Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G045206.17ON67967933080.0
ZYRO0C07876g6.17ON68168419140.0
SAKL0E01100g6.17ON71072215710.0
Ecym_30216.17ON67469415400.0
Kpol_1045.726.17ON69570315400.0
Kwal_56.224116.17ON68970714970.0
KLTH0C11308g6.17ON69070314490.0
ACR009W6.17ON68068914430.0
TPHA0J003106.17ON67570614250.0
KLLA0D01067g6.17ON66070913790.0
Skud_5.276.17ON61549913581e-180
TBLA0G010106.17ON71053313571e-178
YEL062W (NPR2)6.17ON61549313461e-178
KNAG0M011406.17ON59468113021e-172
CAGL0L13288g6.17ON64668312951e-170
NDAI0D008606.17ON66651412411e-162
Suva_5.56.17ON61937211891e-155
KAFR0L003806.17ON54069211741e-153
Smik_5.256.17ON61535311751e-152
NCAS0H008706.17ON61234410891e-140
Kpol_1008.211.358ON79845761.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G04520
         (679 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.1...  1278   0.0  
ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} simila...   741   0.0  
SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON...   609   0.0  
Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON} s...   597   0.0  
Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON} (1670...   597   0.0  
Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {...   581   0.0  
KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} simila...   562   0.0  
ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic ho...   560   0.0  
TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON...   553   0.0  
KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON...   535   0.0  
Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)   527   e-180
TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {O...   527   e-178
YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit ...   523   e-178
KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {...   506   e-172
CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa...   503   e-170
NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.1...   482   e-162
Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)    462   e-155
KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON...   456   e-153
Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON...   457   e-152
NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.1...   424   e-140
Kpol_1008.21 s1008 (41825..44221) [2397 bp, 798 aa] {ON} (41825....    34   1.6  

>TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.17
           YEL062W
          Length = 679

 Score = 1278 bits (3308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 625/679 (92%), Positives = 625/679 (92%)

Query: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60
           MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL
Sbjct: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60

Query: 61  LTLKYKNYRIASYPVTVNSPIYARXXXXXXXXXXXPYDCQTSPYEPAIARLGKMFKVLEE 120
           LTLKYKNYRIASYPVTVNSPIYAR           PYDCQTSPYEPAIARLGKMFKVLEE
Sbjct: 61  LTLKYKNYRIASYPVTVNSPIYARNFFSFNFVFVFPYDCQTSPYEPAIARLGKMFKVLEE 120

Query: 121 QNLILSKAEKDPIFYHFKQVEIKDDQDAKSKPEKGSHNLSKSQAYASEKYHKIMTDIESA 180
           QNLILSKAEKDPIFYHFKQVEIKDDQDAKSKPEKGSHNLSKSQAYASEKYHKIMTDIESA
Sbjct: 121 QNLILSKAEKDPIFYHFKQVEIKDDQDAKSKPEKGSHNLSKSQAYASEKYHKIMTDIESA 180

Query: 181 DSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPPNSNISIEDVPVSTVNL 240
           DSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPPNSNISIEDVPVSTVNL
Sbjct: 181 DSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPPNSNISIEDVPVSTVNL 240

Query: 241 NKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYYNCVLLADIFQF 300
           NKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYYNCVLLADIFQF
Sbjct: 241 NKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYYNCVLLADIFQF 300

Query: 301 SNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFKRVNHSATESVDHELADXXX 360
           SNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFKRVNHSATESVDHELAD   
Sbjct: 301 SNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFKRVNHSATESVDHELADSHR 360

Query: 361 XXXXXXXXXXXXXXNGKFFPSSNNEMPALISEESLYRTGKHXXXXXXXXXXXXXXMLARY 420
                         NGKFFPSSNNEMPALISEESLYRTGKH              MLARY
Sbjct: 361 SQRTSGSRTTSMSSNGKFFPSSNNEMPALISEESLYRTGKHSQSSFSSNNTNPSNMLARY 420

Query: 421 LPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFGVINGLIYRCYSYPIM 480
           LPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFGVINGLIYRCYSYPIM
Sbjct: 421 LPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFGVINGLIYRCYSYPIM 480

Query: 481 KNLEIFDLAKRLHREDISNHTVKHNKAKNPSKNIFSTSDIKFGVEYERQRNKHHKALNLD 540
           KNLEIFDLAKRLHREDISNHTVKHNKAKNPSKNIFSTSDIKFGVEYERQRNKHHKALNLD
Sbjct: 481 KNLEIFDLAKRLHREDISNHTVKHNKAKNPSKNIFSTSDIKFGVEYERQRNKHHKALNLD 540

Query: 541 IADEVLRNVYKKLSVTNSTDTRPNSADPIARLYRERSLGSLADGSTNNIYRLQNSDRPSK 600
           IADEVLRNVYKKLSVTNSTDTRPNSADPIARLYRERSLGSLADGSTNNIYRLQNSDRPSK
Sbjct: 541 IADEVLRNVYKKLSVTNSTDTRPNSADPIARLYRERSLGSLADGSTNNIYRLQNSDRPSK 600

Query: 601 VSFDKQQEIGHISKGMSSSNDKVKMDEEAKXXXXXXXXXXXXSVEAADSLDTICVKLEMS 660
           VSFDKQQEIGHISKGMSSSNDKVKMDEEAK            SVEAADSLDTICVKLEMS
Sbjct: 601 VSFDKQQEIGHISKGMSSSNDKVKMDEEAKLERRERDLILLESVEAADSLDTICVKLEMS 660

Query: 661 RYDVEALIQNLGEYKIINS 679
           RYDVEALIQNLGEYKIINS
Sbjct: 661 RYDVEALIQNLGEYKIINS 679

>ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 681

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/684 (56%), Positives = 468/684 (68%), Gaps = 22/684 (3%)

Query: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60
           M DQFEGF+PIHT+FYAVFHPT+GT+VRYE+PPGNLE +NINFDAIKNYIIPKPQLCHKL
Sbjct: 15  MTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKL 74

Query: 61  LTLKYKNYRIASYPVTVNSPIYARXXXXXXXXXXXPYDCQTSPYEPAIARLGKMFKVLEE 120
           LTLKYK YRI  YPVTVNSP YAR           PYDC+TS YEPAIARLGKMF+VLEE
Sbjct: 75  LTLKYKGYRIVCYPVTVNSPYYARNFFSFNFVFVFPYDCETSSYEPAIARLGKMFRVLEE 134

Query: 121 QNLILSKAEKDPIFYHFKQVEIKDDQDAKSKPEKGSHNLSKSQAYASEKYHKIMTDIESA 180
           QN ILSKAE DPI++ FK  +   +QD K   EK    L+KSQ  A  KY++IM D+ES 
Sbjct: 135 QNQILSKAENDPIYFDFKLADNTTEQDGKLNAEKSFKGLTKSQGMALAKYNEIMKDLESE 194

Query: 181 DSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPPNSNISIEDVPVSTVNL 240
            S FS++DLV+R++QDLNNYSECLIPIDEGNAVDIKIFP+ TPPNS ISIEDVP+STVNL
Sbjct: 195 KSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKTPPNSCISIEDVPISTVNL 254

Query: 241 NKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYYNCVLLADIFQF 300
             +IDVNWDPTMLKIVPYI+GLNSISKIAKLS SD  LV+EC+KHL+YYNCV+LADIFQF
Sbjct: 255 KTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHLVYYNCVILADIFQF 314

Query: 301 SNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFKRVNHSATESVDHELADXXX 360
           SNIYAPTS +R FLTD  L++ECQS+V     S+L  +PF+R+     + +D        
Sbjct: 315 SNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPFERLRKFDLDDMDQSKNQESG 374

Query: 361 XXXXXXXXXXXXXXNGKFFPSSNNEMPALISEESLYRTGKHXXXXXXXXXXXXXXMLARY 420
                            FF S         +  + YR  +                LAR+
Sbjct: 375 SRTTSMSSKSDSKSKRPFFYS---------APRNPYRFNQRSQSSFSSTNTNVTHDLARH 425

Query: 421 LPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFGVINGLIYRCYSYPIM 480
           LPTK+CLFDLYR+LSQG ++REWY ++Y TI+ N IDVRRFITFGVI GLIYRC+S+P+M
Sbjct: 426 LPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIKGLIYRCFSFPVM 485

Query: 481 KNLEIFDLAKRLHREDISNHTVKHNKAKN---PSKNIFSTSDIKFGVEYERQRNKHHKAL 537
           K + IFDLA +LH     N   K  K +     SK +FSTSD+K G     + +K H+  
Sbjct: 486 KKMSIFDLAHKLHTAGNLNQVTKKGKGQKNLAESKYVFSTSDMKLG-----EGSKMHQNF 540

Query: 538 NLDIADEVLRNVYKKLSVTNSTDTRPNSADPIARLYRERSLGSLADGSTNNIYRLQNSDR 597
           ++DIADEVLRNVYKKLS TN   +R +   P++R+YRE S  SL+  S +N+   +  +R
Sbjct: 541 SVDIADEVLRNVYKKLSNTNEPGSRDDY--PLSRIYREESHVSLSALSGDNVSHPKKPER 598

Query: 598 PSKVSFDKQQEIGHISKGMSSSNDKVKMDEEAKXXXXXXXXX--XXXSVEAADSLDTICV 655
            SKV+FD  ++   +   +S    K K  E AK              S+ AAD LD ICV
Sbjct: 599 VSKVAFDMNKD-DPVPYSLSQQKGKNKEREAAKLDRAKNNQKIILLESIAAADCLDKICV 657

Query: 656 KLEMSRYDVEALIQNLGEYKIINS 679
           KLE  R++VE L+  LG+YKIINS
Sbjct: 658 KLEKPRHEVEELLHELGDYKIINS 681

>SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 710

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/722 (46%), Positives = 441/722 (61%), Gaps = 55/722 (7%)

Query: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60
           M   F+GF+PIHT+FY+VFHPTEGTKVRY+FPP NLE+++INFD IKNY+IPKPQLC+KL
Sbjct: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60

Query: 61  LTLKYKNYRIASYPVTVNSPIYARXXXXXXXXXXXPYDCQTSPYEPAIARLGKMFKVLEE 120
           LT KY  YR+A YPV VN+  YAR           PY+C TSPYEPA+ARLGKMF+VLEE
Sbjct: 61  LTFKYGPYRLACYPVNVNASYYARNSFNFNFVFVFPYNCATSPYEPAVARLGKMFRVLEE 120

Query: 121 QNLILSKAEKDPIFYHFKQVEIKD-------DQDAKSKP---EKGS----------HNLS 160
           Q+ ILSKAE DP+++H K  E          DQ    +P   E+G+              
Sbjct: 121 QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQGKI 180

Query: 161 KSQAYASEKYHKIMTDIESADSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPM 220
           + Q  A EKYH+IM D+E      S++DL+ ++YQDLNNYSEC IPID GN+VDIK+FP+
Sbjct: 181 EGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFPL 240

Query: 221 MTPPNSNISIEDVPVSTVNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVI 280
           + PPNS +S EDVP+STVNL K+IDVNWDPTMLKIVP+ING+NSI+KIAK S SD  LVI
Sbjct: 241 LAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDLVI 300

Query: 281 ECIKHLIYYNCVLLADIFQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPF 340
           EC+KHLIYYNCV+LADIFQFSNIYA TS +  FLTD  L++ECQ+YV    D  L RLPF
Sbjct: 301 ECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVTS-SDLELYRLPF 359

Query: 341 K-RVNHSATESVDHELADXXXXXXXXXXXXXXXXXNGKFFPSS-----NNEMPALISEES 394
           + R N  +  S   +  +                 N   +PS      NN   +  S   
Sbjct: 360 ESRPNLLSMHSSRKQ--NSSSTIHTVGVRNSPNRTNSLDYPSELSTRRNNFSSSSASSLM 417

Query: 395 LYRTGKHXXXXXXXXXXXXXXMLARYLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRAN 454
             R                  +L   LPTKSCLFDLYRSL QG +++EWY +++  IR N
Sbjct: 418 RVRDRSGQSTTGSAVDEQESRLL---LPTKSCLFDLYRSLHQGETVKEWYKINFEIIRDN 474

Query: 455 RIDVRRFITFGVINGLIYRCYSYPIMKNLEIFDLAKRLHREDIS---NHTVKHNKAKNPS 511
            IDVRRFITFG++ GLIYRCY+YP+MKNL   ++ K L     S      +K  + KN +
Sbjct: 475 HIDVRRFITFGIVRGLIYRCYAYPVMKNLGALEMLKTLKSASDSRSLRRKLKFREKKNFT 534

Query: 512 KNIFSTSDIKFGVEYERQR------NKHHKALNLDIADEVLRNVYKKLSVTNSTDTRP-N 564
            N+FST+DIK  +E+          N+ H + N+D+A+EVL++ YKKLS+  S D    +
Sbjct: 535 NNVFSTADIKVDLEHSPGGAPAEIFNRKHTS-NVDMAEEVLKDAYKKLSIIESMDDNLYH 593

Query: 565 SADPIARLY----RERSLGSLADGSTNNIYRLQNSDRPSKVSFDKQQEIGHISKGMSSSN 620
             +P++RLY     E S      GS         S+  SKV+F+K +    + +     +
Sbjct: 594 VHNPMSRLYGHDSGESSTKGSRKGSRKGSSSTMESETRSKVAFEKGRSPWQVEE-----D 648

Query: 621 DKVKMDEEAKXXXXXXXXXX---XXSVEAADSLDTICVKLEMSRYDVEALIQNLGEYKII 677
           +K +  EE                 SV++ D+ D IC++LE  R +VE L++ +G Y II
Sbjct: 649 EKKERTEEVSNLLKEKRHEEFLLLKSVKSVDTFDKICMRLEKDREEVEQLLKEMGHYNII 708

Query: 678 NS 679
           NS
Sbjct: 709 NS 710

>Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON}
           similar to Ashbya gossypii ACR009W
          Length = 674

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/694 (45%), Positives = 441/694 (63%), Gaps = 35/694 (5%)

Query: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60
           M + F+GF+PIH+IFY++FHPTEGTKVR++FPP +LE+  I+FD IKNY+IPKPQLC+KL
Sbjct: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60

Query: 61  LTLKYKNYRIASYPVTVNSPIYARXXXXXXXXXXXPYDCQTSPYEPAIARLGKMFKVLEE 120
           LT KY +YR+  YPV +N+  YAR           PYD  TSPYEPAI RLGKMF+VLEE
Sbjct: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120

Query: 121 QNLILSKAEKDPIFYHFKQVEIK------DDQDAKSKPEKGSHNLSKSQ-AYASEKYHKI 173
           Q+ +LSK E+DPI+YH K  ++K      ++ ++K+ P+  +  + +    +A EKYH+I
Sbjct: 121 QSQVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQNCNDKIRRGHHEHAFEKYHEI 180

Query: 174 MTDIESADSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPPNSNISIEDV 233
           M  I   +   S++DL+ ++Y+DLNNYSECLIP+D GNA+DIK+FP++ PPNS  S+EDV
Sbjct: 181 MKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPPNSCFSVEDV 240

Query: 234 PVSTVNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYYNCVL 293
           P++ +NL   +DVNWDPTM+KIVPYING+NSI+KI+K S SD GLV+EC+KHLIYY+CV+
Sbjct: 241 PIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYYDCVV 300

Query: 294 LADIFQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFK---RVNHSATES 350
           L D+FQFSNIYAPTS L  FLTD  ++ ECQ YV+  EDS L +LPF+     NHS   +
Sbjct: 301 LVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPFEGRPNANHSRNPT 360

Query: 351 VDHELADXXXXXXXXXXXXXXXXXNGKFF--PSSNNEMPALISEESLYRTGKHXXXXXXX 408
                                   N +F   P++N  +P   SE S+  + K+       
Sbjct: 361 ASTITFGTLKRTIYTNPRPESFSSNTEFAQKPNANTSLP---SEPSITHSSKN----SEF 413

Query: 409 XXXXXXXMLARYLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFGVIN 468
                  +L R LPT+SCLFDLYRSLSQG ++++WY +++  IR NRIDVRRFITFGV  
Sbjct: 414 NHENNKGILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGVFR 473

Query: 469 GLIYRCYSYPIMKNLEIFDLAKRLHREDISNHTVKHNKAKNPSKNIFSTSDIKFGVEYER 528
            LIYRCYSYP+ K++   D+ KR     + N+ +  +   N S N+FST+DI        
Sbjct: 474 KLIYRCYSYPVAKSIGTLDMLKRFDYASLPNNFM--SPKNNNSNNVFSTADICVDFGEPS 531

Query: 529 QRNKHHKALNLDIADEVLRNVYKKLSVTNSTDTRPNSADPIARLYRERSLGSLADGSTNN 588
           Q  K     N D ADEVLR+ YKKLS+    +  PN  D I R  ++ SL + A  + +N
Sbjct: 532 QFRKKPLVPNTDAADEVLRDAYKKLSL---NERLPNPLDQITR-SKKLSLENDASANVDN 587

Query: 589 IYRLQNSDRPSKVSFDKQQEIGHIS---KGMSSSNDKVKMDEEAKXXXXXXXXXXXXSVE 645
                ++   +KV FD +  + +     +  ++++ ++K   + +            S++
Sbjct: 588 RKLSSSTSGTAKVLFDMKDRLSNKDFEYRDQNAASTELKRKRQQQ-------FLLLKSIK 640

Query: 646 AADSLDTICVKLEMSRYDVEALIQNLGEYKIINS 679
             DS D I +KLE+++ +VE L++  GEY IINS
Sbjct: 641 NVDSFDKIAIKLEINKQEVEELLKATGEYNIINS 674

>Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON}
           (167096..169183) [2088 nt, 696 aa]
          Length = 695

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/703 (46%), Positives = 445/703 (63%), Gaps = 39/703 (5%)

Query: 5   FEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKLLTLK 64
           F+GF PIHTIFY+VFHPTEG KV Y+FPP NL++++INFD+I++Y+IPKPQLC+KLLTLK
Sbjct: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63

Query: 65  YKNYRIASYPVTVNSPIYARXXXXXXXXXXXPYDCQTSPYEPAIARLGKMFKVLEEQNLI 124
           Y NYRI  YP+T+N  IYAR           PY+C+TSPYE  I +LGKMF+VLEEQ+  
Sbjct: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123

Query: 125 LSKAEKDPIFYHFKQV-EIKDDQDAKSKPEKG---------------------SHNLSKS 162
           LSKAEKD  ++ FK +     DQD+K KPEK                      + +  K+
Sbjct: 124 LSKAEKDLAYFDFKAILHSSLDQDSKLKPEKDSSGNNNGNSNNSNNDQSNSANATDSKKN 183

Query: 163 QAYASEKYHKIMTDIESADSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMT 222
            +Y  EKY +I   + + +S FS++D ++R+YQDLNNYSECLIPID GNAVDIK+FP++ 
Sbjct: 184 SSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLFPLLR 243

Query: 223 PPNSNISIEDVPVSTVNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIEC 282
           PP + ISIEDVP+S VNL ++IDVNWDPTMLKIVP+I+G+NSI+KIAKLS SD  LVIEC
Sbjct: 244 PPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVLVIEC 303

Query: 283 IKHLIYYNCVLLADIFQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFKR 342
           IKH IYY CV+++DIFQFSNIYAPTS LR FLTD +++TECQ+YV   E STL +LP + 
Sbjct: 304 IKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQLPLES 363

Query: 343 VNHSATESVDHELADXXXXXXXXXXXXXXXXXNGKFFPSSNNEMPALISEESLYRTGKHX 402
           ++    +S   +  +                 +     SS+NE  +L S   LY      
Sbjct: 364 LSKLKLDSDGSDSQNLRKSKNGIDSRAASFVSSRG--ASSHNENSSLYSRSDLYLNRHRS 421

Query: 403 XXXXXXXXXXXXXMLARYLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFI 462
                           + LPT+S LFDLYRSLSQG +L+EWY  ++  IR N ID+R+FI
Sbjct: 422 ESSISSQNTNDLNGNVKQLPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRNNGIDIRKFI 481

Query: 463 TFGVINGLIYRCYSYPIMKNLEIFDLAKRLHREDISN--HTVKHNKAKNPSKNIFSTSDI 520
            FG+INGL+YRC S+P+  N E  +  K+   +DI N   T K    K  S++IFSTSDI
Sbjct: 482 IFGIINGLLYRCQSFPVTANFEEINKVKKF--KDIQNRKETRKDKLQKQLSQDIFSTSDI 539

Query: 521 KFGVEYERQRNKHHKALNLDIADEVLRNVYKKLSVTNSTDTRPNSADPIARLYRERSLGS 580
           K G +    RN+  + L+LDIAD VL+NVYKKL++    +   N A     L  ++S+ S
Sbjct: 540 KVGEDLISGRNRRIQTLDLDIADSVLKNVYKKLTLKTEEENSSNRALNSQEL-EKKSVQS 598

Query: 581 LADGSTNNIYRLQNSDRP---SKVSFDKQQEIGH-ISKGMSSSNDKVKMDEEAKXXXXXX 636
           L + S  N Y  +   RP   SKVSF +   + +  S G  + N+ +   E+ +      
Sbjct: 599 LFESS--NPYS-KVPKRPGTLSKVSFQQNSNMQYSASSGDVTENEDINNLEKLR---KQN 652

Query: 637 XXXXXXSVEAADSLDTICVKLEMSRYDVEALIQNLGEYKIINS 679
                 ++E+ ++LD ICV LE  R +VE ++++L ++K+INS
Sbjct: 653 EQILLEALESTENLDKICVLLEKPRSEVEEMLKHLVDFKVINS 695

>Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {ON}
           YEL062W (NPR2) - Non-membrane-embedded, PEST
           sequence-containing protein [contig 185] FULL
          Length = 689

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/707 (43%), Positives = 432/707 (61%), Gaps = 48/707 (6%)

Query: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60
           M   F+GF+P+H I Y +FHPTEGTKVR++FPPG LE+ +I FD IKNY+IPKPQLC+KL
Sbjct: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60

Query: 61  LTLKYKNYRIASYPVTVNSPIYARXXXXXXXXXXXPYDCQTSPYEPAIARLGKMFKVLEE 120
           LT KY ++R+  YPV V +P YAR           PYDC TSPYE AIARLGKMF VLEE
Sbjct: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120

Query: 121 QNLILSKAEKDPIFYHFK--------QVEIKDDQDAKSKPEKGSHNLSKSQAYASEKYHK 172
           Q+ ILSKAE   +++  K          E  +D + +   +    + S+S  YA EKYH+
Sbjct: 121 QSQILSKAENSHVYFQLKTRDSHKHTNQEPVNDNELQGTLKNNEASQSESHGYAFEKYHE 180

Query: 173 IMTDIESADSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPPNSNISIED 232
           I+ D+   +   S++DL+ ++Y+DLNNYSECLIPID GNAVDIK+FP+++PP+S +S ED
Sbjct: 181 ILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKLFPLLSPPSSCLSFED 240

Query: 233 VPVSTVNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYYNCV 292
           VP+ TVNL K+IDVNWDPTMLKIVPYING NSI+K+AKLS SD  LV+ECI+HL+YYNCV
Sbjct: 241 VPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYYNCV 300

Query: 293 LLADIFQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFKRV--------- 343
           +LADIFQF NIYAPTS L  FLT+  L+TECQ YV  +E + +  LPF+R          
Sbjct: 301 ILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFERKPSRTTYNNI 360

Query: 344 ---NHSATESVDHELADXXXXXXXXXXXXXXXXXNGKFFPSSNNEMPAL--ISEESLYRT 398
              N S+T  V  +  +                 N ++ P S+        +S+ SL  +
Sbjct: 361 PVRNSSSTLDVQRKGREMSIKESSFTAGIDQSGRN-QYTPQSHTSSIQCHNVSDASLGNS 419

Query: 399 GKHXXXXXXXXXXXXXXMLARYLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDV 458
                                +  +KSCLFD+YRSLSQG +++EWY  H+  IRA RIDV
Sbjct: 420 EGGFNNKV-------------FFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDV 466

Query: 459 RRFITFGVINGLIYRCYSYPIMKNLEIFDLAKRLHREDISNHTVKHNKAKN--PSKNIFS 516
           RRFITFGVI+GL+YRCYS+PIMKN+   ++ K L   D  + T     + N  P+ N+ S
Sbjct: 467 RRFITFGVIHGLLYRCYSFPIMKNVGYLEVVKALGLSDGDSSTEGKWLSGNSEPTNNVLS 526

Query: 517 TSDIKFGVEYE----RQRNKHHKALNLDIADEVLRNVYKKLSVT-NSTDTRPNSADPIAR 571
            ++I+ G+E      R+R  +H + N D A+++L +VY+KL++  N  +    S +P+ R
Sbjct: 527 AAEIRIGLESSSSKLRERRFNHFS-NADTAEDILNDVYRKLALNENKVEQSSQSGNPMMR 585

Query: 572 LYRERSLGSLADGSTNNIYRLQNSDRPSKVSFDKQQEIGHISKGMSSSNDKVKMDEEAKX 631
           ++   S  S  + S  ++     SD  + V+FD ++ +   +       + ++++E+ + 
Sbjct: 586 MFGNCSDDSSGETSVKDVVSTAGSDTRNTVAFDVRRLVNSATAEDRKKGEVMRLEEDKR- 644

Query: 632 XXXXXXXXXXXSVEAADSLDTICVKLEMSRYDVEALIQNLGEYKIIN 678
                      SV   ++ D IC +L   R +VE ++++LG Y +++
Sbjct: 645 ---KDELLLLKSVRDVENFDKICTRLGRDREEVEKMLEDLGPYNVVH 688

>KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 690

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/703 (43%), Positives = 422/703 (60%), Gaps = 37/703 (5%)

Query: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60
           M   F+GF+P+H IFY+VFHPTEGTKVR++FP G LE  +I FD IKNY+IPKPQLC+KL
Sbjct: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60

Query: 61  LTLKYKNYRIASYPVTVNSPIYARXXXXXXXXXXXPYDCQTSPYEPAIARLGKMFKVLEE 120
           LT KY  +R+  YPV V +P YAR           PYDC TSPYEPAI RLGKMF VLEE
Sbjct: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120

Query: 121 QNLILSKAEKDPIFYHFKQVEIK---DDQDAKSKPEKGSHNLSK-----SQAYASEKYHK 172
           Q+ ILSKAE   +++  K    +   + + AK   +  S ++ +     +Q YAS KY++
Sbjct: 121 QSQILSKAENSSVYFQLKARNTQKHGNTETAKGTEQPSSLDIGEIAQPENQGYASAKYYE 180

Query: 173 IMTDIESADSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPPNSNISIED 232
           I+ D+E      ++ DL+ ++Y+DLN+YSECLIPID GNAVDIK+FP+++PP+S  SIED
Sbjct: 181 ILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKLFPLLSPPSSCFSIED 240

Query: 233 VPVSTVNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYYNCV 292
           VP+STVNL K+IDVNWDPTMLKIVP+ING+NSI+K+AK S SD  LV+ECIKHLIYYNCV
Sbjct: 241 VPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYYNCV 300

Query: 293 LLADIFQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFKRVNHSATESVD 352
           +L DIFQFSNIYA T+ L  FLT+  L+ ECQ YV   E + LP LPF+R    + +   
Sbjct: 301 ILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGPSRSGQGNI 360

Query: 353 HELADXXXXXXXXXXXXXXXXXNG-----KFFPSSNNEMPALISEESLYRTGKHXXXXXX 407
            + +                  N       F  + +   P   S    Y           
Sbjct: 361 RDRSSNGTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIPYHN-----TSDA 415

Query: 408 XXXXXXXXMLARYLP--TKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFG 465
                   +  + +P  +KSCLFDLYRSL+QG ++REWY  H+  IRA RIDVRRFITFG
Sbjct: 416 SFGNSDAGLKGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFITFG 475

Query: 466 VINGLIYRCYSYPIMKNLEIFDLAKRLHREDISNHT----VKH-NKAKNPSKNIFSTSDI 520
           V++GLIYR YSYP+++N+     A+ +     +NH+     KH  K   P  N+ S +DI
Sbjct: 476 VLHGLIYRSYSYPVLRNI---GFAESVEALGATNHSRYAKYKHLLKTNQPLNNVLSAADI 532

Query: 521 KFGVE---YERQRNKHHKALNLDIADEVLRNVYKKLSVTN-STDTRPNSADPIARLYRER 576
           + G+E   ++ +  K  +    D A+EVL +VY+KL++++  TD      +PI++++   
Sbjct: 533 RIGLENAGFKARSEKLKQHSTADAAEEVLSDVYRKLALSDKKTDHVAQGNNPISKVFGRN 592

Query: 577 SLGSLADGSTNNIYRLQNSDRPSKVSFDKQQEIGHISKGMSSSNDKVKMDEEAKXXXXXX 636
           S  S  D ST        SD  +KV+FD ++ +   S      ++ ++  EE +      
Sbjct: 593 SEDS-TDISTRESANSMGSDIKNKVAFDVRKTLATSSADERRRSEILRSIEEKR----NE 647

Query: 637 XXXXXXSVEAADSLDTICVKLEMSRYDVEALIQNLGEYKIINS 679
                 SV +  + D IC  L   R  VE+++  LG Y +++S
Sbjct: 648 ELILLKSVRSVHNFDKICTLLGKDRERVESMLSELGPYNVLHS 690

>ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL062W (NPR2)
          Length = 680

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/689 (44%), Positives = 424/689 (61%), Gaps = 26/689 (3%)

Query: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60
           M ++F+GF+PIH IFYA+FHPTEGTKVR++FP  +LE   I FD IKNY+IPK QLC+KL
Sbjct: 8   MPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKL 67

Query: 61  LTLKYKNYRIASYPVTVNSPIYARXXXXXXXXXXXPYDCQTSPYEPAIARLGKMFKVLEE 120
           +T K+ +YR+  YPV + +P YAR           PYD  TSPYEPAIARL KM +VLEE
Sbjct: 68  VTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEE 127

Query: 121 QNLILSKAEKDPIFYHFKQVEIK--DDQDAKSKPEKGSHNL---SKSQAYASEKYHKIMT 175
           Q+ +LSK E+DP++Y  K  E K  + +  +S  +  +HNL   S++Q  A+ KYH+IM 
Sbjct: 128 QSQMLSKVERDPVYYQLKTGETKAAEQKTEESDSKAKTHNLDKKSRAQHNATTKYHEIMK 187

Query: 176 DIESADSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPPNSNISIEDVPV 235
            I S +    ++DL+ ++Y+DLNNYSECLIP+D GNA+DIK+FP++TPPNS +S EDVP+
Sbjct: 188 HINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPPNSCLSFEDVPI 247

Query: 236 STVNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYYNCVLLA 295
           + VNL  ++DVNWDPTMLKIVP+ING+NSI+KI+K S S   LV+ECIKHL+YY+CV L 
Sbjct: 248 AKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVYYDCVALV 307

Query: 296 DIFQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFK-RVNHSATESVDHE 354
           D+FQFSNIYAPT+ LR FL D +L  ECQ YVV  ED  + RLPF+ R N   + +    
Sbjct: 308 DMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFESRPNGGHSRNQTAS 367

Query: 355 LADXXXXXXXXXXXXXXXXXNGKFFPSSNNEMPALISEESLYRTGKHXXXXXXXXXXXXX 414
                               +   F   ++ + +L   +S  ++ K              
Sbjct: 368 TNTVYTLRRTTSTNRADSFSSNAEFSQKSSGISSL--AQSFTQSNKDYYYNRSRNLESN- 424

Query: 415 XMLARYLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFGVINGLIYRC 474
               R LPT+  LFDLYRSL+QG +L+EWY  +Y  IR N+IDVRR I FGV + LIYRC
Sbjct: 425 --CKRTLPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLIIFGVFHRLIYRC 482

Query: 475 YSYPIMKNLEIFDLAKRLHREDISNHTVKHNKAKNPSKNIFSTSDIKFGVE-YERQRNKH 533
           YSYP+ K++   +L KR      +++ +      +   N+FSTSDI+   +   R RN  
Sbjct: 483 YSYPVAKSIGTLELLKRFDYVSTTDNFIP--TGTSAGNNVFSTSDIRVDFDGSSRSRNIP 540

Query: 534 HKALNLDIADEVLRNVYKKLSVTNSTDTRPNSADPIARLYRERSLGSLADGSTNNIYRLQ 593
               + D+A+EVLR  Y+KLS+    D   +S DPIA+ Y+  S    A   T+    + 
Sbjct: 541 PFLNSSDVAEEVLRETYQKLSI---KDILNDSIDPIAKGYQAPSDNEAAMKGTSRKQSMS 597

Query: 594 NSDRPSKVSFDKQQEIGHISKG---MSSSNDKVKMDEEAKXXXXXXXXXXXXSVEAADSL 650
             +  ++++FD +    H+SK        N+ + +  + K            SV++ DS 
Sbjct: 598 TLN-TTRITFDIRNR--HVSKDNEHREQQNEDIPLLLKKK---RLQEFLLLQSVKSVDSF 651

Query: 651 DTICVKLEMSRYDVEALIQNLGEYKIINS 679
           D I V+LEM++++VE L++  GEY I+NS
Sbjct: 652 DKIAVRLEMNKHEVERLLKGTGEYNIVNS 680

>TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON}
           Anc_6.17 YEL062W
          Length = 675

 Score =  553 bits (1425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/706 (45%), Positives = 413/706 (58%), Gaps = 60/706 (8%)

Query: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60
           M + F+GF+PIH IFY+VFHPTEGTKV YEFPP NL    INFDAIKNY+IPKPQLCHKL
Sbjct: 1   MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60

Query: 61  LTLKYKNYRIASYPVTVNSPIYARXXXXXXXXXXXPYDCQTSPYEPAIARLGKMFKVLEE 120
           LTLKY NYRI  YP+ +NS +YAR           PY+C+TSPYEP + RLGKMF  LE 
Sbjct: 61  LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120

Query: 121 QNLILSKAEKDPIFYHFKQVEIKDDQDAKSKPEKGSHNLSKSQA---------------- 164
           Q   LSK EKD  ++ FK +    DQD KS  E  ++ LSK+ +                
Sbjct: 121 QCQFLSKCEKDMAYFDFKLISNLIDQD-KSNTEPDNNILSKTNSMILPTISNIDTTVGST 179

Query: 165 ------------YASEKYHKIMTDIESADSTFSLKDLVLRVYQDLNNYSECLIPIDEGNA 212
                       Y   KY+ I   I++     S+ D+++RV+QDLN+YSEC IPID+GNA
Sbjct: 180 NTQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNA 239

Query: 213 VDIKIFPMMTPPNSNISIEDVPVSTVNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLS 272
           +DIK+FP + PP  +IS+EDVP+ TVNLNK+IDVNWDPTMLKIVPYI+GLNSI KIA LS
Sbjct: 240 IDIKLFPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLS 299

Query: 273 VSDPGLVIECIKHLIYYNCVLLADIFQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEED 332
            SD  LVIECI+H +YY CV+L+DIFQFSNIYAPTSS+  FLTD  L+TECQ YV   ED
Sbjct: 300 NSDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPED 359

Query: 333 STLPRLPFKRVNHSATESVDHELADXXXXXXXXXXXXXXXXXNGKFFPSSNNEMPALISE 392
           S L  LPFK+            +A                  +       +N+  A  + 
Sbjct: 360 SLLSALPFKKGRKMVKNRRSASIASHFTSSSSLRQNLNSKASSFISDEGHHNDDTAYPNH 419

Query: 393 ESLYRTGKHXXXXXXXXXXXXXXMLARYLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIR 452
           +S+Y   +                   YLPTKS LFDLYRSLSQG  L EWY +++ +IR
Sbjct: 420 DSIYENRRRSESSFSSGNNDEMHQNRNYLPTKSTLFDLYRSLSQGVKLEEWYQINFNSIR 479

Query: 453 ANRIDVRRFITFGVINGLIYRCYSYPIMKNLEIFDLAKRLHREDISNHTVKHNKAKNPSK 512
            N ID+RRFI FG+I  +IYRC+SYP+ KN E F     L         VK NK+++ + 
Sbjct: 480 DNFIDIRRFIIFGIIKRIIYRCHSYPLPKNYEAFSKLNDLKNLQNGPKIVK-NKSQSYTY 538

Query: 513 NIFSTSDIKFGVEYERQRNKHHKALNLDIADEVLRNVYKKLSVTNSTDTRPNSADPIARL 572
           NIFSTSDIKFGV+      K    L++D+AD VL NVYKKL    ST+ RP ++      
Sbjct: 539 NIFSTSDIKFGVDLYTDTKKKLHTLDVDVADRVLNNVYKKL----STNGRPTTS------ 588

Query: 573 YRERSLGSLADGSTNNIYRLQNSDRPSKVSFDKQQEIGHISKGMSSSNDKVKMDEEAKXX 632
                     +G             PSKV+F  Q     +   M  +N  ++  + ++  
Sbjct: 589 ---------INGQ---------GQHPSKVAFKNQSYDNDLPGLM--NNLGIEATKFSREI 628

Query: 633 XXXXXXXXXXSVEAADSLDTICVKLEMSRYDVEALIQNLGEYKIIN 678
                     ++++A++LD IC  LE+SR +VE L+  L EY+IIN
Sbjct: 629 NINDKIYLLDALQSAENLDNICSNLELSREEVETLLNELTEYRIIN 674

>KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 660

 Score =  535 bits (1379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/709 (43%), Positives = 423/709 (59%), Gaps = 79/709 (11%)

Query: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60
           M   F+GF+PIHT+FY +FHPTEG+KVR++FPP +LE+  I+FD IKNYIIPKPQLC+KL
Sbjct: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60

Query: 61  LTLKYKNYRIASYPVTVNSPIYARXXXXXXXXXXXPYDCQTSPYEPAIARLGKMFKVLEE 120
           LT KY  YRI  YPV VN+  YAR           PYDC TSPYEPAIARLGKMFKVLEE
Sbjct: 61  LTFKYGEYRIVCYPVNVNARYYARNSFNFNFVFVFPYDCATSPYEPAIARLGKMFKVLEE 120

Query: 121 QNLILSKAEKDPIFYHFKQVEIKDDQDAKSKPEKGSHNLS-----KSQAYASEKYHKIMT 175
           Q+ ILSK+E++P+++  K     D   A    E GS  +S     KS     EKY +I+ 
Sbjct: 121 QSQILSKSEQNPVYFQLKS---NDSNAADQSTEMGSITISEHTDIKSTGDDGEKYLEIIK 177

Query: 176 DIESADSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPPNSNISIEDVPV 235
           ++     +  ++DL+++++ DLNNYSECLIPIDEGN++DIK+FP+ TPP+SNIS+EDVP+
Sbjct: 178 ELAKNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSSNISVEDVPI 237

Query: 236 STVNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYYNCVLLA 295
           + VNL+ +IDVNWDPTM+KIVPYING+NS+++IA  + SD  LV ECIKHL+YYNCV+L+
Sbjct: 238 AVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMYYNCVILS 297

Query: 296 DIFQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPR--LPFK-RVNH------- 345
           DIFQFSNIYAPTS +  FLT+  ++  CQ +V   +  +L +  LPF+ R N+       
Sbjct: 298 DIFQFSNIYAPTSEIHNFLTNPAVAKACQLFV---QGDSLKQSLLPFEGRPNNIYPTGRK 354

Query: 346 SATESVDHELADXXXXXXXXXXXXXXXXXNGKFFPSSNNE--MPALISEESLYRTGKHXX 403
            A+ S  H                     +  +  SS+      A  SE +   TG++  
Sbjct: 355 QASTSTVHSRRRDSNDTATTGSTSSVRDTHRNYLSSSSTSSYFRAHASENTSLATGEN-- 412

Query: 404 XXXXXXXXXXXXMLARYLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFIT 463
                        + R LPT+SCLFDLY+SLSQG ++++WY  ++  IR NRIDVR+ I 
Sbjct: 413 ------------QMKRILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIM 460

Query: 464 FGVINGLIYRCYSYPIMKNLEIFDLAKRLHREDISNHTVKHNKAKNPSKNIFSTSDIKFG 523
           FG+   LIYR  SYPI+KN+  +D+ K L  ++   H          SKNIFS +DIK  
Sbjct: 461 FGITRRLIYRVNSYPIVKNVGTWDILKSLVSKEPKTHY-----GSGSSKNIFSAADIKV- 514

Query: 524 VEYERQRNKHHKALNLDIADEVLRNVYKKLSVTNSTDTRPNSADPIARLYRERSLGSLAD 583
           V+ + + N+  K   LD ADE+L+++Y+KLS+       PN+    AR Y         D
Sbjct: 515 VDTKEEGNQSDK---LDAADELLKSLYQKLSLKQDV---PNTMSKFARYYD--------D 560

Query: 584 GSTNNIY-----RLQNSDRPSKVSFD----KQQ----EIGHISKGMSSSNDKVKMDEEAK 630
             +NN +     R  +S    KVSFD     QQ    E+  +  G               
Sbjct: 561 SPSNNAFTESTSRKSSSGSHQKVSFDFGTAGQQKTVTEVPDLGDGEKVE---------VW 611

Query: 631 XXXXXXXXXXXXSVEAADSLDTICVKLEMSRYDVEALIQNLGEYKIINS 679
                       S+  A++ D +C KL+ SR++VE L+++LG Y I+NS
Sbjct: 612 KKKKEEELILLESLSNAETFDKVCTKLKKSRHEVELLLKDLGHYNIVNS 660

>Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)
          Length = 615

 Score =  527 bits (1358), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 259/499 (51%), Positives = 336/499 (67%), Gaps = 19/499 (3%)

Query: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60
           M   F+GF+PIHTIFY+VFHPTEG+K++YEFPP NL++H INF+ IKNYIIPKP LCHKL
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60

Query: 61  LTLKYKNYRIASYPVTVNSPIYARXXXXXXXXXXXPYDCQTSPYEPAIARLGKMFKVLEE 120
           +T KY  YRI  YPVT+NSPIYAR           PYDC+TSPYEPAI RLGKMFKVLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QNLILSKAEKDPIFYHFKQVE---IKDDQDAKSKPEKGSHNLS--------KSQAYASEK 169
           QN +LSK+EKD +F+  K +E   I             S N +         ++   S +
Sbjct: 121 QNQLLSKSEKDAVFFDLKALENSTITPSTAGAPTTSNPSSNTTPTYPTSDKDAKDLRSSR 180

Query: 170 YHKIMTDIESADSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPPNSNIS 229
           Y+ +  D+   +S+FS++DL++R++QDLNNYSECLIPIDEGNAVDIKIFP++ PP + +S
Sbjct: 181 YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240

Query: 230 IEDVPVSTVNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYY 289
           +EDVP+S+VNL K+IDVNWDPTM+ IVPYI+GLNSI+KI+KLS SDP LVIECI+HLIYY
Sbjct: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYY 300

Query: 290 NCVLLADIFQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFKRVNHSATE 349
            CV L+DIFQFSNIYAP+S +RTFLTD +++++CQSYV   E S +  LP  +      +
Sbjct: 301 KCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSK----NLD 356

Query: 350 SVDHELADXXXXXXXXXXXXXXXXXNGKFFPSSNNEM----PALISEESLYRTGKHXXXX 405
           S D +                    +     SSN+++        S  S+ +  +     
Sbjct: 357 SADRDSPSLFVRRKSKSSSIPSNPDSRTTSFSSNSKVSQNSSLNSSFSSVCKDWRQSQTS 416

Query: 406 XXXXXXXXXXMLARYLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFG 465
                        R+LPT+SCLFDLYRSLSQG +L+ WY   +  ++ N IDVRRFITFG
Sbjct: 417 LSSSNLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFG 476

Query: 466 VINGLIYRCYSYPIMKNLE 484
           +   +IYRCYS+P+M N++
Sbjct: 477 LERRIIYRCYSFPVMLNVD 495

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 56/102 (54%), Gaps = 15/102 (14%)

Query: 578 LGSLADGSTNNIYRLQNSDRPSKVSFDKQQEIGHISKGMSSSNDKVKMDEEAKXXXXXXX 637
           +GS   G  NN+     S+RPSKVSF+ Q+  G ++ G  ++  K+  +EE         
Sbjct: 529 VGSKNSGQPNNV----KSERPSKVSFEMQRA-GSLATG-EATIPKLSDEEE--------- 573

Query: 638 XXXXXSVEAADSLDTICVKLEMSRYDVEALIQNLGEYKIINS 679
                S+ +A+S D ICV L  S+ +VE  +  LGE+K+INS
Sbjct: 574 RILENSIRSAESFDNICVLLSKSKLEVENYLNELGEFKVINS 615

>TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {ON}
           Anc_6.17 YEL062W
          Length = 710

 Score =  527 bits (1357), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 274/533 (51%), Positives = 359/533 (67%), Gaps = 40/533 (7%)

Query: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60
           M D FEGF+PIHT+FY++FHPTEGTKVRYEFPPGNL+++NINFD IKNYIIPKPQLCHKL
Sbjct: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60

Query: 61  LTLKYKNYRIASYPVTVNSPIYARXXXXXXXXXXXPYDCQTSPYEPAIARLGKMFKVLEE 120
           LTLKY +YR+ SYPVT+NS +YAR           P +C+TSPYEP IARLGKMF+VLEE
Sbjct: 61  LTLKYGDYRLVSYPVTINSSLYARNFFSFNFVFVFPINCETSPYEPIIARLGKMFRVLEE 120

Query: 121 QNLILSKAEKDPIFYHFKQVEIKDDQDAKSKPEKGSHNLSKSQAYASEKYHKIMTDIESA 180
           QN +LS+AE D +++      +  +QD+    +K +  L  S+   S  + K  TD+  +
Sbjct: 121 QNQLLSRAENDSVYFDNSHSLLSSEQDSIMHQDKNTSILGFSRKRFS--FSKRPTDLSLS 178

Query: 181 D-------STFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPPNSNISIEDV 233
           +       S FS++DL++R++QDLNNYSECLIPIDEGN+VDIKIFP M PP+ +IS EDV
Sbjct: 179 EYPDNESGSNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMVPPSISISYEDV 238

Query: 234 PVSTVNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYYNCVL 293
           PV+ V+L+ V+DVNWDPTMLKIVP+I+ +NSIS+IA LS SD   V+ECI+HL+YY  V+
Sbjct: 239 PVAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVECIRHLVYYQLVI 298

Query: 294 LADIFQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFKRVNHSATESVDH 353
           L+DIFQF+NIYAPTS LR FLTD  L+T+CQ+YV   ++S   +LP ++       S++ 
Sbjct: 299 LSDIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLPLEK-------SINT 351

Query: 354 ELADXXXXXXXXXXXXXXXXXNGKFFPSSNNEMPALISEESL----YRTGKHXXXXXXXX 409
           +L +                     +P  NNE+  L +++ L    Y   ++        
Sbjct: 352 DLDE-------------YSNSGSAIYP--NNEI--LENDDRLRWPMYYKPRNSQSSLSSG 394

Query: 410 XXXXXXMLARYLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFGVING 469
                   + YLPTKSCLFDLYRSLSQGT L +WY  HY  I  N+ID+RRFITFG++ G
Sbjct: 395 ISSGNERTSNYLPTKSCLFDLYRSLSQGTVLHDWYNEHYSLIHFNKIDIRRFITFGLVRG 454

Query: 470 LIYRCYSYPIMKNLEIFDLAKRLHREDISNHTVKHNKAKNPSKNIFSTSDIKF 522
           L+YRCY+ PIMKN  IFD+   L     SN    +   KN +    ST++I+F
Sbjct: 455 LLYRCYAIPIMKNAGIFDILSSLTTSQSSNPYHSNGDDKNGTA---STANIRF 504

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 55/185 (29%), Positives = 93/185 (50%), Gaps = 32/185 (17%)

Query: 501 TVKHNKAKNPSKNIFSTSDIKFGVEYERQRNKHHKALNLDIADEVLRNVYKKLSVTNSTD 560
           TVKHN +++ S+++FS                  + LN  IAD+VL ++++KL+  + T 
Sbjct: 550 TVKHNSSRDASEHLFSPP-------------PKRQILNSGIADKVLSDIHRKLAKFDDT- 595

Query: 561 TRPNSADPIARLYRERSLGSLADGSTNNIYRLQNSDRPSKVSFD-------KQQEIGHIS 613
             P S  PI +  +E +    ++GS  NI    +S+  +KVSF+        Q  + H++
Sbjct: 596 --PRS--PIVK-RKEDTFRDFSNGS--NIVGYGSSNTGNKVSFNLSRDSDTTQNNLDHMN 648

Query: 614 KGMSSSNDKVKMDEEAKXXXXXXXXXXXXSVEAADSLDTICVKLEMSRYDVEALIQNLGE 673
             + SS D +   +E              S+  AD++D IC+KL+  R +VE L+  +G+
Sbjct: 649 PILDSSKDIIAQQQEKNHIRRLLLE----SLREADNMDKICIKLQKPRKEVEELLSEIGD 704

Query: 674 YKIIN 678
           Y IIN
Sbjct: 705 YVIIN 709

>YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit of
           SEA (Seh1-associated), Npr2/3, and Iml1p complexes;
           Npr2/3 complex mediates downregulation of TORC1 activity
           upon amino acid limitation; SEA complex is a
           coatomer-related complex that associates dynamically
           with the vacuole; Iml1p complex (Iml1p-Npr2p-Npr3p) is
           required for non-nitrogen-starvation (NNS)-induced
           autophagy; Iml1p interacts primarily with phosphorylated
           Npr2p; homolog of human NPRL2; target of Grr1p; required
           for growth on urea and proline
          Length = 615

 Score =  523 bits (1346), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 255/493 (51%), Positives = 329/493 (66%), Gaps = 11/493 (2%)

Query: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60
           M   F+GF+PIHTIFY+VFHPTEG+K++YEFPP NL++H INF+  KNYIIPKP LCHKL
Sbjct: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60

Query: 61  LTLKYKNYRIASYPVTVNSPIYARXXXXXXXXXXXPYDCQTSPYEPAIARLGKMFKVLEE 120
           +T KY  YRI  YPVT+NSPIYAR           PYDC+TSPYEPAI RLGKMFKVLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QNLILSKAEKDPIFYHFKQVEIKDDQDAKSKPEKG---------SHNLSK--SQAYASEK 169
           QN +LSK+E+DP+F+  K +E      + + P            +H  S+  ++   S +
Sbjct: 121 QNQLLSKSERDPVFFDLKVLENSTTTPSTAGPSSTPNPSSNTTPTHPTSEKDTKDMRSSR 180

Query: 170 YHKIMTDIESADSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPPNSNIS 229
           Y  ++ D+    S FS++DL++R++QDLNNYSECLIPIDEGNAVDIKIFP++ PP + +S
Sbjct: 181 YSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240

Query: 230 IEDVPVSTVNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYY 289
           +EDVP+S+VNL K+IDVNWDPTM+ IVPYI+GLNSI+KI+KLS SDPGLVIECI+HLIYY
Sbjct: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIYY 300

Query: 290 NCVLLADIFQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFKRVNHSATE 349
            CV L+DIFQFSNIYAP+S +R FLTD +++++CQSYV   E S +  LP  +   S  +
Sbjct: 301 KCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNKSLGSGDQ 360

Query: 350 SVDHELADXXXXXXXXXXXXXXXXXNGKFFPSSNNEMPALISEESLYRTGKHXXXXXXXX 409
                                    +       +       S  S+Y+  +         
Sbjct: 361 DSPSFSVRRKSKSSSIPSNPDSRTTSFSSTSRVSQNSSLNSSFSSIYKDWRQSQTSCSSS 420

Query: 410 XXXXXXMLARYLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFGVING 469
                    R+LPT+SCLFDLYRSLSQG +L+ WY   Y  ++ N ID+RRFITFG+   
Sbjct: 421 NIHVINNRNRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFGLEKR 480

Query: 470 LIYRCYSYPIMKN 482
           +IYRCYS+P+M N
Sbjct: 481 IIYRCYSFPVMIN 493

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 47/84 (55%), Gaps = 11/84 (13%)

Query: 596 DRPSKVSFDKQQEIGHISKGMSSSNDKVKMDEEAKXXXXXXXXXXXXSVEAADSLDTICV 655
           +RPSKVSF+ Q+ +  ++ G  S+  K+  +EE              S+  A++ D ICV
Sbjct: 543 ERPSKVSFEMQR-VSSLATG-KSTMPKLSDEEEG---------ILEESIRNAETFDKICV 591

Query: 656 KLEMSRYDVEALIQNLGEYKIINS 679
            L   + +VE+ +  LGE+K+INS
Sbjct: 592 LLSKPKLEVESYLNELGEFKVINS 615

>KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {ON}
           Anc_6.17 YEL062W
          Length = 594

 Score =  506 bits (1302), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 284/681 (41%), Positives = 390/681 (57%), Gaps = 91/681 (13%)

Query: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60
           M  +FEGF+PIHT+FY +FHPTEG+KV Y+FPPGNL+ ++INFDAIKNYIIPKPQLCH+L
Sbjct: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60

Query: 61  LTLKYKNYRIASYPVTVNSPIYARXXXXXXXXXXXPYDCQTSPYEPAIARLGKMFKVLEE 120
           LT+KY NYRI SYPV V S  YAR           PY+C TSPYEPAI RLGKMF+VLEE
Sbjct: 61  LTMKYGNYRIVSYPVAVQSSSYARNYFRFNFVFVFPYECATSPYEPAITRLGKMFRVLEE 120

Query: 121 QNLILSKAEKDPIFYHFKQVEIKDDQDAKSKPEKGSHNLSKSQAYASEKYHKIMTDIESA 180
           Q+ +LS+AE+D   +   ++   D+  AK++       +SK+++++ +K  K   DI   
Sbjct: 121 QSQVLSRAERDDSLFKGDKLPF-DNNSAKNQAPLTHALISKTKSFSPDK--KTEGDIH-- 175

Query: 181 DSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPPNS-NISIEDVPVSTVN 239
               S++DL++R+YQDLNNYSECLIPIDEGNA+DIKIFP++ PP S ++SIEDVP+  V 
Sbjct: 176 --LISVQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHLSIEDVPMLVVK 233

Query: 240 LNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYYNCVLLADIFQ 299
           L K+ID+NWDPTM+ I+P+ING+NSI  IA+LS SDP LVIECIKHLIYY CV++ DIFQ
Sbjct: 234 LKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIYYKCVIITDIFQ 293

Query: 300 FSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFKRVNHSATESVDHELADXX 359
           FSNIYAP+S +  FLTD  ++ +CQ YV   + S L  +P +  +   + +  H+ ++  
Sbjct: 294 FSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPLQ-TSVPGSRNNKHKKSNSL 352

Query: 360 XXXXXXX--XXXXXXXXNGKFFPSSNNEMPALISEESLYRTGKHXXXXXXXXXXXXXXML 417
                            + +F+  SN +     SE SL   G                  
Sbjct: 353 SSTGVLSWQSNSQYSNNSSEFYSMSNKKR----SESSLSSEGTPGAGRSDDHTI------ 402

Query: 418 ARYLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFGVINGLIYRCYSY 477
             Y PT+  LFDLYRSLSQG +L +WY  ++ TIR+N IDVR+FI FG I  +IYR  SY
Sbjct: 403 --YYPTRMVLFDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKIIYRVLSY 460

Query: 478 PIMKNLEIFDLAKRLHREDISNHTVKHNKAKNPSKNIFSTSDIKFGVEYERQRNKHHKAL 537
           P+++      +AK++ +  ++       KA +     FSTSDIKF               
Sbjct: 461 PVLEKRRNSIIAKQMGKSKMA------EKAPHSKNAFFSTSDIKF--------------- 499

Query: 538 NLDIADEVLRNVYKKLSVTNSTDTRPNSADPIARLYRERSLGSLADGSTNNIYRLQNSDR 597
             D  D +  ++Y +                                             
Sbjct: 500 --DDGDRLFNSLYARF-------------------------------------------- 513

Query: 598 PSKVSFDKQQEIGHISKGMSSSNDKVKMDEEAKXXXXXXXXXXXXSVEAADSLDTICVKL 657
            SKVSF+K++E     K   +       D+E              +++  +S D ICV+L
Sbjct: 514 -SKVSFEKRRENARERKSFDAVGGTNGADKETMILTKEEKLQLLGALDNLESFDKICVQL 572

Query: 658 EMSRYDVEALIQNLGEYKIIN 678
             SR ++  LI ++GEY++IN
Sbjct: 573 GRSRVEIANLIADIGEYRVIN 593

>CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa]
           {ON} similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062w nitrogen permease regulator
          Length = 646

 Score =  503 bits (1295), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 291/683 (42%), Positives = 409/683 (59%), Gaps = 43/683 (6%)

Query: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60
           M  QFEGF+ IH+IFY+ FHPTEG+KV+++FPP +LE+  INFD+IKNY+IPK  LCH+L
Sbjct: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60

Query: 61  LTLKYKNYRIASYPVTVNSPIYARXXXXXXXXXXXPYDCQTSPYEPAIARLGKMFKVLEE 120
           +T KY NYRIA YPVTVNS IYAR           P++C+TSPYEPAI RLGKMF+VLE 
Sbjct: 61  ITFKYGNYRIACYPVTVNSSIYARNFFSFNFVFVFPFNCETSPYEPAIERLGKMFRVLEI 120

Query: 121 QNLILSKAEKDPIFYHFKQVE----IKDDQDAKSKPEKGSHNLSKSQAYASEKYHKIMTD 176
           QN ILSK+E D I ++ K  +    I +D       +  S  ++  Q    E+ + I+++
Sbjct: 121 QNQILSKSENDTIMFNLKSADKNFNIDNDSSNYILGDDISSIMTTQQKDKYERLNNIISN 180

Query: 177 IESADSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPPNSNISIEDVPVS 236
           I+   S F++ DL++R+YQDLN YSECLIPID+GNAVDIK+FP++TPP   ISIE VP+S
Sbjct: 181 IKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTPYISIEHVPIS 240

Query: 237 TVNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYYNCVLLAD 296
            VNL K++DVNWDP ML I+PYING+N+I +I++LS ++  LVIECI+HL+YY C++L D
Sbjct: 241 LVNLFKIVDVNWDPIMLTIIPYINGINNIYRISQLSHNEESLVIECIRHLVYYRCIVLTD 300

Query: 297 IFQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFKRVNHSATESVDHELA 356
           IF+FSN+YAPTSSLR FL D  ++TECQSYV+   +S +  L     +H    + + ++ 
Sbjct: 301 IFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDLSL-YPHHGKHSAFNGDIG 359

Query: 357 DXXXXXXXXXXXXXXXXXNGKFFPSSNNEMPALISEESLYRTGKHXXXXXXXXXXXXXXM 416
                               +   SS ++     S+ + Y+  K                
Sbjct: 360 SRNNSVSTSLYSFNGNDSRPQSRSSSVDQ-----SQTNFYKNKKQSESSISTGNSNNGQN 414

Query: 417 LARYLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFGVINGLIYRCYS 476
           + ++LPT+S LFDLYRSLSQG +L+EWY  ++  IR NRIDVRRFITFGV+  +IYRC +
Sbjct: 415 IHKHLPTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRFITFGVLRRIIYRCET 474

Query: 477 YPIMKNLEIFDLAKRLHREDISNHTVKHNKAKNPSKNIFSTSDIKFGVEYERQRNKHHKA 536
           Y ++ + +        H +++     K N+ +NP     S  +I       + ++ H  +
Sbjct: 475 YSVINSTD--------HLQNL----WKLNELENP----ISMENI------SKLQSNHIDS 512

Query: 537 LNLDIADEVLRNVYKKLSVTNSTDTRPNSADPIARLYRERSLGSLADGSTNNIYRLQNSD 596
           L    ADE L N YKKLS+   +     S +     +   SL   A    N+  + + + 
Sbjct: 513 L---AADEALMNAYKKLSLKVPSKGALKSHNTSHSSF---SLTPTAPEMENS--QAKRNK 564

Query: 597 RPSKVSFDKQQEIGHISKGMSSSNDKVKMDEEA-KXXXXXXXXXXXXSVEAADSLDTICV 655
           R SKVSF+   E  +  +    SN K  + E   K            ++  A++LD ICV
Sbjct: 565 RLSKVSFEALPEDRNGFRW--GSNIKTPIQETTWKKLSKMQRRIMLKALADAETLDKICV 622

Query: 656 KLEMSRYDVEALIQNLGEYKIIN 678
            LEM R +V  ++  LGE K+IN
Sbjct: 623 LLEMPRQNVVNILHELGELKLIN 645

>NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.17
           YEL062W
          Length = 666

 Score =  482 bits (1241), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 257/514 (50%), Positives = 322/514 (62%), Gaps = 48/514 (9%)

Query: 3   DQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKLLT 62
           + FEGF+PIHTIFY++FHPTEGTKVRYEFPP NL + +I+FDAIKNYIIPK QLC+KLLT
Sbjct: 11  NHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLLT 70

Query: 63  LKYKNYRIASYPVTVNSPIYARXXXXXXXXXXXPYDCQTSPYEPAIARLGKMFKVLEEQN 122
            KY NYRI SYP+T+NS  YAR           PYDC+TSPYEPAIARLGKMFKVLEEQN
Sbjct: 71  FKYANYRIVSYPITINSDFYARNFFSFNFVFVFPYDCETSPYEPAIARLGKMFKVLEEQN 130

Query: 123 LILSKAEKDPIFYHFKQ--------VEIKDDQDAK-SKPEKGSHNLSKSQAYASEKYHKI 173
            ILSKAE DPI++            +   +D D K +K      N   S        ++I
Sbjct: 131 QILSKAENDPIYFKSDYTPYQPTLIIPTNNDNDGKRNKKLMKKENTIFSTRQQRSNSNRI 190

Query: 174 MT-----------------------DIE---SADSTFSLKDLVLRVYQDLNNYSECLIPI 207
           +                         IE   + +S  S++DL++R+YQDLNNYSECLIPI
Sbjct: 191 LEENSNSNSNSNSNSNGNENDNNYNTIEQYLNNNSRISVQDLIMRIYQDLNNYSECLIPI 250

Query: 208 DEGNAVDIKIFPMMTPPNSN-ISIEDVPVSTVNLNKVIDVNWDPTMLKIVPYINGLNSIS 266
           D+GN VDIKIFP++ PP +N +SIEDVP+S V+L K+ DVNWDPTMLK++P+ING+N IS
Sbjct: 251 DDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLTKITDVNWDPTMLKLIPFINGINDIS 310

Query: 267 KIAKLSVSDPGLVIECIKHLIYYNCVLLADIFQFSNIYAPTSSLRTFLTDSVLSTECQSY 326
           KI+KLS S P LVIECIKHLIYYNCV++ DIFQFSN Y+ TS + TFLTD  ++T CQ+Y
Sbjct: 311 KISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFSNTYSTTSLISTFLTDPNMATLCQNY 370

Query: 327 VVCEEDSTLPRLPFKRVNHSATESVDHELADXXXXXXXXXXXXXXXXXNGKFFPSSNNEM 386
           VV    S L RLPF     ++ +S                        NG+   S+++  
Sbjct: 371 VVLPLGSKLTRLPFHIETETSVQSSSAYRHHHNRHEKTPSFGSSITSNNGRSSFSADD-- 428

Query: 387 PALISEESLYRTGKHXXXXXXXXXXXXXXMLARYLPTKSCLFDLYRSLSQGTSLREWYGV 446
                     R                  +   +LPTK  LF+LYRSL+Q T L+ WY +
Sbjct: 429 ----------RKQSETSLNSSNDPSNSNLISTAHLPTKMSLFELYRSLNQRTDLKNWYKL 478

Query: 447 HYGTIRANRIDVRRFITFGVINGLIYRCYSYPIM 480
           +Y TI  N ID+R+FI FG+I GLIYRC+SYPI+
Sbjct: 479 NYTTIIENNIDIRKFIKFGIIKGLIYRCHSYPIV 512

 Score = 38.5 bits (88), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 39/91 (42%), Gaps = 7/91 (7%)

Query: 591 RLQNSDRPSKVSFDKQ---QEIGHISKGMSSSNDKVKMDEEAKXXXXXXXXXXXXSVEAA 647
           +L+     SKVSF  +   Q   +     SS ND    D+               S+   
Sbjct: 579 KLEKGKNHSKVSFSDKIAFQNDENDHSATSSDND----DKSKSQLTLKQRNILLDSISNM 634

Query: 648 DSLDTICVKLEMSRYDVEALIQNLGEYKIIN 678
           D++D ICVKL   R  +E  +   G+YK+IN
Sbjct: 635 DNMDKICVKLGRPRSQIEEWLSEFGDYKVIN 665

>Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)
          Length = 619

 Score =  462 bits (1189), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 220/372 (59%), Positives = 276/372 (74%), Gaps = 20/372 (5%)

Query: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60
           M   F+GF+PIHTIFY+VFHPTEG+K++YEFPP NL+SH INF+ IKNYIIPKP LCHKL
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60

Query: 61  LTLKYKNYRIASYPVTVNSPIYARXXXXXXXXXXXPYDCQTSPYEPAIARLGKMFKVLEE 120
           +T KY  YRI  YPVT+NSPIYAR           PYDC+TSPYEPAI RLGKMFKVLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QNLILSKAEKDPIFYHFKQVEIKDDQDAKSKPEKGSHNLS----------------KSQA 164
           QN +LSK+E+DP+F+  K +E      + + P   S+  S                +S  
Sbjct: 121 QNQLLSKSERDPVFFDLKAIENSLLTPSTAGPPATSNPSSNTTPTHPTSDKDAKDLRSNR 180

Query: 165 YASEKYHKIMTDIESADSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPP 224
           +  EKY+ I+ D+   +STFS++DL++R++QDLNNYSECLIPID+GNAVDIKIFP++ PP
Sbjct: 181 FNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLRPP 240

Query: 225 NSNISIEDVPVSTVNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIK 284
            + +S+EDVP+S+VNL K+IDVNWDPTM+ IVPYI+GLNSI+KI+K S SDP LVIECI+
Sbjct: 241 TTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIECIR 300

Query: 285 HLIYYNCVLLADIFQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFKRVN 344
           HLIYY CV L+DIFQFSNIYAP+S +R FLTD +++T+CQSYV   E S L  LP  +  
Sbjct: 301 HLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPLNK-- 358

Query: 345 HSATESVDHELA 356
               +SVD +L 
Sbjct: 359 --NFDSVDQDLT 368

 Score = 99.0 bits (245), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 52/62 (83%)

Query: 419 RYLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFGVINGLIYRCYSYP 478
           ++LPT+SCLFDLYRSLSQG +L+ WY + + T++ N ID+RRFITFG+   +IYRCYS+P
Sbjct: 435 QFLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFITFGLERSIIYRCYSFP 494

Query: 479 IM 480
           +M
Sbjct: 495 VM 496

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 50/86 (58%), Gaps = 13/86 (15%)

Query: 595 SDRPSKVSFDKQQEIGHISKGMSSSNDKV-KMDEEAKXXXXXXXXXXXXSVEAADSLDTI 653
           S+RPSKVSF+ Q+     +  +++  +K+ K+ +E K            S+ +A++ D I
Sbjct: 546 SERPSKVSFEMQR-----ANSLATGKNKIPKLSDEEKKILEK-------SIRSAENFDKI 593

Query: 654 CVKLEMSRYDVEALIQNLGEYKIINS 679
           CV L  S+ +VE  +  LGE+K+INS
Sbjct: 594 CVLLGKSKQEVENYLSELGEFKVINS 619

>KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON}
           Anc_6.17 YEL062W
          Length = 540

 Score =  456 bits (1174), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 274/692 (39%), Positives = 369/692 (53%), Gaps = 165/692 (23%)

Query: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60
           M  QFEGF PIHTIF+++FHPTEG+KV Y+FPP NL+++NINFD+IKN++IPKPQLCH+L
Sbjct: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60

Query: 61  LTLKYKNYRIASYPVTVNSPIYARXXXXXXXXXXXPYDCQTSPYEPAIARLGKMFKVLEE 120
           LTL+YKNYR+ SYPV V+S  YAR            YDCQT PYEPAI RLGKMFK LEE
Sbjct: 61  LTLEYKNYRLVSYPVNVSSSSYARNFFSFNFVFIFSYDCQTLPYEPAIERLGKMFKTLEE 120

Query: 121 QNLILSKAEKDPIFYHFKQVEIKDDQDAKSKPEKGSHNLSKSQAYASEKYHKIMTDIESA 180
           Q+ ILSK+++   F+       KD +D                             ++  
Sbjct: 121 QSQILSKSQRTSAFF-------KDGED-----------------------------VDFV 144

Query: 181 DSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPPNS-NISIEDVPVSTVN 239
           D+ FS++DL++R+YQDLNNYSECLIPIDEGN ++IKIFP++ PP S  ISIEDVP+S VN
Sbjct: 145 DTKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQISIEDVPLSIVN 204

Query: 240 LNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYYNCVLLADIFQ 299
           L+K++D+NWDPTML I+P+I+G+NSI+ I+ LS SDP LVIECIKHLIYYNCV++ DIFQ
Sbjct: 205 LDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIYYNCVIITDIFQ 264

Query: 300 FSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFKRVNHSATES-VDHELADX 358
           FSNIYAP+S +  FL D +++        C+    LP  P  ++N     S  D E+ + 
Sbjct: 265 FSNIYAPSSLINNFLRDPMIAFN------CQSYVVLP--PGSKINDLPLASEQDDEINNS 316

Query: 359 XXXXXXXXXXXXXXXXNGKFFPSSNNEMPALISEESLYRTGKHXXXXXXXXXXXXXXMLA 418
                                 +      A +SE + +                      
Sbjct: 317 DMTQKALSSSRSSFSSYFSHKSAY-----ARVSETAHHHQSTSTLSSSEGQQDNPRQ--G 369

Query: 419 RYLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFGVINGLIYRCYSYP 478
           + LP+K  LFDLYRSL+ G ++  WY  ++ TI+ N IDVR+FI FGVIN +IYR + YP
Sbjct: 370 QVLPSKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINKIIYRVHQYP 429

Query: 479 IMKNLEIFDLAKRLHREDISNHTVKHNKAKNP-------SKNIFSTSDIKFGVEYERQRN 531
           IM                      +H   K+P        K + STSDIKF         
Sbjct: 430 IM----------------------EHKTFKSPLLSDRQNDKIVLSTSDIKF--------- 458

Query: 532 KHHKALNLDIADEVLRNVYKKLSVTNSTDTRPNSADPIARLYRERSLGSLADGSTNNIYR 591
                   D+ D +L ++Y KL                                      
Sbjct: 459 --------DVGDRILNSIYNKL-------------------------------------- 472

Query: 592 LQNSDRPSKVSFDK----QQEIGHISKGMSSSNDKVKMDEEAKXXXXXXXXXXXXSVEAA 647
                  SKV+FD+    + +IG+ S+ +  S   +  +                ++E  
Sbjct: 473 -------SKVTFDRDKKLESKIGN-SRNLGESEKNILFN----------------ALERH 508

Query: 648 DSLDTICVKLEMSRYDVEALIQNLGEYKIINS 679
           +S D IC KL  S+ +VE++I  +GEY  INS
Sbjct: 509 ESFDRICSKLGKSKNEVESIISEIGEYMTINS 540

>Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON}
           YEL062W (REAL)
          Length = 615

 Score =  457 bits (1175), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 213/353 (60%), Positives = 269/353 (76%), Gaps = 11/353 (3%)

Query: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60
           M   F+GF+PIHTIFY+VFHPTEG+K++YEFPP NL++H INF+ IKNYIIPKP LCHKL
Sbjct: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60

Query: 61  LTLKYKNYRIASYPVTVNSPIYARXXXXXXXXXXXPYDCQTSPYEPAIARLGKMFKVLEE 120
           +T KY  YRI  YPVT+NSPIYAR           PYDC+TSPYEPAI RLGKMFKVLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QNLILSKAEKDPIFYHFKQVEIKDDQDAKSKPEKGSHNLSKS-----------QAYASEK 169
           QN +LSK+EKDP+F+  K +E      + + P   S+  S +           +   + +
Sbjct: 121 QNQLLSKSEKDPVFFDLKALENSTIAPSTACPPATSNTSSNTTPTHPTSDKDAKDLRNSR 180

Query: 170 YHKIMTDIESADSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPPNSNIS 229
           Y+ ++ D E  +STFS++DL++R++QDLNNYSECLIPIDEGNAVDIKIFP++ PP + +S
Sbjct: 181 YNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240

Query: 230 IEDVPVSTVNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYY 289
           +EDVP+S+VNL K+IDVNWDPTM+ IVPYI+GLNSI+KI+KLS SDP LVIECI+HLIYY
Sbjct: 241 LEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRHLIYY 300

Query: 290 NCVLLADIFQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFKR 342
            CV L+DIFQFSNIYAP+SS+R FLTD +++ +CQ YV   E S +  LP  +
Sbjct: 301 KCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNK 353

 Score = 94.7 bits (234), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 40/62 (64%), Positives = 49/62 (79%)

Query: 419 RYLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFGVINGLIYRCYSYP 478
           R+LPT+SCLFDLYRSLSQG +L+ WY   Y  I+ N ID+RRFITFG+   +IYR YSYP
Sbjct: 430 RFLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITFGLEKRIIYRSYSYP 489

Query: 479 IM 480
           +M
Sbjct: 490 VM 491

 Score = 51.2 bits (121), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 58/120 (48%), Gaps = 18/120 (15%)

Query: 563 PNSADPIARLYRERSLGSLADGST---NNIYRLQNSDRPSKVSFDKQQEIGHISKGMSSS 619
           PN ++   + Y E S   +   +    NNI     S RPSKVSFD Q+    I+    S+
Sbjct: 511 PNESNSSEKKYHEHSFSIIRSKNAVLFNNI----KSGRPSKVSFDMQKASSLITG--EST 564

Query: 620 NDKVKMDEEAKXXXXXXXXXXXXSVEAADSLDTICVKLEMSRYDVEALIQNLGEYKIINS 679
             K+  DEE              SV +A++ D ICV L   + +VE  +  LGE+KIINS
Sbjct: 565 IPKLSDDEE---------RILEESVRSAENFDKICVLLGKPKLEVENYLNELGEFKIINS 615

>NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.17
           YEL062W
          Length = 612

 Score =  424 bits (1089), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 204/344 (59%), Positives = 257/344 (74%), Gaps = 5/344 (1%)

Query: 3   DQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKLLT 62
           + FEGF+PIHTIFY++FHPTEGTKV YEFPP NL + +INFD IKNYIIPK QLC++LLT
Sbjct: 10  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69

Query: 63  LKYKNYRIASYPVTVNSPIYARXXXXXXXXXXXPYDCQTSPYEPAIARLGKMFKVLEEQN 122
            KY+NYRI SYP+T+N+P YAR           PY+C+TSPYEP+IARLGKMFK+LEEQ+
Sbjct: 70  FKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQS 129

Query: 123 LILSKAEKDPIFYHFKQVEIKDDQDAKSKPEKGSHNLSKSQAYASEKYHKIMTDI----E 178
            ILSKAE DPI++    V  +       +      N   +    +    +  TD     E
Sbjct: 130 QILSKAENDPIYFKSDYVPTEPTTTIIPQISPSHRNKRNNDHNDNNDGSRFETDFFGEEE 189

Query: 179 SADSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMT-PPNSNISIEDVPVST 237
              + FS++DL++R+YQDLNNYSECLIPID+GN ++IK+FP++  PPN  IS+EDVP+S 
Sbjct: 190 DGVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMSL 249

Query: 238 VNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYYNCVLLADI 297
           +NLN VIDVNWDPTML IVPYING+N ISKIAKL+ +DP LVIECIKHL+YYNCV++ DI
Sbjct: 250 INLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDI 309

Query: 298 FQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFK 341
           FQFSN+YAPTS + +FLTD  ++T+CQ+YVV    S L  LPF+
Sbjct: 310 FQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFE 353

 Score =  121 bits (303), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 87/261 (33%), Positives = 119/261 (45%), Gaps = 66/261 (25%)

Query: 420 YLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFGVINGLIYRCYSYPI 479
           +LPTK+CLFDLYRSLS G +LR WY  +   I  N +DVR+FI FG+I GLIYRC+SYPI
Sbjct: 413 HLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPI 472

Query: 480 MKNLEIFDLAKRLHREDISNHTVKHNKAKNPSKNIFSTSDIKFGVEYERQRNKHHKALNL 539
            +      + +     DI  H ++            S S  +         +    ++N+
Sbjct: 473 PQRPSNEGIQRIERLNDIDAHRLQIRS---------SGSAARSNSGSGSGSSASPSSINV 523

Query: 540 DIADEVLRNVYKKLSVTNSTDTRPNSADPIARLYRERSLGSLADGSTNNIYRLQNSDRPS 599
           D ADE+L+NVYKKL                                          +R S
Sbjct: 524 DGADELLKNVYKKL------------------------------------------ERHS 541

Query: 600 KVSF-DKQQEIGHISKGMSSSNDKVKMDEEAK--XXXXXXXXXXXXSVEAADSLDTICVK 656
           KVSF DK++            N+ +K DE+ +              S+E+ ++LD ICVK
Sbjct: 542 KVSFMDKEK------------NESMKTDEKGRPSTMTKEERSVLLKSIESLENLDKICVK 589

Query: 657 LEMSRYDVEALIQNLGEYKII 677
           L  SR  VE  +  LG YKII
Sbjct: 590 LGKSRQQVERWLDELGNYKII 610

>Kpol_1008.21 s1008 (41825..44221) [2397 bp, 798 aa] {ON}
           (41825..44221) [2397 nt, 799 aa]
          Length = 798

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 4/45 (8%)

Query: 216 KIFPMMTPPNS----NISIEDVPVSTVNLNKVIDVNWDPTMLKIV 256
           +I P+M PPN      +  + VP  T +LNK +DV   PTM  I 
Sbjct: 708 EILPIMVPPNDFSTRALQFQAVPSKTSSLNKTLDVESPPTMTPIT 752

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 68,972,143
Number of extensions: 2949019
Number of successful extensions: 9616
Number of sequences better than 10.0: 55
Number of HSP's gapped: 9864
Number of HSP's successfully gapped: 83
Length of query: 679
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 563
Effective length of database: 40,180,143
Effective search space: 22621420509
Effective search space used: 22621420509
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)