGIIPRILFKL 143
           ++  I   L  +  +GY+  V+ YG   TGK+    G +  Y+G      G++   +  L
Sbjct: 75  LYNGIKGDLINNIFEGYHTGVITYGSAGTGKSSIFYGTDSTYEG------GVVLMFVQDL 128

Query: 144 FETLELQKED--YVVKCSFVELYNEELKDLL 172
           ++ ++    D  + V  S +E++ E++ DLL
Sbjct: 129 YDKIDSIGNDTHFTVSLSTIEIHLEKMYDLL 159

>NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON}
           Anc_2.633 YKL079W
          Length = 572

 Score = 39.3 bits (90), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 14/68 (20%)

Query: 89  AEPLFADFI----KGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSESAGIIPRILFKLF 144
            EPL  D I    +G +C+++ YG ++TGKT+       L+D    +  GIIP  + +L+
Sbjct: 65  PEPLVIDNINELTRGVDCSMVTYGQSATGKTHV------LFD----QVRGIIPLFIEQLY 114

Query: 145 ETLELQKE 152
             LE Q +
Sbjct: 115 IYLEAQSD 122

 Score = 35.4 bits (80), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 67/152 (44%), Gaps = 28/152 (18%)

Query: 271 KGLKHRQVAT-TKMNDF--------SSRSHTIFTITL-YKEYNGEIFRVSKMNLVDLAGS 320
           KGLK   V++  ++ D+        +S  HT   I+L     + + FR   +  VDL   
Sbjct: 166 KGLKEVFVSSRCELQDYLNAACDLQNSTFHTFVKISLQLVNCHEDSFRKCCIEFVDLCAQ 225

Query: 321 ENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFRESKLTRLLQDSLGGNTK 380
           E++                 Q + +L  V+++  DK   +   +S+  +LL +S+GGN K
Sbjct: 226 EDVL----------------QLVCSLVAVLSNDNDKK--IGKEKSQFCKLLSNSIGGNRK 267

Query: 381 TALIATISPAKINSEETCSTLQYAAKAKNIKN 412
           T  I   S  + N + +  TL++  K   + N
Sbjct: 268 TTFILACSTLEQNEKISLETLEFGLKVSQVVN 299

>KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633
           YKL079W
          Length = 681

 Score = 39.3 bits (90), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 61/134 (45%), Gaps = 10/134 (7%)

Query: 44  VTGSNEV-SINTTGDVGITAQINSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNC 102
           V  SN V ++N T       ++  ++++  +V    A ++  F ++A  +  D + G NC
Sbjct: 69  VGNSNHVQTVNDT-----VVKLGEQSFSFSKVLNDQATKTEQFTELASKVTDDVLSGINC 123

Query: 103 TVLVYGMTSTGKTYTMTGDEKLYDGELSES---AGIIPRILFKLFETLELQK-EDYVVKC 158
            V  YG      +  M G +     E  +S   +G++ +    +F  ++     +Y V  
Sbjct: 124 CVTTYGSGLAADSLVMFGPQSGNSKEEQDSSRCSGLLQQTCKHIFNAIDSDSTSEYQVSL 183

Query: 159 SFVELYNEELKDLL 172
           S  E+Y +++ DLL
Sbjct: 184 SLCEVYVDKVFDLL 197

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 75/159 (47%), Gaps = 28/159 (17%)

Query: 354 TDKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNK 413
           +D+S    ++E+ LT+L+ + L  N KT+ +   S    N  +T   LQ+ A+ + I+ +
Sbjct: 325 SDESKASRYKEAHLTKLMYEPLMVNFKTSFVLCCSNNSKNRNDTLQLLQFGAQLQQIRTQ 384

Query: 414 PQLGSVIMKDILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEVKEC 473
                      +  N+ G         L++K K  +Y+S    KE     E+YK  ++  
Sbjct: 385 -----------VSGNVFG---------LNSKRKMELYLSDMKLKE-----ENYKERIRFL 419

Query: 474 KRAIETLTSQN--TLLLKDKKASNEVND-LQRIKLQNMR 509
           +R +E+  + N  T      K +N V D L +I+++N +
Sbjct: 420 QRQLESSKNLNNGTAGTTSNKPANPVMDRLMKIQIENFK 458

>NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401
          Length = 874

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 40/72 (55%), Gaps = 6/72 (8%)

Query: 310 SKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHV---PFRESK 366
           S+  +VD+ G++++ +S     +  E   +N SLLTLG+ IN+L    + +   P  E  
Sbjct: 427 SEFTIVDMNGTQHLGKSQNVMPKTTE---LNSSLLTLGKSINNLNLDEMPIVISPLAEFL 483

Query: 367 LTRLLQDSLGGN 378
           + R L++S  GN
Sbjct: 484 IRRALKNSRLGN 495

>KAFR0C03650 Chr3 complement(744293..744931) [639 bp, 212 aa] {ON}
           Anc_8.8 YFL046W
          Length = 212

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 27/41 (65%), Gaps = 1/41 (2%)

Query: 432 ELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEVKE 472
           + AK+K  LLS+  KE  Y  Q+ Y+ + NDLE  KT++KE
Sbjct: 94  DFAKLKDQLLSSDRKE-FYNLQNEYERVHNDLEKMKTKLKE 133

>YDL058W Chr4 (345665..351037) [5373 bp, 1790 aa] {ON}
           USO1Essential protein involved in the vesicle-mediated
           ER to Golgi transport step of secretion; binds membranes
           and functions during vesicle docking to the Golgi;
           required for assembly of the ER-to-Golgi SNARE complex
          Length = 1790

 Score = 34.3 bits (77), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 59/116 (50%), Gaps = 13/116 (11%)

Query: 564 LFNNEFARVKQTILSNIRDIE--QQIDWENI-GVQGNIDSIRGEISKLLERAQQQTDDMY 620
           LFN    R++ T LS+  D E   +I +E +  +Q     ++GEI+ L    Q +T+  +
Sbjct: 703 LFNENIYRIR-TALSHDPDEEPINKISFEEVEKLQRQCTKLKGEITSL----QTETESTH 757

Query: 621 KDCVEKILDETPGHFQLAAEKVSEVEKLIATCHRDLTENLSDVSEEFNNLRQYLND 676
           ++  EK++  T  H +L      E  +++ + H  L EN S +  E  N+R  L++
Sbjct: 758 ENLTEKLIALTNEHKEL-----DEKYQILNSSHSSLKENFSILETELKNVRDSLDE 808

>Kpol_1002.47 s1002 (137553..139292) [1740 bp, 579 aa] {ON}
           (137553..139292) [1740 nt, 580 aa]
          Length = 579

 Score = 33.1 bits (74), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 48/91 (52%), Gaps = 14/91 (15%)

Query: 264 EGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEIFRVSKMNLVDLAGSE-- 321
           EG++ L+  L+H+ +    M D    SH+ + I  Y++Y  EI++ S++ ++  + SE  
Sbjct: 390 EGLQNLRNALEHKVI---NMKDIEP-SHSKYAIKTYRQYCSEIYKTSQLEILKSSISELK 445

Query: 322 NISRSGAQHQRAKEAGSINQSLLTLGRVINS 352
           +I +S     + K        LLT+ +V+ S
Sbjct: 446 HIEKSWISESKNK--------LLTMKKVMKS 468

>KLLA0F01100g Chr6 complement(101843..102499) [657 bp, 218 aa] {ON}
           similar to uniprot|P32489 Saccharomyces cerevisiae
           YPL121C MEI5 Meiosis specific protein involved in DMC1-
           dependent meiotic recombination
          Length = 218

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 74/172 (43%), Gaps = 46/172 (26%)

Query: 510 DAMSDLYSKAEKQNKREQNLVATASTLKTTVGTMQSIIKEHERRERDIESKMGDLFNNEF 569
           D+ SD+  K   +N  E+   +T S L         ++KE  R E D++ ++ DL   EF
Sbjct: 20  DSFSDILPKLSCRNPEER---STGSVL---------LLKEIRRLENDLDRQIRDLTKKEF 67

Query: 570 A-----RVKQTILSNIRDIEQQIDWENI---GVQGNIDSI--------------RGEISK 607
           A     ++ QT  + ++ IE    W +I   G+   +++I              R EI  
Sbjct: 68  ALKRAVKIMQTYDNELKTIELINKWRSICQCGMSYMLNTILVKIDRMGGYQEYKRKEIEA 127

Query: 608 LLERAQQQTDDMYKDCVEKILDETPGHFQLAA-----------EKVSEVEKL 648
              + + Q DD  +  +E+IL E+P  F L             EKV E E++
Sbjct: 128 RKRQVEYQYDDGIQQQMEEIL-ESPDFFHLPIEEKEEIRERMDEKVREAEEM 178

>TDEL0C05460 Chr3 complement(981269..981874) [606 bp, 201 aa] {ON}
           Anc_3.409 YGR081C
          Length = 201

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 50/98 (51%), Gaps = 14/98 (14%)

Query: 517 SKAEKQNKREQN----LVATASTLKTTVGTMQSIIKEHERRER-DIESKMGDLFNNEFAR 571
           SK +KQN ++QN    ++A A+      G  +S ++  +R+ R D++ KMGDL       
Sbjct: 46  SKKDKQNNKQQNFLNRVLAKATGQDQFAGISKSAVRRRKRKLREDLKPKMGDLL------ 99

Query: 572 VKQTILSNIRDIEQQIDWENIGVQGNIDSIRGEISKLL 609
              T L    D+++ +  E +  +  ++  R  ++K++
Sbjct: 100 ---TSLGQEDDLKEHVQEEIVDEKVQVEEPRRNVTKIV 134

>Suva_6.48 Chr6 (83671..84114) [444 bp, 148 aa] {ON} YFL012W (REAL)
          Length = 148

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 19/104 (18%), Positives = 51/104 (49%)

Query: 645 VEKLIATCHRDLTENLSDVSEEFNNLRQYLNDHFFKNNHEEILVSHIDRTYHHIQTSADD 704
           +++ IA C  D+ E+L   ++ +  +R+ ++    +NN     ++   R     + +  +
Sbjct: 6   LKRTIAPCSSDIYESLHFQNDGYVKIRELISHFVIENNSISTAIADEARMRQLAEPTVKE 65

Query: 705 LFQQFKEMMDNHLEKNKDLMLESLKTATYDVIRKEMQLFEPQKK 748
              +F++  +     +KDL ++ L+T   D++ +  +   P++K
Sbjct: 66  PVHRFRKWKNRSSCVSKDLTMKGLRTRKRDMVYRWFERHLPKEK 109

>TPHA0F00360 Chr6 (80013..83468) [3456 bp, 1151 aa] {ON} Anc_4.39
           YLR313C
          Length = 1151

 Score = 32.3 bits (72), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 52/104 (50%), Gaps = 16/104 (15%)

Query: 406 KAKNIKNKP-QLGSVIM--------KDILVKNITGELAKIKADLLSTKSKEGIYMSQDNY 456
           K+ NI+ KP ++   I+        K IL+ N T E   I  D+ STKS +G+  +    
Sbjct: 705 KSSNIQTKPDRIPPAIIIPKKEDRVKPILIANGTDEAKPIVEDIYSTKSNKGVDFTDTED 764

Query: 457 KELTNDLESYKTEVKECKRAIETLTSQNTLLLKDKKASNEVNDL 500
           K +  DL+  K   ++  +++ET       +++D K+S E  DL
Sbjct: 765 KTIDEDLD--KAVEEDLNKSVET-----GRVIRDNKSSQENADL 801

>ZYRO0F06424g Chr6 complement(532056..533414) [1359 bp, 452 aa] {ON}
           similar to Q12234 YOR216C uniprot|Q12234 Saccharomyces
           cerevisiae RUD3 Golgi matrix protein that is involved in
           the structural organization of the cis-Golgi
          Length = 452

 Score = 32.0 bits (71), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 84/174 (48%), Gaps = 31/174 (17%)

Query: 466 YKTEVKECKRAIETLTSQNTLLLKDKKASN-----EVNDLQRIKLQNMRDAMSDLYSKAE 520
           YK  + + +R +ET  + ++  L+ +K  N     ++ +L  I L N +  +S L+ + E
Sbjct: 189 YKKTIDDLQRQLETFNTSHSHELEFQKTQNSQLNTQLQELLLI-LDNNKQDISALHQERE 247

Query: 521 KQNKREQNLVATASTLKTTVGTMQSIIKEHERR------ERDIESKMGDLFNNEFARVKQ 574
                 +NL    S LK ++  M++ ++  E+R      +R+IE    +    E  R K+
Sbjct: 248 DLQFNLENLTKENSILKDSLKEMEAELERTEQRFNDQLTQRNIEV---NSLKAELERSKE 304

Query: 575 TILSNIRDIEQQIDWENIGVQGNIDSIRGEISKLLERAQQQTDDMYKDCVEKIL 628
           +  S++                 ID++RGE+ ++ + A +Q + + K+C +++L
Sbjct: 305 STKSHV---------------DTIDTLRGEVERMKD-AVEQKEKLEKECKDRVL 342

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.128    0.350 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 96,071,072
Number of extensions: 4248862
Number of successful extensions: 17797
Number of sequences better than 10.0: 764
Number of HSP's gapped: 18098
Number of HSP's successfully gapped: 1137
Length of query: 958
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 839
Effective length of database: 39,836,145
Effective search space: 33422525655
Effective search space used: 33422525655
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 71 (32.0 bits)