Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G045106.18ON96996951290.0
ZYRO0C07854g6.18ON94495029510.0
NDAI0I022606.18ON96796628120.0
NCAS0D026506.18ON95095928050.0
KAFR0A050506.18ON94894627430.0
Suva_15.1806.18ON94894726340.0
YOR005C (DNL4)6.18ON94494226090.0
Smik_15.1746.18ON94594225800.0
KNAG0F028706.18ON95495325640.0
Kpol_1032.76.18ON96594525400.0
Skud_15.1666.18ON94794425060.0
CAGL0E02695g6.18ON94695924800.0
Kwal_56.224146.18ON96395924170.0
TBLA0G010406.18ON97296423390.0
TPHA0M002606.18ON96696423330.0
KLTH0C11286g6.18ON95196923120.0
ACR008W6.18ON98197420220.0
KLLA0D01089g6.18ON90794119930.0
ACL155W7.343ON6974113004e-27
TBLA0E020507.343ON7204222924e-26
SAKL0F10912g7.343ON6934092881e-25
NDAI0A019407.343ON7654182863e-25
Kwal_56.246167.343ON7154092835e-25
Kpol_2001.717.343ON7264132764e-24
CAGL0I03410g7.343ON7244132754e-24
Suva_4.827.343ON7554132721e-23
KLTH0H01408g7.343ON7234112594e-22
KLLA0D12496g7.343ON7004092568e-22
TPHA0D045707.343ON7364062568e-22
YDL164C (CDC9)7.343ON7554092561e-21
Smik_4.747.343ON8454092552e-21
TDEL0C020407.343ON7054092495e-21
Skud_4.937.343ON7554092471e-20
NCAS0A141107.343ON7534142381e-19
ZYRO0F11572g7.343ON7314112381e-19
KNAG0C037407.343ON7274032327e-19
KAFR0B008307.343ON7104132237e-18
KLLA0B02200g6.228ON466103880.092
TDEL0D014401.276ON60360860.17
KAFR0F036004.80ON33561830.30
NCAS0D041006.228ON449103810.56
TBLA0A089104.80ON39049810.58
KNAG0F019006.228ON457104790.92
TPHA0A058203.518ON27675771.2
SAKL0E13860g2.29ON636109762.1
YGL035C (MIG1)4.80ON50461762.1
Suva_7.1336.228ON459104762.4
Skud_7.2494.80ON50279762.4
CAGL0I09570g6.228ON449233718.0
CAGL0G07843g3.447ON598107718.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G04510
         (969 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...  1980   0.0  
ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...  1141   0.0  
NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...  1087   0.0  
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...  1085   0.0  
KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...  1061   0.0  
Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...  1019   0.0  
YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...  1009   0.0  
Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...   998   0.0  
KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...   992   0.0  
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...   983   0.0  
Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...   969   0.0  
CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...   959   0.0  
Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...   935   0.0  
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...   905   0.0  
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...   903   0.0  
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...   895   0.0  
ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...   783   0.0  
KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...   772   0.0  
ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...   120   4e-27
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...   117   4e-26
SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...   115   1e-25
NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...   114   3e-25
Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...   113   5e-25
Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...   110   4e-24
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...   110   4e-24
Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...   109   1e-23
KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...   104   4e-22
KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...   103   8e-22
TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...   103   8e-22
YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...   103   1e-21
Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...   102   2e-21
TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...   100   5e-21
Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...   100   1e-20
NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...    96   1e-19
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...    96   1e-19
KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...    94   7e-19
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...    91   7e-18
KLLA0B02200g Chr2 (196341..197741) [1401 bp, 466 aa] {ON} highly...    39   0.092
TDEL0D01440 Chr4 complement(282138..283949) [1812 bp, 603 aa] {O...    38   0.17 
KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.8...    37   0.30 
NCAS0D04100 Chr4 (774815..776164) [1350 bp, 449 aa] {ON} Anc_6.2...    36   0.56 
TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa] ...    36   0.58 
KNAG0F01900 Chr6 (367193..368566) [1374 bp, 457 aa] {ON} Anc_6.2...    35   0.92 
TPHA0A05820 Chr1 complement(1319614..1320444) [831 bp, 276 aa] {...    34   1.2  
SAKL0E13860g Chr5 complement(1141665..1143575) [1911 bp, 636 aa]...    34   2.1  
YGL035C Chr7 complement(431548..433062) [1515 bp, 504 aa] {ON}  ...    34   2.1  
Suva_7.133 Chr7 (262417..263796) [1380 bp, 459 aa] {ON} YGL130W ...    34   2.4  
Skud_7.249 Chr7 complement(434181..435689) [1509 bp, 502 aa] {ON...    34   2.4  
CAGL0I09570g Chr9 complement(914062..915411) [1350 bp, 449 aa] {...    32   8.0  
CAGL0G07843g Chr7 (744599..746395) [1797 bp, 598 aa] {ON} highly...    32   8.9  

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score = 1980 bits (5129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 956/969 (98%), Positives = 956/969 (98%)

Query: 1   MESAEILTSTHEVSQELQESESTEKAPPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGN 60
           MESAEILTSTHEVSQELQESESTEKAPPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGN
Sbjct: 1   MESAEILTSTHEVSQELQESESTEKAPPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGN 60

Query: 61  KPLSVRYYEVISHFIRLWRKTVGNNIFPALVLSLPYRDRRIYNIKDYTLVKAICSYLALP 120
           KPLSVRYYEVISHFIRLWRKTVGNNIFPALVLSLPYRDRRIYNIKDYTLVKAICSYLALP
Sbjct: 61  KPLSVRYYEVISHFIRLWRKTVGNNIFPALVLSLPYRDRRIYNIKDYTLVKAICSYLALP 120

Query: 121 KQSATEKRLLKWKRRATRGVRLSNFCVEEIRKRKSEPSPGRRITIDKLNECLDHLVEERN 180
           KQSATEKRLLKWKRRATRGVRLSNFCVEEIRKRKSEPSPGRRITIDKLNECLDHLVEERN
Sbjct: 121 KQSATEKRLLKWKRRATRGVRLSNFCVEEIRKRKSEPSPGRRITIDKLNECLDHLVEERN 180

Query: 181 AKGGFKGLSDSPTFNFCLQNMSFIELRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSV 240
           AKGGFKGLSDSPTFNFCLQNMSFIELRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSV
Sbjct: 181 AKGGFKGLSDSPTFNFCLQNMSFIELRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSV 240

Query: 241 VSDLETVASRLWDPEHRLRRDDLSINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKM 300
           VSDLETVASRLWDPEHRLRRDDLSINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKM
Sbjct: 241 VSDLETVASRLWDPEHRLRRDDLSINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKM 300

Query: 301 DGERIQVHYMDYGAKIRFLSRRGVDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMIT 360
           DGERIQVHYMDYGAKIRFLSRRGVDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMIT
Sbjct: 301 DGERIQVHYMDYGAKIRFLSRRGVDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMIT 360

Query: 361 FDTDRNVVLPFGMVKSSARQALSTEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEF 420
           FDTDRNVVLPFGMVKSSARQALSTEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEF
Sbjct: 361 FDTDRNVVLPFGMVKSSARQALSTEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEF 420

Query: 421 LNRVLKPCPHAVEILPYVRCSEHTAIRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWI 480
           LNRVLKPCPHAVEILPYVRCSEHTAIRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWI
Sbjct: 421 LNRVLKPCPHAVEILPYVRCSEHTAIRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWI 480

Query: 481 KVKPEYLEQFGENLDLVIIGRTPGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEG 540
           KVKPEYLEQFGENLDLVIIGRTPGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEG
Sbjct: 481 KVKPEYLEQFGENLDLVIIGRTPGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEG 540

Query: 541 DELDDTDGKKIIKYFISFCVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKI 600
           DELDDTDGKKIIKYFISFCVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKI
Sbjct: 541 DELDDTDGKKIIKYFISFCVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKI 600

Query: 601 PEEWIDPKNSIMLEVKARSLDNTESSKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELW 660
           PEEWIDPKNSIMLEVKARSLDNTESSKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELW
Sbjct: 601 PEEWIDPKNSIMLEVKARSLDNTESSKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELW 660

Query: 661 QERLHKSSTGVGSFNXXXXXXXXXXXXXIDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDY 720
           QERLHKSSTGVGSFN             IDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDY
Sbjct: 661 QERLHKSSTGVGSFNKQYSKKMKSKKRKIDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDY 720

Query: 721 IDVSRNVRITKSEFDDLILQNSGKLVRNLISKHHSESQFRIISGKYTAECRALIERGYDI 780
           IDVSRNVRITKSEFDDLILQNSGKLVRNLISKHHSESQFRIISGKYTAECRALIERGYDI
Sbjct: 721 IDVSRNVRITKSEFDDLILQNSGKLVRNLISKHHSESQFRIISGKYTAECRALIERGYDI 780

Query: 781 LSPQWILDCIRNRMVVKLEPRHCFNVSSELMTIVNGRVDEYGDSFVNPITEQQLDNLIDT 840
           LSPQWILDCIRNRMVVKLEPRHCFNVSSELMTIVNGRVDEYGDSFVNPITEQQLDNLIDT
Sbjct: 781 LSPQWILDCIRNRMVVKLEPRHCFNVSSELMTIVNGRVDEYGDSFVNPITEQQLDNLIDT 840

Query: 841 NMKQTEPNLMREANSELDVVPLFLFSTRAVYIPPQVFNAVDAYGLTSKFKLHGGSIASDI 900
           NMKQTEPNLMREANSELDVVPLFLFSTRAVYIPPQVFNAVDAYGLTSKFKLHGGSIASDI
Sbjct: 841 NMKQTEPNLMREANSELDVVPLFLFSTRAVYIPPQVFNAVDAYGLTSKFKLHGGSIASDI 900

Query: 901 PSCNLIIMPNENQRLGTQSLVEMRQSVLQAMGRNDSTPSIPYIVTPDWVEKSIEENCQVP 960
           PSCNLIIMPNENQRLGTQSLVEMRQSVLQAMGRNDSTPSIPYIVTPDWVEKSIEENCQVP
Sbjct: 901 PSCNLIIMPNENQRLGTQSLVEMRQSVLQAMGRNDSTPSIPYIVTPDWVEKSIEENCQVP 960

Query: 961 EEDFTPVYA 969
           EEDFTPVYA
Sbjct: 961 EEDFTPVYA 969

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score = 1141 bits (2951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/950 (57%), Positives = 709/950 (74%), Gaps = 19/950 (2%)

Query: 24  EKAPPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGNKPLSVRYYEVISHFIRLWRKTVG 83
           +  P NFAPSPDF WLC+ELFVK+++VQ+Q R+H   K L+V+Y+E+IS F++LWRKTVG
Sbjct: 8   QNKPHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGAFKSLTVKYFEIISFFVKLWRKTVG 67

Query: 84  NNIFPALVLSLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEKRLLKWKRRATRGVRLS 143
           +NI+PAL+L LPYRDRRI+NIKDYTL+KAICS+L LP  S TEKRLL+WKRRA RG++LS
Sbjct: 68  DNIYPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRAGRGIKLS 127

Query: 144 NFCVEEIRKRKSEPSPGRRITIDKLNECLDHLVEERNAKG-GFKGLSDSPTFNFCLQNMS 202
           +FCVEEIR+R+SEP  G RITIDKLNECLD L EERN KG GFK L+DS  F +CL+NMS
Sbjct: 128 DFCVEEIRRRRSEPLNGERITIDKLNECLDQLAEERNTKGRGFKSLADSSVFKYCLENMS 187

Query: 203 FIELRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDLETVASRLWDPEHRLRRDD 262
           F E++++FDI+LK+RVIGGQEHK LNCWHPDA DYLSVVSDL+TVA +LWDP HRL+ DD
Sbjct: 188 FTEMKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPSHRLKNDD 247

Query: 263 LSINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRR 322
           L +NLG  F P LAK++ ISY+K+  +L +DF IEEKMDGERIQ+HYMDYG K+++ SRR
Sbjct: 248 LGVNLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRKLKWFSRR 307

Query: 323 GVDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQAL 382
           G DYT LYGE++ +GTVA YL  D  VR+CVLDGEMI+FDT+ N VLPFG+VKSSAR +L
Sbjct: 308 GNDYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSL 367

Query: 383 STEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSE 442
           + EGI +QG+RP+ MV+D +YLNGVSLI +PL  RK++L+ +L PCPHAVEI+  + C +
Sbjct: 368 TAEGILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHCYD 427

Query: 443 HTAIRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGRT 502
            T+I+ SLEK+I MGSEGI+LK +K++YEIGAR D WIK+KPEYLEQFGENLDL++IGR 
Sbjct: 428 DTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRD 487

Query: 503 PGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIA 562
           PGKKDSLMCGLAV EG+E   E  A+ +  +VNLDSE +E    + +K +K FISFC IA
Sbjct: 488 PGKKDSLMCGLAVLEGDE---EPGAQSDKQVVNLDSEEEE----EPRKAVKKFISFCTIA 540

Query: 563 NGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDN 622
           NGISQ+EFK+I+RKT G W  ++   P   +L FGSK+PEEWI P++S++LEVKARSLDN
Sbjct: 541 NGISQEEFKQIERKTAGKWKNTEDHKPPK-ILEFGSKLPEEWIYPEDSVVLEVKARSLDN 599

Query: 623 TESSKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQERLHKSSTGVGSFNXXXXXXX 682
           TESS +KF  GCTLHGGYCRRIR+DK+WT CY+  ELWQER  K      S N       
Sbjct: 600 TESSGRKFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERRKKVPLSEDSNNQKPMKSK 659

Query: 683 XXXXXXIDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDYIDVSRNVRITKSEFDDLILQNS 742
                 I     Q     D   +++IF GL FYV+SDY+    + RI+K +  DLI  N 
Sbjct: 660 KIRRPRIVSRLNQTLSCDDEAKTSSIFDGLIFYVISDYMASQDSERISKEQLCDLISGNG 719

Query: 743 GKLVRNLISKHHSESQFRIISGKYTAECRALIERGYDILSPQWILDCIRNRMVVKLEPRH 802
           GKL  N+IS H  +   RIISGKYT EC+ALIERGYDILSPQW++DC+    +V +EPRH
Sbjct: 720 GKLTFNVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDCVNTGFLVTIEPRH 779

Query: 803 CFNVSSELMTIVNGRVDEYGDSFVNPITEQQLDNLI-----DTNMKQTEPNLMREANSEL 857
           CF+VS ++  I   RVD +GDS+   ITE +L +++     D++      +++    S++
Sbjct: 780 CFSVSEDMEKIARTRVDHFGDSYDVEITEDRLRDILTSKEFDSDFSTGSLDVI----SDV 835

Query: 858 DVVPLFLFSTRAVYIPPQVFNAVDAYGLTSKFKLHGGSIASDIPSCNLIIMPNENQRLGT 917
           + +PLFLFS R V+I P+ F+ +D   L  K +L+GG +  ++  CNLII+P+    L  
Sbjct: 836 EDIPLFLFSRRIVFI-PEGFSYLDTQLLKHKVRLYGGQLTDNVNQCNLIIVPDGKINLRG 894

Query: 918 QSLVEMRQSVLQAMGRNDSTPSIPYIVTPDWVEKSIEENCQVPEEDFTPV 967
           + + ++R+ +       +  P+IP+IV P W+++SIEEN QVPEEDF  V
Sbjct: 895 RIISDLRRLLSTFAAMTELPPAIPWIVIPAWIDRSIEENIQVPEEDFLAV 944

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score = 1087 bits (2812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/966 (55%), Positives = 698/966 (72%), Gaps = 34/966 (3%)

Query: 19  ESESTEKAPPNFAPSPDFIWLCEELFVKLEDVQRQGREHLG---NKPLSVRYYEVISHFI 75
           ++++    P NFAPSP F WLC+ELFVKLE +Q+           KP++V+YYEVI HFI
Sbjct: 11  DNDTRPATPHNFAPSPSFRWLCDELFVKLERIQQASTSKASKEFQKPINVQYYEVIQHFI 70

Query: 76  RLWRKTVGNNIFPALVLSLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEKRLLKWKRR 135
            LWRKTVGN+I+PAL+L LPYRDRRIYN++DYTL+KAICSYL LPK S TEKRLL WK+R
Sbjct: 71  NLWRKTVGNDIYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFTEKRLLSWKQR 130

Query: 136 ATRGVRLSNFCVEEIRKRKSEPSPGRR--ITIDKLNECLDHLVEERNAKG--GFKGLSDS 191
           A R VRLS+F V EI+KRKSEP  G R  ITIDKLN+CLD L EERN+KG  G++GLSDS
Sbjct: 131 AGRSVRLSSFIVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNSKGSMGYRGLSDS 190

Query: 192 PTFNFCLQNMSFIELRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDLETVASRL 251
           PTF FCL+NM+F+EL+FFFDI+LK+RVIGG EHK LN WHPDA DYLSVVSDL+TVA++L
Sbjct: 191 PTFVFCLENMTFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVVSDLKTVANKL 250

Query: 252 WDPEHRLRRDDLSINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMD 311
           WDP   L+ DDL+IN+G  F PQ AKK++ISYEKIC KL +DF IEEKMDGERIQ+HY D
Sbjct: 251 WDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQD 310

Query: 312 YGAKIRFLSRRGVDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPF 371
           YG K+ FLSRRG DYT LYGE+++ GTV+ YL+ D+NV++CVLDGEM+TFD +RN +LPF
Sbjct: 311 YGNKLSFLSRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPF 370

Query: 372 GMVKSSARQALSTEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHA 431
           G+VKSSAR  ++ EG+ ++G+RP+LMV DLVYLNGVSL+ +PLYQRK +L ++  P  H 
Sbjct: 371 GLVKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHI 430

Query: 432 VEILPYVRCSEHTAIRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPEYLEQFG 491
           VE+L   RCS+  +I+ +LE +IS+GSEG+VLK Y +RY + +RND WIKVKPEYLEQFG
Sbjct: 431 VELLRSKRCSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVKPEYLEQFG 490

Query: 492 ENLDLVIIGRTPGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDS-------EGDELD 544
           EN+DL++IG+ PGKKDSLMCGLAV E +E   + +    + IVNLDS       E  E +
Sbjct: 491 ENMDLIVIGKDPGKKDSLMCGLAVVEEDEPEIDEDG---NEIVNLDSQDSIGEGEDKEGN 547

Query: 545 DTDGKKIIKYFISFCVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEW 604
           + + +K IK F+SFC IANGISQ+EFK I R T+G W KSD+  P +DLL FGS++P EW
Sbjct: 548 EIEREKTIKRFVSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSRVPAEW 607

Query: 605 IDPKNSIMLEVKARSLDNTESSKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQERL 664
           IDPK+SI++EVKARSL+N E + KKF  G TL+GGYCR+IR+DKDW  CY+ SEL + + 
Sbjct: 608 IDPKDSIVIEVKARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLSELRRMKR 667

Query: 665 HKSSTGVGSFNXXXXX---XXXXXXXXID-PFSGQAAKKHDVFDSTNIFKGLQFYVLSDY 720
            K  +   + N                ID  F     +     D + IF GL FYV+SD 
Sbjct: 668 FKLGSNKRANNDATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSRIFDGLYFYVISDV 727

Query: 721 IDVSRNVRITKSEFDDLILQNSGKLVRNLISKHHSESQFRIISGKYTAECRALIERGYDI 780
           +D + + R+++ E  D IL   G +V N+I+KHH E+QFRI+ GKYTAEC++LI+RGYDI
Sbjct: 728 VDATGS-RVSREELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLIDRGYDI 786

Query: 781 LSPQWILDCIRNRMVVKLEPRHCFNVSSELMTIVNGRVDEYGDSFVNPITEQQLDNLIDT 840
           + PQW+LDCI++ M++KLEP++CFNVS ELM I   RVD +GDSF   I+E     LI+ 
Sbjct: 787 IEPQWVLDCIKDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSFSRLIER 846

Query: 841 N---MKQTEPNLMREANSELDVVPLFLFSTRAVYIPPQVFNAVDAYGLTSKFKLHGGSIA 897
           N   ++   P++  +    +D VPLFLF  R + +  ++ +      L  + +L+GG   
Sbjct: 847 NVRSLRNAPPSIQYDM---VDTVPLFLFYGRTILL--RIKDKALFTKLKVQIRLYGGKTT 901

Query: 898 SDIPSCNLIIMPNENQRLGTQSLVEMRQSVLQAMGRNDSTPSIPYIVTPDWVEKSIEENC 957
            D+ SCNL+++      +      ++R S+L+     D  P +PYIVTP+W++ SI E C
Sbjct: 902 GDLASCNLVVIQQNEIAVAK----DVRSSLLKLTSDTDKPPVLPYIVTPEWIDSSISEGC 957

Query: 958 QVPEED 963
           QVPEED
Sbjct: 958 QVPEED 963

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score = 1085 bits (2805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/959 (55%), Positives = 686/959 (71%), Gaps = 19/959 (1%)

Query: 13  VSQELQESESTEK--APPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGNKPLSVRYYEV 70
           +SQ++Q S+       P NF+PSP F WLC+ELFVKLED+Q +       KP++VRYYEV
Sbjct: 1   MSQQIQLSQEPPPVMTPCNFSPSPAFQWLCDELFVKLEDIQSKRDPKNIGKPVTVRYYEV 60

Query: 71  ISHFIRLWRKTVGNNIFPALVLSLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEKRLL 130
           I+HFI LWRKTVGN+IFPAL+L LPYRDRR++NI+DYTL+KAIC+YL LP+ S TEKRLL
Sbjct: 61  INHFIALWRKTVGNDIFPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLL 120

Query: 131 KWKRRATRGVRLSNFCVEEIRKRKSEPSPGRRITIDKLNECLDHLVEERNAKG-GFKGLS 189
            WK RA +GV+LS FCV EI+KRKSEP     ITID+LNECLD L EERN+KG GFK L+
Sbjct: 121 SWKARAGKGVKLSQFCVNEIKKRKSEPKDKIEITIDRLNECLDKLAEERNSKGRGFKKLA 180

Query: 190 DSPTFNFCLQNMSFIELRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDLETVAS 249
           DSPTF FCL+NMSFIEL+FFFDI+LKNRVIGGQEHK LN WHPDA DYLSVVSDL TV +
Sbjct: 181 DSPTFKFCLENMSFIELQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTT 240

Query: 250 RLWDPEHRLRRDDLSINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHY 309
           RLWDPE RL+ +DL IN G+AF PQLAKK++ISYEKIC KL NDF+IEEKMDGERIQ+HY
Sbjct: 241 RLWDPEIRLQNNDLVINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHY 300

Query: 310 MDYGAKIRFLSRRGVDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVL 369
            DYG K++F SRRG DYT LYGE++  G +  +L  + +V+DC+LDGEMIT+D  +N++L
Sbjct: 301 QDYGEKLKFFSRRGTDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMIL 360

Query: 370 PFGMVKSSARQALSTEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCP 429
           PFG+VKSSAR  L+ +GI ++G++P+ MV DL+++NG SL  +PL  RKE+LN +  P P
Sbjct: 361 PFGLVKSSARSMLTKDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEP 420

Query: 430 HAVEILPYVRCSEHTAIRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPEYLEQ 489
           H +E+L         +IRKSLE +ISMGSEGIVLK Y +RY + +RND WIKVKPEYLEQ
Sbjct: 421 HIIELLSSYHRFNEDSIRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQ 480

Query: 490 FGENLDLVIIGRTPGKKDSLMCGLAVYEGEE--DLNEIEAKRESAIVNLDSEGDELDDTD 547
           FGEN+DL++IGR PGKKDSLMCGLAV E +E  DLNE     +  ++ LD   DE    +
Sbjct: 481 FGENMDLIVIGRDPGKKDSLMCGLAVVEEDEKADLNE---NNDDNVIILDD--DEDAPVE 535

Query: 548 GKKIIKYFISFCVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDP 607
            ++ I  F+SFCVIANG+SQ+EFK+IDRKTRG W +SD+  P   LL+FG+++P EWIDP
Sbjct: 536 QERTIHKFVSFCVIANGLSQEEFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDP 595

Query: 608 KNSIMLEVKARSLDNTESSKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQERLHKS 667
           K S+++EVKARS+D  ES+ +KFA GCTL+GGYCR IR+DKDW  CY+ SE  + +  KS
Sbjct: 596 KKSVVIEVKARSIDAAESNGRKFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVKS 655

Query: 668 STGVGSFNXXXXXXXXXXXXXIDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDYIDVSRNV 727
               GS                        ++  +  +T  F+ L FYV+SD  D     
Sbjct: 656 RRN-GSDQVIHGVKRQKKNRRKYILDQSLEEEGGLLKNTAFFRNLYFYVISDVFDDVLGT 714

Query: 728 RITKSEFDDLILQNSGKLVRNLISKHHSESQFRIISGKYTAECRALIERGYDILSPQWIL 787
           RI K      I +  G L+ N+ISK       RIISGK T EC ALIERGYD+++PQWI+
Sbjct: 715 RIEKERMYKYIQEGGGTLIHNIISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIV 774

Query: 788 DCIRNRMVVKLEPRHCFNVSSELMTIVNGRVDEYGDSFVNPITEQQLDNLIDT--NMKQT 845
           DC++++ ++KLEP++CFNVS+EL  +   RVD +GDS+  PITE+QL  L++T  N+ + 
Sbjct: 775 DCVQSKSLLKLEPKYCFNVSTELKKLTEKRVDTFGDSYEVPITEEQLSTLLETELNLVRV 834

Query: 846 EPNLMREANSELDVVPLFLFSTRAVYIPPQVFNAVDAYGLTSKFKLHGGSIASDIPSCNL 905
           +  +   A+ EL  +PLFLF  R +  P      +    L  K KL+GG + +DI  CNL
Sbjct: 835 QGLVTPYADEELIKIPLFLFQDRIMLFPNTESKTISF--LQEKIKLYGGKLTTDIGKCNL 892

Query: 906 IIMPNENQRLGTQSLVEMRQSVLQAMGRNDSTPSIPYIVTPDWVEKSIEENCQVPEEDF 964
           II+PN NQ+L    L   R  + + +  +   P+IPYIV P W+E+SIEEN QVPEED+
Sbjct: 893 IILPNGNQQL----LQRTRDLLTKNIMNSGEVPTIPYIVNPLWIERSIEENSQVPEEDY 947

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score = 1061 bits (2743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/946 (53%), Positives = 685/946 (72%), Gaps = 9/946 (0%)

Query: 25  KAPPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGNKPLSVRYYEVISHFIRLWRKTVGN 84
           + P NFAPSP F WLCEELF KLE+V  Q   HL  K +++RYYE+I++F+ LWR TVG+
Sbjct: 9   EVPRNFAPSPQFKWLCEELFSKLEEVPNQ--RHLTTKRITLRYYEIITNFVNLWRTTVGD 66

Query: 85  NIFPALVLSLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEKRLLKWKRRATRGVRLSN 144
           +I+PAL+L+LPYRDRR+YN+KDYTL+KAIC+YL LPK S TEKRLL WK+RA R V+LS 
Sbjct: 67  DIYPALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSVKLSV 126

Query: 145 FCVEEIRKRKSEPSPGRRITIDKLNECLDHLVEERNAKG-GFKGLSDSPTFNFCLQNMSF 203
            CV E+RKRKSEP     IT+D+LN  LD L ++RN KG G+K LS+S  F +C++ MSF
Sbjct: 127 SCVNEMRKRKSEPVEKSPITLDELNTLLDFLSQDRNIKGRGYKNLSESSIFTYCIEKMSF 186

Query: 204 IELRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDLETVASRLWDPEHRLRRDDL 263
           +ELR+FFDI+LK RVIG  EHKLLN WHPDA DYLSVVSDL+TV +RLW+P  RLR D+L
Sbjct: 187 MELRYFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLRHDEL 246

Query: 264 SINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRG 323
           SIN+GYAF P LAKK++ISY+KIC KL NDF IEEKMDGERIQ+HYMDYG  I+FLSRRG
Sbjct: 247 SINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFLSRRG 306

Query: 324 VDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALS 383
           VDYT LYGENL +GT+A YL  + +V++CVLDGEM+T+D D++++LPFGMVKS+A  AL+
Sbjct: 307 VDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNALT 366

Query: 384 TEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEH 443
            E I  Q + P+LMV DLV+LNG SL++ PLYQRK++L  VL+P    V+I+ + RCS  
Sbjct: 367 KEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSNE 426

Query: 444 TAIRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGRTP 503
             IRKSLE +IS+GSEGIVLK+Y +RY IG+RND WIK+KPEYLEQFGEN+DL++IGR  
Sbjct: 427 NIIRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIGRDS 486

Query: 504 GKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIAN 563
            KKDS  CGL V + EE+    E   +  +VNL S+  + ++ +  + IK  +SFC+IAN
Sbjct: 487 AKKDSFYCGLTVLDEEEEKLVEEI--DKGVVNLVSDESDYENPENNRHIKKVVSFCMIAN 544

Query: 564 GISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDNT 623
           GISQ E+KEI RKTRG W K+++  P  +L+ FG+++P EWI+P++S++LE+KARSLDNT
Sbjct: 545 GISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARSLDNT 604

Query: 624 ESSKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQERLHKSSTGVGSFNXXXXXXXX 683
           ESS K+F AGCTL+GGYCRRIRDD DW   +S +EL ++R  K   G    +        
Sbjct: 605 ESSCKRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGTSEKDTLLKSKKR 664

Query: 684 XXXXXIDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDYIDVSRNVRITKSEFDDLILQNSG 743
                + P + Q     D+  ++ IF GL FY+LSDY D + NVRI+K +   L+L+N G
Sbjct: 665 RKKQLLTPLN-QNLNPRDIQTTSKIFDGLFFYILSDYFDTNENVRISKDDLQKLLLENGG 723

Query: 744 KLVRNLISKHHSESQFRIISGKYTAECRALIERGYDILSPQWILDCIRNRMVVKLEPRHC 803
           K+  N++SK  S+S  RI+ GKYTAEC  LI+RGYDILSPQW++DC+ N+ +VK+EP HC
Sbjct: 724 KISHNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKIEPSHC 783

Query: 804 FNVSSELMTIVNGRVDEYGDSFVNPITEQQLDNLIDTNMKQTEPNLMREANSELDV--VP 861
           F+VS +LM +   RVD+YGDS+ + ++  +L  ++ ++ K   P+L+  AN  LD   VP
Sbjct: 784 FSVSDDLMALAMRRVDKYGDSYESLLSVSRLSYILRSS-KDISPDLLSPANMSLDFEKVP 842

Query: 862 LFLFSTRAVYIPPQVFNAVDAYGLTSKFKLHGGSIASDIPSCNLIIMPNENQRLGTQSLV 921
            FLF  R  ++    F+         K +L+GG +  +I  CN++I P     +  +S+ 
Sbjct: 843 YFLFWRRKAFVMEHNFDKSSIRETILKIQLYGGKVVKNISECNIVIFPKAEITVIRESMK 902

Query: 922 EMRQSVLQAMGRNDSTPSIPYIVTPDWVEKSIEENCQVPEEDFTPV 967
            +R ++ + +  +   P +P IV+ +W++ SIE+N QVPEED+ P+
Sbjct: 903 FIRNTLAKTVSTSVELPMLPRIVSFEWIDASIEKNVQVPEEDYVPM 948

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score = 1019 bits (2634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/947 (54%), Positives = 662/947 (69%), Gaps = 23/947 (2%)

Query: 27  PPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGNKPLSVRYYEVISHFIRLWRKTVGNNI 86
           P NFAPSPDF WLCEELF K+E+V   G    G K +S RYYE+IS+F  LWRKTVGNNI
Sbjct: 11  PHNFAPSPDFRWLCEELFAKVEEVLINGTAGTG-KSVSFRYYEIISNFTELWRKTVGNNI 69

Query: 87  FPALVLSLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEKRLLKWKRRATRGVRLSNFC 146
           +PAL+L+LPYRDRRIYNIKDY L++ +CSYL LPK S TE+RL  WK+R  +G  LS+  
Sbjct: 70  YPALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVGKGRSLSSLL 129

Query: 147 VEEIRKRKSEPSPGRRITIDKLNECLDHLVEERNAKG-GFKGLSDSPTFNFCLQNMSFIE 205
           VEEI KR++EP+  + IT+D +N  LD L +E NA G GFK L  S  F  CL+NM+F+E
Sbjct: 130 VEEISKRRTEPT-RKSITVDSVNFYLDELSKEMNASGRGFKNLVKSKPFLHCLENMTFVE 188

Query: 206 LRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDLETVASRLWDPEHRLRRDDLSI 265
           L+FFFDI+LKNRVIGGQEHKLLNCWHPDA DYLSVVSDL  V S+L+DP+ RL+ DDLSI
Sbjct: 189 LKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLKNDDLSI 248

Query: 266 NLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVD 325
            +G+AF PQLAKK+ +SYEKIC  L NDF +EEKMDGERIQVHYM+YG  I+F SRRG+D
Sbjct: 249 KVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRGID 308

Query: 326 YTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTE 385
           YT LYG NL SGT++ YL F  +V++CVLDGEM+TFD  R V+LPFG+VK SA++ALS  
Sbjct: 309 YTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALSFN 368

Query: 386 GICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTA 445
            I +    P+ MV DL+YLNG SL  LPLYQRKE+L+ +L P    VEI+ Y RC +  +
Sbjct: 369 DINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCYDAES 428

Query: 446 IRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGRTPGK 505
           ++KSLE +IS+GSEG+VLK Y + Y + +RN+ WIKVKPEYLE+FGENLDL+IIGR  GK
Sbjct: 429 VKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLIIIGRDSGK 488

Query: 506 KDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIANGI 565
           KDS M GL V + E++  + + +  S I+N  S   E   T+ KK ++  +SFC IANGI
Sbjct: 489 KDSFMLGLLVVD-EQETGKTDQEGPSEILNDSST--ERRATNPKKRVRKVLSFCSIANGI 545

Query: 566 SQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDNTES 625
           SQ+EFKEIDRKTRG W K+    P   +L FGSK+P EWI+P  SI+LE+K+RSLDNTE+
Sbjct: 546 SQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSLDNTET 605

Query: 626 SKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQERLHKS--STGVGSFNXXXXXXXX 683
           + +K+A  CTL+GGYCRRIR DKDWT CY+  EL++ R  KS  S  V +          
Sbjct: 606 NMQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSNPSHQVENLQLQLVPKKR 665

Query: 684 XXXXXIDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDYIDVSRNVRITKSEFDDLILQNSG 743
                 DPF     +K      + +F GL FYVLSDYI+    VRIT+SE +D+I+++ G
Sbjct: 666 KRALVSDPFQQSREQK----PISGVFAGLFFYVLSDYINSVTGVRITRSELNDVIVKHGG 721

Query: 744 KLVRNLISKHHSESQFRIISGKYTAECRALIERGYDILSPQWILDCIRNRMVVKLEPRHC 803
           KL+ N+I K H     R+I  K T ECRALI+RGYDIL P+WI+DC     ++ +EP +C
Sbjct: 722 KLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKLLPIEPSYC 781

Query: 804 FNVSSELMTIVNGRVDEYGDSFVNPITEQQLDNLIDTNMKQTEPNLM--REANS--ELDV 859
           F+VS +L  +   RVD +GDSF N I+E +L     +++++++P+L+  R+A+   EL +
Sbjct: 782 FSVSGKLRAVARRRVDCFGDSFENDISESKL-----SSLQKSQPDLLSTRQADKSFELQI 836

Query: 860 VPLFLFSTRAVYIPPQVFNAVDAYGLTSKFKLHGGSIASDIPSCNLIIMPNENQRLGTQS 919
           +PLFLFS R VYIP       D   L  K +L GG I       NLII+P  +       
Sbjct: 837 IPLFLFSNRIVYIPRSKIGPKDEMLLEMKIRLFGGKITDQQSLSNLIIIPYADPIWRGDC 896

Query: 920 LVEMRQSVLQAM--GRNDSTPSIPYIVTPDWVEKSIEENCQVPEEDF 964
           L E+   + + +    +D+ P IP IVTP+WV+ SI ENCQVPEEDF
Sbjct: 897 LEEVHSQINEHVKASNSDTVPRIPRIVTPEWVDHSISENCQVPEEDF 943

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score = 1009 bits (2609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/942 (53%), Positives = 658/942 (69%), Gaps = 11/942 (1%)

Query: 27  PPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGNKPLSVRYYEVISHFIRLWRKTVGNNI 86
           P NFAPSPDF WLCEELFVK+ +VQ  G    G K  S +YYE+IS+F+ +WRKTVGNNI
Sbjct: 11  PQNFAPSPDFKWLCEELFVKIHEVQINGTAGTG-KSRSFKYYEIISNFVEMWRKTVGNNI 69

Query: 87  FPALVLSLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEKRLLKWKRRATRGVRLSNFC 146
           +PALVL+LPYRDRRIYNIKDY L++ ICSYL LPK SATE+RL  WK+R  +G  LS+  
Sbjct: 70  YPALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVGKGGNLSSLL 129

Query: 147 VEEIRKRKSEPSPGRRITIDKLNECLDHLVEERNAKG-GFKGLSDSPTFNFCLQNMSFIE 205
           VEEI KR++EPS  + ITID +N  LD L  +R A G GFK L  S  F  C++NMSF+E
Sbjct: 130 VEEIAKRRAEPS-SKAITIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFLHCVENMSFVE 188

Query: 206 LRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDLETVASRLWDPEHRLRRDDLSI 265
           L++FFDIVLKNRVIGGQEHKLLNCWHPDA DYLSV+SDL+ V S+L+DP+ RL+ DDLSI
Sbjct: 189 LKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRLKDDDLSI 248

Query: 266 NLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVD 325
            +G+AF PQLAKK+ +SYEKIC  L++DFL+EEKMDGERIQVHYM+YG  I+F SRRG+D
Sbjct: 249 KVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRRGID 308

Query: 326 YTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTE 385
           YT LYG +L SGT++ +L F  +V++CVLDGEM+TFD  R V+LPFG+VK SA++ALS  
Sbjct: 309 YTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEALSFN 368

Query: 386 GICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTA 445
            I +    P+ MV DL+YLNG SL  LPL+QRK++LN +L P  + VEI+   RC    +
Sbjct: 369 SINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCYGVES 428

Query: 446 IRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGRTPGK 505
           I+KSLE +IS+GSEG+VLK Y + Y + +RN+ WIKVKPEYLE+FGENLDL++IGR  GK
Sbjct: 429 IKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLIVIGRDSGK 488

Query: 506 KDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIANGI 565
           KDS M GL V + EE   +      S IV+  S+   + ++  ++ +K  +SFC IANGI
Sbjct: 489 KDSFMLGLLVLDEEE--YKKHQGDSSEIVDHSSQEKHIQNS--RRRVKKILSFCSIANGI 544

Query: 566 SQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDNTES 625
           SQ+EFKEIDRKTRG W ++ +  P A +L FGSKIP EWIDP  SI+LE+K+RSLDNTE+
Sbjct: 545 SQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLDNTET 604

Query: 626 SKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQERLHKSSTGVGSFNXXXXXXXXXX 685
           + +K+A  CTL+GGYC+RIR DK+WT CY+ ++L++ R  KS+    +            
Sbjct: 605 NMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPSYQAERSQLGLIRKKR 664

Query: 686 XXXIDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDYIDVSRNVRITKSEFDDLILQNSGKL 745
              +   S    +K      +NIF GL FYVLSDY+     +RIT++E +  I+++ GKL
Sbjct: 665 KRVLISDSFHQNRKQ--LPISNIFAGLLFYVLSDYVTEDTGIRITRAELEKTIVEHGGKL 722

Query: 746 VRNLISKHHSESQFRIISGKYTAECRALIERGYDILSPQWILDCIRNRMVVKLEPRHCFN 805
           + N+I K HS    R+IS K T EC+ALI+RGYDIL P W+LDCI  + ++ +EP +CFN
Sbjct: 723 IYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAYKRLILIEPNYCFN 782

Query: 806 VSSELMTIVNGRVDEYGDSFVNPITEQQLDNLIDTNMKQTEPNLMREANSELDVVPLFLF 865
           VS ++  +   RVD  GDSF N I+E +L +L  + +    P    E +SE+   PLFLF
Sbjct: 783 VSQKMRAVAEKRVDCLGDSFENDISETKLSSLYKSQL-SLPPMGELEIDSEVRRFPLFLF 841

Query: 866 STRAVYIPPQVFNAVDAYGLTSKFKLHGGSIASDIPSCNLIIMPNENQRLGTQSLVEMRQ 925
           S R  Y+P +  +  D   +  K KL GG I      CNLII+P  +  L    + E+ +
Sbjct: 842 SNRIAYVPRRKISTEDDI-IEMKIKLFGGKITDQQSLCNLIIIPYTDPILRKDCMNEVHE 900

Query: 926 SVLQAMGRNDSTPSIPYIVTPDWVEKSIEENCQVPEEDFTPV 967
            + + +  +D+ P I  +V P+WV+ SI ENCQVPEEDF  V
Sbjct: 901 KIKEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDFPVV 942

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score =  998 bits (2580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/942 (52%), Positives = 657/942 (69%), Gaps = 10/942 (1%)

Query: 27  PPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGNKPLSVRYYEVISHFIRLWRKTVGNNI 86
           P NFAPSPDF WLCEELF K+++VQ +G    G K  S +YYEV+S+F+ +WRKTVGNNI
Sbjct: 11  PQNFAPSPDFKWLCEELFSKIDEVQVKGTIGTG-KSRSFKYYEVLSNFVEMWRKTVGNNI 69

Query: 87  FPALVLSLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEKRLLKWKRRATRGVRLSNFC 146
           +PAL+L+LPYRDRRIYNIKDY L++ ICSYL LPK SATE RL  WK+R  +G  LS+  
Sbjct: 70  YPALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVGKGKNLSSLL 129

Query: 147 VEEIRKRKSEPSPGRRITIDKLNECLDHLVEERNAKG-GFKGLSDSPTFNFCLQNMSFIE 205
           VEEI KR+SEP+ G+ ITID +N  LD L ++R+  G GFK L  S  F  CL++MSF+E
Sbjct: 130 VEEIAKRRSEPN-GKAITIDGINSTLDELSKDRSTSGRGFKNLVKSSPFLHCLESMSFVE 188

Query: 206 LRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDLETVASRLWDPEHRLRRDDLSI 265
           L++FFDI+LK+RVIGGQEHK L+CWHPDA DYLSVVSDL+ VAS+L+DP  RL+ DDL+I
Sbjct: 189 LKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVRLKNDDLTI 248

Query: 266 NLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVD 325
            +G+AF PQLAKK+ + YEKIC  L+NDFL+EEKMDGERIQVHYM+YG  +RF SRRG+D
Sbjct: 249 KVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRGID 308

Query: 326 YTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTE 385
           YT LYG +L SGT++++L+F  NVR+CVLDGEM+TFD  R V+LPFG+VK SA+ ALS  
Sbjct: 309 YTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDALSFN 368

Query: 386 GICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTA 445
            I +    P+ +V DL+YLNG SL  LPL+QRKE+L  +L P  + VE++   RC    +
Sbjct: 369 SINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRCYNVES 428

Query: 446 IRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGRTPGK 505
           I+KSLE +IS+GSEG+VLK Y + Y + +RN+ WIKVKPEYLE+FGENLDLVIIGR PGK
Sbjct: 429 IKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLVIIGRDPGK 488

Query: 506 KDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIANGI 565
           KDS M GL +   E+++++ + +  S I N +S+ + +     +K +K  +SFC +ANGI
Sbjct: 489 KDSFMLGLLLL-NEKEMDKRDQEVSSGIAN-NSKNENI--LYSQKKVKKILSFCSVANGI 544

Query: 566 SQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDNTES 625
           SQ+EFKEIDRKTRG W K+ +  P A +  FGSKIP EWI+P  SI+LE+K+RSLDNTE+
Sbjct: 545 SQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRSLDNTET 604

Query: 626 SKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQERLHKSSTGVGSFNXXXXXXXXXX 685
           + +K+A  CTL+GGYC+RIR DKDWT C++ +EL+  R  + +    +            
Sbjct: 605 NMQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAEKSHLKLVRKKR 664

Query: 686 XXXIDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDYIDVSRNVRITKSEFDDLILQNSGKL 745
              +   S    +K +   ++ IF GL FYVLSDY+  +  VRIT+ E ++ I+++ G+L
Sbjct: 665 REVLT--SNTFDQKTEQIPTSIIFAGLYFYVLSDYVTNASEVRITRGELENAIVRHGGRL 722

Query: 746 VRNLISKHHSESQFRIISGKYTAECRALIERGYDILSPQWILDCIRNRMVVKLEPRHCFN 805
           + N+I K H     R+IS K T ECRALI RGYDIL P W++DC+  + ++ +EP +CFN
Sbjct: 723 IYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIPIEPCYCFN 782

Query: 806 VSSELMTIVNGRVDEYGDSFVNPITEQQLDNLIDTNMKQTEPNLMREANSELDVVPLFLF 865
           VS ++  +   RVD  GDSF N I+E +L  L  +      P  + E ++E+ V PLFLF
Sbjct: 783 VSQKMRAVAEKRVDCLGDSFENDISETKLSLLYKSQHNLPPPEEV-ERDAEVQVFPLFLF 841

Query: 866 STRAVYIPPQVFNAVDAYGLTSKFKLHGGSIASDIPSCNLIIMPNENQRLGTQSLVEMRQ 925
           S R VYIPP+         L  K +L GG I      CNL+I+P  +       + E+ +
Sbjct: 842 SNRIVYIPPRKIGMKYEKTLEMKIRLFGGKITDRQSLCNLVIIPYGDPTWRKDCIKEVNE 901

Query: 926 SVLQAMGRNDSTPSIPYIVTPDWVEKSIEENCQVPEEDFTPV 967
            + + +   D+ P IP IV P+WV+ SI  NCQVPEEDF  V
Sbjct: 902 QIKEQVKALDTIPKIPRIVAPEWVDHSIYGNCQVPEEDFPVV 943

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score =  992 bits (2564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/953 (51%), Positives = 659/953 (69%), Gaps = 10/953 (1%)

Query: 20  SESTEKAPPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGNKPLSVRYYEVISHFIRLWR 79
           SE  E+ P NFAPSPDF WLC+ELFVK + V  Q R  +  KP++VRYYEV+S+F++LWR
Sbjct: 2   SEKVEEGPTNFAPSPDFQWLCDELFVKFDLVATQDR-RINLKPITVRYYEVVSNFVQLWR 60

Query: 80  KTVGNNIFPALVLSLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEKRLLKWKRRATRG 139
           KTVGNN +P L+L+LPYRDRR YNIKD TL+KAIC YL LPK+S+TEK+LL WK+RA+R 
Sbjct: 61  KTVGNNFYPVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRN 120

Query: 140 VRLSNFCVEEIRKRKSEPSPGRR--ITIDKLNECLDHLVEERNAKG-GFKGLSDSPTFNF 196
            RLS+FCV EIRKRKS P P +R  IT+DKLN  LD L   ++++G G + L+DS  F F
Sbjct: 121 ERLSSFCVAEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSRGQGSRTLADSSHFKF 180

Query: 197 CLQNMSFIELRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDLETVASRLWDPEH 256
           CL+NMSFIEL++FFDI+LK R+IGG EHKLLN WHPDA+DY SVVSDL +V  +L++P  
Sbjct: 181 CLENMSFIELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSV 240

Query: 257 RLRRDDLSINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKI 316
           RLR +DL++ +G AF P LAK++ ISYEKI  KL +DF IEEKMDGERIQ+HYMDYG +I
Sbjct: 241 RLRNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEI 300

Query: 317 RFLSRRGVDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKS 376
           +FLSRRG DYT LYG +  +GT+A YL  + NV++C+LDGEM+T+D ++ ++LPFG+VKS
Sbjct: 301 KFLSRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKS 360

Query: 377 SARQALSTEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILP 436
           SA+  LS E I +  + P+ M  DLVYLNG SL+ LPLYQRK++L+++L  C   V+I+ 
Sbjct: 361 SAKNFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVS 420

Query: 437 YVRCSEHTAIRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPEYLEQFGENLDL 496
           + RC+   +I KSL  +IS+GSEGI+LK   +RY + +RND WIK+KP+YL+QFGEN+DL
Sbjct: 421 FARCNNLESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDL 480

Query: 497 VIIGRTPGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFI 556
           +IIGR PGKKD+ MC L V   ++    +  + E+  ++LD+E  E +     +I+K F+
Sbjct: 481 IIIGRDPGKKDAFMCALGV-TIDDPQPRVLQQEENVNLDLDTEDSEPETPKASRIVK-FV 538

Query: 557 SFCVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVK 616
           SFC IANGIS  EFKEID+KTRG W + DQ  P ++ L+FG+K P EWIDPK S++LEVK
Sbjct: 539 SFCTIANGISNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEVK 598

Query: 617 ARSLDNTESSKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQERLHK-SSTGVG-SF 674
           +RSLDNTES+ KK+ AG TL GGYCR +R DKDWT CY+ SE  ++R +K      G S 
Sbjct: 599 SRSLDNTESNVKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYKLPKVNAGESI 658

Query: 675 NXXXXXXXXXXXXXIDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDYIDVSRNVRITKSEF 734
                         I        K+    + ++IF+ L F VLSDY+D     RI ++  
Sbjct: 659 TTSNKGRKKRNTTSILGVISPRKKRTPEGEHSDIFQNLHFCVLSDYLDPYTGNRIDRNTL 718

Query: 735 DDLILQNSGKLVRNLISKHHSESQFRIISGKYTAECRALIERGYDILSPQWILDCIRNRM 794
             LI+   GK++ N+++K   E   RII   +  EC ALI+RGYDILSP W+LDCI +  
Sbjct: 719 TQLIIDYGGKVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIESAR 778

Query: 795 VVKLEPRHCFNVSSELMTIVNGRVDEYGDSFVNPITEQQLDNLIDTNMKQTEPNLMREAN 854
           ++KLE  HCFNVS ELM + + RVDEY DSF N I+  +LD LID ++           N
Sbjct: 779 LLKLERNHCFNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNMPSGSFSGEN 838

Query: 855 --SELDVVPLFLFSTRAVYIPPQVFNAVDAYGLTSKFKLHGGSIASDIPSCNLIIMPNEN 912
              EL  +P  LF  R+V+I     +      ++S+ KL GG +   I  CNLII+PN +
Sbjct: 839 LDFELRGLPPLLFFDRSVFIAETKLSDRIYAKISSETKLFGGQVTHTIEDCNLIIIPNTD 898

Query: 913 QRLGTQSLVEMRQSVLQAMGRNDSTPSIPYIVTPDWVEKSIEENCQVPEEDFT 965
                Q L ++R  +   + + +ST  IP IV+ +W+ +SI+EN QVPEE+++
Sbjct: 899 DEDKIQVLQKIRGKLASMIQKLNSTERIPPIVSEEWLYQSIKENIQVPEENYS 951

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score =  983 bits (2540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/945 (50%), Positives = 662/945 (70%), Gaps = 14/945 (1%)

Query: 27  PPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGNKPLSVRYYEVISHFIRLWRKTVGNNI 86
           P NF+PSPDF WLC+ELFVKL+ +Q + +E  G+KP  + YY++I++FI +WR+TVGN+I
Sbjct: 31  PHNFSPSPDFKWLCDELFVKLDQIQFRPKELNGSKPKYIEYYDIINNFIDIWRRTVGNDI 90

Query: 87  FPALVLSLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEKRLLKWKRRATRGVRLSNFC 146
           +PAL+L++PYRDRR+YNIK+  L++ +C YL LPK S TE+RL++WK RA R VRLS FC
Sbjct: 91  YPALILTIPYRDRRMYNIKESKLIRIVCDYLKLPKNSETERRLMRWKHRADRNVRLSTFC 150

Query: 147 VEEIRKRKSEPSPGRRITIDKLNECLDHLVEERNAKGG-FKGLSDSPTFNFCLQNMSFIE 205
           VEEI+KRK EP    +ITIDKLNECLD+LV ER  KG   + +S+S TF FC +NM+++E
Sbjct: 151 VEEIKKRKGEPREKIKITIDKLNECLDNLVLERGYKGSKSQKISESETFKFCFENMTYVE 210

Query: 206 LRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDLETVASRLWDPEHRLRRDDLSI 265
           L++FFDI+LK++++GG EHK LNCWHPDA DYLSVVSDL+ V+S+LW+PE RL+ DDL+I
Sbjct: 211 LKYFFDILLKDKIVGGLEHKFLNCWHPDAQDYLSVVSDLKIVSSKLWNPEFRLKYDDLTI 270

Query: 266 NLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVD 325
           N+ +AF P+ AK++T SY+ I  +L NDF IEEKMDGERIQ+HYM+YGAK++FLSRRG+D
Sbjct: 271 NIDHAFTPETAKRLTYSYDTIARRLKNDFFIEEKMDGERIQLHYMNYGAKLKFLSRRGLD 330

Query: 326 YTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTE 385
           Y+ LYG+N  +G +  YLNF  +V++C+LDGEM+T+D+ +N +LPFG+VKSSA Q+LS  
Sbjct: 331 YSYLYGDNRNNGAIGRYLNFHKDVKECILDGEMVTYDSVKNCILPFGLVKSSAMQSLSVS 390

Query: 386 GICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTA 445
            I   G+ P+ M  DLVYLNG SL  LPL+QRK +L+++L PCP  VEILP + C++ + 
Sbjct: 391 DIEPDGYHPLYMAFDLVYLNGSSLSTLPLHQRKNYLDKLLIPCPDFVEILPALHCNDSSL 450

Query: 446 IRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGRTPGK 505
           I+ SLEK+I +GSEGI+LK + ++Y +  R+D WIK+KPEYLEQFGEN+DL++IGR PGK
Sbjct: 451 IKSSLEKAIELGSEGIILKRFDSQYLVAKRSDDWIKIKPEYLEQFGENMDLIVIGRDPGK 510

Query: 506 KDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIANGI 565
           KDSLMCGL +  G+ +  EI +        LDS   +  ++  K   +  ISFC IANGI
Sbjct: 511 KDSLMCGL-ILTGDNEPEEITS--------LDSNPTDTAESFLKPDKRKIISFCNIANGI 561

Query: 566 SQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDNTES 625
           SQ+EF++IDR T G W+K D  LP  DL  FG+K P EWI P++S++LE+KARSL+  ES
Sbjct: 562 SQKEFRDIDRYTFGHWIKFDDELPPQDLFEFGTKHPIEWIYPEHSVVLEIKARSLETNES 621

Query: 626 SKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQER-LHKSSTGVGSFNXXXXXXXXX 684
           ++ K+  G TL GGYCR+IR DKDW  C++++E  + R L  +                 
Sbjct: 622 ARIKYGTGSTLFGGYCRQIRYDKDWVSCFTYNEFMESRNLKNALVNYPDNKNLIGRKKRP 681

Query: 685 XXXXIDPFSGQAAKKHDVFDSTN-IFKGLQFYVLSDYIDVSRNVRITKSEFDDLILQNSG 743
                +  +       D  D +N IF+GL FYV+SDYID +   R++KS+  +L+L+++G
Sbjct: 682 KKRMFNSLTEIFENTKDAPDESNVIFRGLHFYVISDYIDETDGSRLSKSDLCNLVLEHNG 741

Query: 744 KLVRNLISKHHSESQFRIISGKYTAECRALIERGYDILSPQWILDCIRNRMVVKLEPRHC 803
           KLV N IS+    ++ RIIS KYT E  +LIERGYDI+ PQWILDCI NR +V+L P HC
Sbjct: 742 KLVHNPISRIDILNRLRIISMKYTRETTSLIERGYDIIHPQWILDCISNRKLVRLLPSHC 801

Query: 804 FNVSSELMTIVNGRVDEYGDSFVNPITEQQLDNLIDTNMKQTEPNLMREANSELDV-VPL 862
           FNVSS LM +   RVD YGDS+   +TE+  + LI+  + ++E    R    E  + +P+
Sbjct: 802 FNVSSSLMEVTKTRVDRYGDSYETSLTEKDFEILINRQVLKSESADKRITEGENHLKIPI 861

Query: 863 FLFSTRAVYIPPQVFNAVDAYGLTSKFKLHGGSIASDIPSCNLIIMPNENQRLGTQSLVE 922
            LF  R  +I P+   +   Y L SK +L+GG + + I  CN+I+  N +     + + +
Sbjct: 862 LLFCNRRFFI-PETLPSTPIYELKSKVELYGGKLVNKISDCNVIVFTNTHTENRKEVMKK 920

Query: 923 MRQSVLQAMGRNDSTPSIPYIVTPDWVEKSIEENCQVPEEDFTPV 967
           +R++++     +   P +P IV  +W++  I E  QVPEED+  V
Sbjct: 921 IRRALVCLDPNSMQVPVLPRIVDANWIDACISECVQVPEEDYPAV 965

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score =  969 bits (2506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/944 (52%), Positives = 656/944 (69%), Gaps = 13/944 (1%)

Query: 27  PPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGNKPLSVRYYEVISHFIRLWRKTVGNNI 86
           P NFAPSPDF WLCEELFV++++V+  G    G K  S +YYE+IS+F+  WRK VGNNI
Sbjct: 11  PQNFAPSPDFKWLCEELFVRIDNVRINGTAGTG-KSASFKYYEIISNFVESWRKGVGNNI 69

Query: 87  FPALVLSLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEKRLLKWKRRATRGVRLSNFC 146
           +PALVL+LPYRDRRIYNIKDY L++ ICSYL LP+ S TE+RL  WK+R +R   LS+  
Sbjct: 70  YPALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVSRARNLSSLL 129

Query: 147 VEEIRKRKSEPSPGRRITIDKLNECLDHLVEERNAKG-GFKGLSDSPTFNFCLQNMSFIE 205
           VEEI KR+ EP+ G+ ITID +N+ LD L +ER+  G GFK L +S  F  CL++MSF+E
Sbjct: 130 VEEIAKRRPEPN-GKSITIDGVNDYLDELSKERSISGRGFKDLVNSKPFLSCLESMSFVE 188

Query: 206 LRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDLETVASRLWDPEHRLRRDDLSI 265
           L++FFDIVLKNRVIGGQEH+ LNCWHPDA DYLSVVSDL+ V S+L+DP  RL+ DDLSI
Sbjct: 189 LKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVRLKNDDLSI 248

Query: 266 NLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVD 325
            +G+AF PQLAKK+++ YEKIC  L+NDFLIEEKMDGERIQVHYM+YG  I+F SRRG+D
Sbjct: 249 KVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRGID 308

Query: 326 YTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTE 385
           YT LYG +L SGT++ YL   + V++CVLDGEM+TFD+ R V+LPFG+VK SA+  LS  
Sbjct: 309 YTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLSCS 368

Query: 386 GICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTA 445
            I +   RP+ MV DL+YLN +SL  LPL+QRK++L+ +L P  + VEI+   RC +  +
Sbjct: 369 DINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDVQS 428

Query: 446 IRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGRTPGK 505
           ++ SLE +IS+GSEG+VLK Y + Y I +RN  WIKVKPEYLE+FGENLDL+IIGR  GK
Sbjct: 429 VKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLIIIGRDSGK 488

Query: 506 KDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIANGI 565
           KDS M GL V + E ++ E + +  S+ V  DS+ ++ D  + KK +K  +SFC +ANGI
Sbjct: 489 KDSFMLGLLVID-EREMEERDQELSSSEVVNDSKIEQ-DVINSKKKVKKVLSFCSVANGI 546

Query: 566 SQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDNTES 625
           S +EFKEI+R+TRG W ++    P + +L+FGS+IP EWI+P +SI+LE+K+RSLDNTE+
Sbjct: 547 SHEEFKEINRRTRGHWKRTSDFSPPS-ILQFGSRIPAEWIEPSDSIVLEIKSRSLDNTET 605

Query: 626 SKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQERLHKSSTGVG--SFNXXXXXXXX 683
           S +++A  CTL+GGYCRRIR DKDWT CY+ ++L+++R  KS       +F         
Sbjct: 606 SIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDENFQLQLAHKKR 665

Query: 684 XXXXXIDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDYIDVSRNVRITKSEFDDLILQNSG 743
                 DPF     +K      ++IF GL FYVLSDY+     VRIT++  +D I+++ G
Sbjct: 666 KRALISDPFHQIREQKL----ISSIFAGLFFYVLSDYVTKDTGVRITRAGLEDAIVKHGG 721

Query: 744 KLVRNLISKHHSESQFRIISGKYTAECRALIERGYDILSPQWILDCIRNRMVVKLEPRHC 803
           KL+ N+I K H     R+IS K T ECR LI+RGYDI+ P W++DCI  + ++ +EP +C
Sbjct: 722 KLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYKQLIFIEPSYC 781

Query: 804 FNVSSELMTIVNGRVDEYGDSFVNPITEQQLDNLIDTNMKQTEPNLMREANSELDVVPLF 863
           F+VS +L  +   RVD  GDSF N I+E++L  L  +    +    +   +SE  V+PLF
Sbjct: 782 FSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFKSRQDLSSIGEI-GIDSEAQVIPLF 840

Query: 864 LFSTRAVYIPPQVFNAVDAYGLTSKFKLHGGSIASDIPSCNLIIMPNENQRLGTQSLVEM 923
           LFS R VYIP       +   L  K +L GG I      CNLII+P  +       + ++
Sbjct: 841 LFSNRIVYIPRTKTGLREEKLLEMKIRLFGGEITGQQSLCNLIIIPYVDSSRRKDCIEKV 900

Query: 924 RQSVLQAMGRNDSTPSIPYIVTPDWVEKSIEENCQVPEEDFTPV 967
            + + + M  + + P +  IV+P WV+ SI ENCQVPEEDF  V
Sbjct: 901 NEQIKEQMKASHTVPKVARIVSPGWVDHSINENCQVPEEDFPVV 944

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score =  959 bits (2480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/959 (49%), Positives = 662/959 (69%), Gaps = 42/959 (4%)

Query: 19  ESESTEKAPPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGNKPLSVRYYEVISHFIRLW 78
           E + TE+   NFAPSPDF+WLCE+LF K++ VQ +   +L  KP++ RYYEVIS+F  LW
Sbjct: 14  ELKGTEEQAVNFAPSPDFLWLCEQLFAKIDHVQFERANNLLTKPVTARYYEVISNFTTLW 73

Query: 79  RKTVGNNIFPALVLSLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEKRLLKWKRRATR 138
           R TVGNNI+PAL L LPYRDRR++NIKDYTL+KAIC++L LPK S+TEK+L+ WK+ A R
Sbjct: 74  RTTVGNNIYPALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKKLINWKQDAGR 133

Query: 139 GVRLSNFCVEEIRKRKSEPSPGR--RITIDKLNECLDHLVEERNAKG-GFKGLSDSPTFN 195
            VRLS FCVEEI+KR+SEP   R  RITID LN  LD L  ER  +G  FK L++S   N
Sbjct: 134 SVRLSKFCVEEIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTEQGRSFKNLANSDIMN 193

Query: 196 FCLQNMSFIELRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDLETVASRLWDPE 255
            CL +M+F+E+++FFDI+LKNR +GG EHKLLNCWHPDA DYLSVVSDLETVA RLWDP 
Sbjct: 194 KCLTSMTFLEMQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLETVAKRLWDPS 253

Query: 256 HRLRRDDLSINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAK 315
            RL   DL IN+G AF PQLA K+ +SY+KI  KL  DF IEEKMDGERIQ+HY ++G+ 
Sbjct: 254 QRLGNQDLKINIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSD 313

Query: 316 IRFLSRRGVDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVK 375
           I+F SRR  DYT LYG NL++GT+AN++N + NV+DCVLD E++TFD++  +VLPFGMVK
Sbjct: 314 IKFYSRRATDYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVK 373

Query: 376 SSARQALSTEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEIL 435
           SSA+  LS +GI +QG  P+LMV D++YLNG +L+ LP Y+R+E+L ++L P  H +EI+
Sbjct: 374 SSAKNMLSQDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEII 433

Query: 436 PYVRCSEHTAIRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPEYLEQFGENLD 495
             +R ++   I+KSLEK++S+GSEGI+LK Y +RY I +R+D WIK+KPEYLEQFGEN+D
Sbjct: 434 KSIRANDEQMIKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMD 493

Query: 496 LVIIGRTPGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYF 555
           LV++GR P KKDSLM GL  YE        E  ++S I+ ++S+  E    +  +  + F
Sbjct: 494 LVLMGRDPSKKDSLMLGLLDYE--------EVIQDSPIM-VNSQSSE----ENSQRFRGF 540

Query: 556 ISFCVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEV 615
           +S C+IANGIS +E+KEIDRKT+G W  S +++P  + ++FGSK+P +WIDPK S++LE+
Sbjct: 541 VSLCIIANGISNEEYKEIDRKTKGLWNDS-EKIPPLEYMKFGSKVPRQWIDPKKSLILEI 599

Query: 616 KARSLDNTESSKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQERLHKSSTGVGSFN 675
           KARSLDNT SS++KFAAGCTL GGYCR+IR+DK+W  CY+  E  + +   +    GS  
Sbjct: 600 KARSLDNTRSSERKFAAGCTLFGGYCRQIREDKNWKTCYTLQEFERAKSGNNWRKRGSSK 659

Query: 676 XXXXXXXXXXXXXIDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDYIDVSRNVRITKSEFD 735
                        I   +       ++   ++IF G+ FYVLSDY D  +  RI KSE  
Sbjct: 660 PQKVISKKRRYNIISSVNKALEDFAELEHRSDIFDGMYFYVLSDYFDGVKRKRIKKSEIQ 719

Query: 736 DLILQNSGKLVRNLISKHHSESQFRIISGKYTAECRALIERGYDILSPQWILDCIRNRMV 795
            +I+ N G+LV+N+I+++++ +  RIIS + T EC +LI RGYDI+SP+W+ DC+ +  +
Sbjct: 720 KVIVANGGQLVQNVITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCLLSGKI 779

Query: 796 VKLEPRHCFNVSSELMTIVNGRVDEYGDSFVNPITEQQLDNL----IDTNMKQTEPNLMR 851
           +KLEP HCFN S +LM     R+D+YGD +   I + +  +L    I T  KQ +P++  
Sbjct: 780 MKLEPSHCFNFSKQLMDYAYKRIDQYGDPYERDINKYEWSSLTSEKICTTAKQ-QPDVQF 838

Query: 852 EANSELDVVPLFLFSTRAVYIPPQVFN------AVDAYGLTSKFKLHGGSIASDIPSCNL 905
           + NS +D VP FLF  R V++     N       VDAY         GG + +++ S NL
Sbjct: 839 D-NSLMD-VPHFLFHGRIVFLLSDNNNIQKESFMVDAY---------GGKVTNELSSANL 887

Query: 906 IIMPNENQRLGTQSLVEMRQSVLQAMGRNDSTPSIPYIVTPDWVEKSIEENCQVPEEDF 964
           +I+      +  + + ++R+ +   + + D  P IP +V+  W+   I++N QV E+++
Sbjct: 888 VIVVGA---VTQRRINDIRKQISSEVIKQDHPPRIPDMVSEGWLYDCIKQNTQVAEDNY 943

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score =  935 bits (2417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/959 (50%), Positives = 639/959 (66%), Gaps = 31/959 (3%)

Query: 18  QESESTEKAPPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGNKPLSVRYYEVISHFIRL 77
           Q  E ++K P NFAPSPDF WLC+ELF KLE++  + R+ LG K ++V+  EVI +FI+L
Sbjct: 27  QPGEVSQKKPQNFAPSPDFRWLCDELFSKLEEIT-EDRQKLG-KAVTVKRVEVIMYFIKL 84

Query: 78  WRKTVGNNIFPALVLSLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEKRLLKWKRRAT 137
           WR TVG+NI+P L L LPYRD R YNIKDYTLVKA+C  L LPK S TEKRLL WK+ A 
Sbjct: 85  WRTTVGDNIYPVLRLILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKRLLNWKQYAP 144

Query: 138 RGVRLSNFCVEEIRKRKSEPSPGRRITIDKLNECLDHLVEERNAKG-GFKGLSDSPTFNF 196
           RG  LS FCVEEI KR+ EP   +R+TID LN+CLD L +E +AK  GF GLS SP+F  
Sbjct: 145 RGTSLSKFCVEEIMKRRKEPQGSQRLTIDALNKCLDELSKEASAKKWGFNGLSKSPSFQN 204

Query: 197 CLQNMSFIELRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDLETVASRLWDPEH 256
           CLQNMSF E R+FFDI+LK RVIGG EHK LNCWHPDA DYL VVSDL+ ++  LW+P  
Sbjct: 205 CLQNMSFSEQRYFFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLKVLSETLWNPTM 264

Query: 257 RLRRDDLSINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKI 316
           RL +++LSIN+G AF P LAK++ +SYE++C KL  DF+IEEKMDGERIQ+HY++ GAKI
Sbjct: 265 RLGKNELSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKI 324

Query: 317 RFLSRRGVDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKS 376
           RFLSRRG D+T LYG++L+ G ++ +L F ++V+DCVLDGEM++FD ++NVVLPFG+VKS
Sbjct: 325 RFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGIVKS 384

Query: 377 SARQAL--STEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEI 434
           +A + L  S   + + G+RP+ M+ DLVYLNGVSL +LPL+ RK +L  +L P  + VEI
Sbjct: 385 TAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANIVEI 444

Query: 435 LPYVRCSEHTAIRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPEYLEQFGENL 494
           L  VR SE  AI+ SLE++I MGSEGI+LK + + YEIGARND WIK+KPEY E+ GE +
Sbjct: 445 LSDVRASEPNAIKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELGETM 504

Query: 495 DLVIIGRTPGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKY 554
           DLV+IGR PGKKDSLMCGL + +          + + + VNL S+ D L        +  
Sbjct: 505 DLVVIGRDPGKKDSLMCGLILAD----------ETDGSSVNLASQDDPLRPKQRNPKV-- 552

Query: 555 FISFCVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLE 614
            ISFC IANG+S  EFKEI+RKTRG W  +    P + LL FG+K+P EWIDP++S++LE
Sbjct: 553 -ISFCNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVLE 611

Query: 615 VKARSLDNTESSKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQ-ERLHKSSTGVGS 673
           VKARS+D  E S KK+  G TL G YCR +R +KDW+ C +  +  Q +R H    G   
Sbjct: 612 VKARSVDTDELSSKKYKTGSTLRGAYCRALRFNKDWSTCATVQQYEQAKRAHNYHKGKRK 671

Query: 674 FNXXXXXXXXXXXXXIDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDYIDVSRNVRITKSE 733
            +              + +   A    +    +NIF+GLQFY+LSDYID S+  R  K +
Sbjct: 672 SHQISPRKQRKLANVSELYPLLADDSRESIFESNIFQGLQFYILSDYID-SQKKRYEKDQ 730

Query: 734 FDDLILQNSGKLVRNLISKHHSESQFRIISGKYTAECRALIERGYDILSPQWILDCIRNR 793
              L+ +NSG ++ N   +    S+ RIISGK T ECR+L E+GYDI+ P WI DC+   
Sbjct: 731 IGTLVRKNSGHVLHNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDCLNYG 790

Query: 794 MVVKLEPRHCFNVSSELMTIVNGRVDEYGDSFVNPITEQQLDNLIDTNMKQTEPNLMREA 853
            +VKLEPRHCF  S +L+     RVD +GDSF  P++  + D L++       P+L   A
Sbjct: 791 SLVKLEPRHCFRTSRKLLENSRQRVDRFGDSFCRPLSYTEFDELVN-GQSVVSPHL--SA 847

Query: 854 NSELDVVPLFLFSTRAVYIPPQVFNAVDAYG-LTSKFKLHGGSIASDIPSCNLIIMP--- 909
             ELD +PLFLF    +Y   +V N  D    L    +L GG  +  +  CNL+++    
Sbjct: 848 PEELDGIPLFLFQNFKIYF-ARVGNDPDQEEYLEKTLRLFGGERSLTLDCCNLVVVRVSF 906

Query: 910 NENQRLGTQSLVE-MRQSVLQAMGRNDSTPSIPYIVTPDWVEKSIEENCQVPEEDFTPV 967
            E ++L    LVE +R+ +      ++    IP++V+ +W+E  I E C VPEEDF P+
Sbjct: 907 KEQKKLF--KLVEGLRKRIASTAYSSEVDHRIPHLVSSNWLEACINEQCLVPEEDFPPL 963

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score =  905 bits (2339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/964 (46%), Positives = 640/964 (66%), Gaps = 17/964 (1%)

Query: 13  VSQELQESESTEKAPPNFAPSPDFIWLCEELFVKLEDVQRQGREH----LGNKPLSVRYY 68
           VS   +ES +T   P NFAPSPDF WLC+ELFVK++ ++ Q +      + NKP+S RY+
Sbjct: 11  VSTTTKESPAT--TPKNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISNKPISTRYF 68

Query: 69  EVISHFIRLWRKTVGNNIFPALVLSLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEKR 128
           + I+HFI+LWR T+G++IFPAL L LPYRDRR+YNIKD TL++AICSYL LPK S  E+R
Sbjct: 69  DTITHFIKLWRTTIGDDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERR 128

Query: 129 LLKWKRRATRGVRLSNFCVEEIRKRKSEPSPGR--RITIDKLNECLDHLVEERNAKGGFK 186
           L++WK +A R   L+ FC+ EI KRK+EP   +  RI+IDKLNE LD LV  R      K
Sbjct: 129 LIRWKYKADRYETLATFCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVNRQNWNNKK 188

Query: 187 --GLSDSPTFNFCLQNMSFIELRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDL 244
              L    TF FCL+NM+FIEL++FFDI++KN+++G  E+  L  WHPD+ +YLSVVSDL
Sbjct: 189 RSNLLQVETFKFCLENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDL 248

Query: 245 ETVASRLWDPEHRLRRDDLSINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGER 304
            T++++LW+P  ++   DLSI +GY F PQLAK++ +SY+ I  +LNNDF IEEKMDGER
Sbjct: 249 RTLSNKLWNPSIKINNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGER 308

Query: 305 IQVHYMDYGAKIRFLSRRGVDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTD 364
           IQ+HYM+YG  ++F SR G DYT LYG +  +GT+A +L    NV++CVLDGEM+TFD+ 
Sbjct: 309 IQLHYMNYGETVKFFSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDST 368

Query: 365 RNVVLPFGMVKSSARQALSTEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRV 424
              VLPFG+VKSSA   L+ + I +    P+ MV D++YLNG SLI LPL++RKEFLN V
Sbjct: 369 SKKVLPFGLVKSSASSQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTV 428

Query: 425 LKPCPHAVEILPYVRCSEHTAIRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKP 484
           L P    VEIL  +RC++   I+K L+ +IS+GSEGIVLK Y ++Y   AR++ WIKVKP
Sbjct: 429 LTPYKDYVEILSSIRCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVKP 488

Query: 485 EYLEQFGENLDLVIIGRTPGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELD 544
           EYLE+FGEN+DL++IGR  GKKD L+CG+ V E +++L+E   KRES I  +   GD+  
Sbjct: 489 EYLEEFGENMDLIVIGRDSGKKDCLICGILVTEEKQELSE-NMKRESEIEIISDSGDDDL 547

Query: 545 DTDGKKIIKYFISFCVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEW 604
           DT   + IK  ISFC IANG+SQ E KEI+R TRGAW   +   P  D+L FG+K P EW
Sbjct: 548 DTKPSQGIKKVISFCTIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKPVEW 607

Query: 605 IDPKNSIMLEVKARSLDNTESSKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQERL 664
           I P++S++LE+KARSLD T+ ++ K+A GCTL+GGYCR+IR DKDWT CY+  +L    +
Sbjct: 608 IYPQDSVVLEIKARSLDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHDLTYNEI 667

Query: 665 HKSSTGVGSFNXXXXXXXXXXXXXIDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDYIDVS 724
            +      +               I P +G      D+   +++F GL FY++SDYI  S
Sbjct: 668 KRHEKKNKNKQTLIRSYSRKKSKIISP-AGMLPNGTDLRLISDLFHGLYFYIISDYIPDS 726

Query: 725 RNVRITKSEFDDLILQNSGKLVRNLISKHHSESQFRIISGKYTAECRALIERGYDILSPQ 784
              RI + +   LI++N G+++ N+I+K ++ S+ RI+S K T EC  L+ RGYD+++  
Sbjct: 727 DAQRIDREDICSLIIKNGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGYDVINLS 786

Query: 785 WILDCIRNRMVVKLEPRHCFNVSSELMTIVNGRVDEYGDSFVNPITEQQLDNLIDTNMKQ 844
           W+ DC++  +++ LEP HC  VS+EL+ I   R+D++GDS+   + + +L  L+D+N+ +
Sbjct: 787 WLFDCLQAGVILPLEPAHCLFVSNELLAIATDRIDKFGDSYEATLIDSKLLKLLDSNINK 846

Query: 845 TEPN----LMREANSELDVVPLFLFSTRAVYIPPQVFNAVDAYGLTSKFKLHGGSIASDI 900
              +    L+   +  +D +P+FLF+ R  ++  +     D   L  + KL+GGS+ + +
Sbjct: 847 VNRSNSNLLLINKDEGVDSIPIFLFTNRKFFLIKEDILLGDRDTLIFQIKLYGGSLVTKL 906

Query: 901 PSCNLIIMPNENQRLGTQSLVEMRQSVLQAMGRNDSTPSIPYIVTPDWVEKSIEENCQVP 960
             CN+I+    +Q L  + L ++R  +++     +    IP  V   W+ +SI+   Q+ 
Sbjct: 907 EDCNIIVGVCGSQ-LVNKKLGDLRCKLVKQYVDANFPQPIPRAVNVSWITESIKAGYQLS 965

Query: 961 EEDF 964
            ED+
Sbjct: 966 PEDY 969

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score =  903 bits (2333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/964 (47%), Positives = 639/964 (66%), Gaps = 23/964 (2%)

Query: 21  ESTEKAPPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGNKPLSVRYYEVISHFIRLWRK 80
           +++E+ P NF+PSPDF WLC ELFVKL++V+ + +  +  +P +++Y  VI++FI LWR 
Sbjct: 10  DTSEREPRNFSPSPDFKWLCNELFVKLDEVRLKPKS-VDTRPKNIQYDIVINNFIHLWRV 68

Query: 81  TVGNNIFPALVLSLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEKRLLKWKRRATRGV 140
           TVGN+I+PAL L LPYRDRR Y I+++TL++ +C YL L K S TE+RL +WK++A R +
Sbjct: 69  TVGNDIYPALRLILPYRDRRNYYIREHTLIRIVCDYLKLQKNSVTEQRLRRWKQKARRSI 128

Query: 141 RLSNFCVEEIRKRKSEPSPGRRITIDKLNECLDHLVEER------NAKGGFKGLSDSPTF 194
            LS+FC++EI+KR SEP    +ITIDKLN  LD L  ER      N   G K LS   + 
Sbjct: 129 NLSSFCIQEIKKRLSEPVSKEKITIDKLNSILDSLSMERSSSKITNGSSG-KKLSQLESI 187

Query: 195 NFCLQNMSFIELRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDLETVASRLWDP 254
            +C +NMSFIEL +FFDI++K R+IGG EHK LN WHPDA DYLSVVS+L  V  +LW+P
Sbjct: 188 KYCFENMSFIELEYFFDILIKARLIGGLEHKFLNAWHPDANDYLSVVSELNIVTEKLWNP 247

Query: 255 EHRLRRDDLSINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGA 314
             RL   DL+I L  AF PQLAKK+ +SYE +  ++NN F IEEKMDGERIQ+HYMDYG 
Sbjct: 248 NFRLNSKDLTIALHNAFEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDYGH 307

Query: 315 KIRFLSRRGVDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMV 374
           +I++ SRRG DYT LYG++  + T++ YL  + +V++C+LDGEM+++D  RN +LPFGMV
Sbjct: 308 QIKYFSRRGNDYTYLYGKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCILPFGMV 367

Query: 375 KSSARQALSTEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEI 434
           KS A  +L  +G+ +    P+ +V D+++LNG  L  LPLYQRKE+L+ +L P    +EI
Sbjct: 368 KSGAANSLKIDGLENDLCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHIEI 427

Query: 435 LPYVRCSEHTAIRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPEYLEQFGENL 494
           L +    +  +IR +L+ +IS+GSEGIVLK Y + Y +G RN+ WIKVKPEYLEQFGENL
Sbjct: 428 LKFSIAHDSESIRSALQAAISVGSEGIVLKKYDSLYSVGDRNNDWIKVKPEYLEQFGENL 487

Query: 495 DLVIIGRTPGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDEL------DDTDG 548
           DL++IGR PGKKDSLMCG+AV E EE   +I    +  ++ L S+ D+       D    
Sbjct: 488 DLIVIGRDPGKKDSLMCGVAVLENEESYEKI---LQEEVITLTSDDDDSQNNIPEDKPIR 544

Query: 549 KKIIKYFISFCVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPK 608
            K I  FISFCVIANGIS +EFKEIDRKT G W K     P  D L FG+++P EWI+P 
Sbjct: 545 TKRITKFISFCVIANGISNEEFKEIDRKTFGCWKKFSDEAPPTDYLEFGTRLPVEWINPH 604

Query: 609 NSIMLEVKARSLDNTESSKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQERLHKSS 668
           +S++LEVKARSL+N E+ + KF  G TL+G YCRRIR DKD+  CY+FS+L      K S
Sbjct: 605 DSVVLEVKARSLENNEALRDKFKTGYTLYGAYCRRIRTDKDFNDCYTFSDLVIATNKKRS 664

Query: 669 TGVGSFNXXXXXXXXXXXXXIDPFSGQ-AAKKHDVFDSTNIFKGLQFYVLSDYIDVSRNV 727
           +     N             ++  +   + +  D   ++ IF GL F+V+SDY+D + + 
Sbjct: 665 SSELYGNHSHIKKKRSRTSKVNMLNQTLSIQDDDTGFTSKIFDGLSFFVISDYVDSNSSF 724

Query: 728 RITKSEFDDLILQNSGKLVRNLISKHHSESQFRIISGKYTAECRALIERGYDILSPQWIL 787
           R+   E  ++I  N G+L+ NL+S++ +E   RI+S K T EC  LI+RGYDI+ P+WIL
Sbjct: 725 RLRIDELINIIKVNGGQLIFNLVSQNLNEKYVRIMSCKKTFECNELIKRGYDIIHPKWIL 784

Query: 788 DCIRNRMVVKLEPRHCFNVSSELMTIVNGRVDEYGDSFVNPITEQQLDNLID--TNMKQT 845
           DCI N  ++  EP HCFNVS  L TI   RVD  GDS+   ITE++L+ LI   T  +Q 
Sbjct: 785 DCIANDKLLDFEPSHCFNVSQSLSTISKQRVDLLGDSYQKYITEEELELLISSKTPKEQL 844

Query: 846 EPNLMREANSELDVVPLFLFSTRAVYIPPQVFNAVDAYGLTSKFKLHGGSIASDIPSCNL 905
             N + + + +++ +P+FLFS +  Y P Q F+           KL+GG+  ++I  CN+
Sbjct: 845 YSNPL-QFDQQIEKIPIFLFSNKKAYTPKQCFSEKLLKETNLYIKLYGGTSVNNINDCNV 903

Query: 906 IIMPNENQRLGTQSLVEMRQSV-LQAMGRNDSTPSIPYIVTPDWVEKSIEENCQVPEEDF 964
           II+ +E+ +   + +  +R+ + + A+  N+  P IP IV+  W+EKSI +  QV EEDF
Sbjct: 904 IIIGDEHSKSSNEKISSIRKELSIHAVSSNNVIP-IPRIVSYKWIEKSIAQGTQVVEEDF 962

Query: 965 TPVY 968
             ++
Sbjct: 963 PIIF 966

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score =  895 bits (2312), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/969 (47%), Positives = 629/969 (64%), Gaps = 44/969 (4%)

Query: 16  ELQESESTEKAPPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGNKPLSVRYYEVISHFI 75
           E   S+ +E  P NFAPSPDF WLCEELF +L+ +    R+ LG K ++V+  E+I+ FI
Sbjct: 10  ETDTSKISENEPHNFAPSPDFRWLCEELFHRLDAINEH-RQELG-KAVTVKRVEIITCFI 67

Query: 76  RLWRKTVGNNIFPALVLSLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEKRLLKWKRR 135
           +LWR TVG++ FPAL L  PYRD R Y+IKD+TL+KA+C  L L + S TE+RLL WK+ 
Sbjct: 68  KLWRTTVGDDFFPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERRLLNWKQY 127

Query: 136 ATRGVRLSNFCVEEIRKRKSEPSPGRRITIDKLNECLDHLVEERNAKG--GFKGLSDSPT 193
           A RG  LS FCV+EI KR+ EP P R++TID LNE LD L +E + K   G  GLS+S +
Sbjct: 128 AGRGTSLSKFCVQEISKRRKEPLPERQLTIDGLNEKLDELAKEASGKKAWGTTGLSESHS 187

Query: 194 FNFCLQNMSFIELRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDLETVASRLWD 253
           F FCL+N+SF+ELR+FFDIVLKNRVIGG EHK L CWHPDA  YL VV+DL+ ++ +LW+
Sbjct: 188 FQFCLKNLSFLELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKILSKKLWN 247

Query: 254 PEHRLRRDDLSINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYG 313
           P  RL + DLSIN+G+AF P LAK++ +SYE+IC+KL +DF++EEKMDGERIQ+HY++ G
Sbjct: 248 PSVRLDKRDLSINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGG 307

Query: 314 AKIRFLSRRGVDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGM 373
           + ++FLSRRG+D++ LYG+ +  G ++ YL   S+VRDCVLDGEM+++D  R ++LPFG+
Sbjct: 308 SVLKFLSRRGIDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGI 367

Query: 374 VKSSARQAL--STEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHA 431
           VKS+A   L  S  G  + G+RP+ MV DLVYLNGVSL K+PL+ RKE+L  +L P P  
Sbjct: 368 VKSAAVDELINSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDV 427

Query: 432 VEILPYVRCSEHTAIRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPEYLEQFG 491
           VEIL  +R  +  AI+  ++++I MGSEG+++K   + YE+GARND+W+K+KPEY E  G
Sbjct: 428 VEILKGIRACDAKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKPEYFEDLG 487

Query: 492 ENLDLVIIGRTPGKKDSLMCGLAVYEGE---EDLNEIEAKRESAIVNLDSEGDELDDTDG 548
           E +DLV+IGR PGKKDSLMCGL V + E   E+   IE  +E                 G
Sbjct: 488 ETMDLVVIGRDPGKKDSLMCGLLVSDSEHILENFGPIEHGKE-----------------G 530

Query: 549 KKIIKYFISFCVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPK 608
             IIK  +SFC +ANG+S +EFKEI+RKTRG+WV   ++ P   LL FGSKIP EWIDPK
Sbjct: 531 DPIIK-CVSFCNVANGVSDEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPK 589

Query: 609 NSIMLEVKARSLDNTESSKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQER-LHKS 667
           NS+++EVKARS++N+E S K++ AG TLH  YCRRIR+DKDWT C S ++  Q +  H  
Sbjct: 590 NSVVIEVKARSVENSEYSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQYQQAKAAHNY 649

Query: 668 STGVGSFNXXXXXXXXXXXXXIDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDYIDVSRNV 727
                  +              +  +G+A  + D  + ++IF+GL FY+LSDY+   R  
Sbjct: 650 HRYKRKVHQVSPRRKRNVHEIFEYCAGEAKSELDT-EGSSIFEGLHFYILSDYVTSQRR- 707

Query: 728 RITKSEFDDLILQNSGKLVRNLISKHHSESQFRIISGKYTAECRALIERGYDILSPQWIL 787
           R  +      ++++ G +V+N+  +    S  RI+SGK T ECR L+ RGYDI+ P WI 
Sbjct: 708 RYERGMVAAKVVKHGGLIVKNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIF 767

Query: 788 DCIRNRMVVKLEPRHCFNVSSELMTIVNGRVDEYGDSFVNPI--TE-QQLDNLIDTNMKQ 844
           DCI     + +EP+HCF  S  L+     RVD+YGDSF  P+  TE QQL     ++   
Sbjct: 768 DCISAGFQLGIEPKHCFQTSRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLFKFFCSSPSD 827

Query: 845 TEPNLMREANSELDVVPLFLFSTRAVYI-----PPQVFNAVDAYGLTSKFKLHGGSIASD 899
               +      +LD  PLFL     +Y+      PQ F+      L  K +L+GG ++  
Sbjct: 828 FSSRISSMLQDDLDEAPLFLLQRFKIYVLAADLIPQQFSI-----LRRKIELYGGVVSET 882

Query: 900 IPSCNLIIMPNENQRLGTQSLV-EMRQSVLQAMGRNDSTPSIPYIVTPDWVEKSIEENCQ 958
           +   NL+++P+      T   V E+RQ +       ++   IP+IV  +W++    E C 
Sbjct: 883 LEGANLVLVPSALSTARTAYYVQELRQKIAGNAFAGNTNTRIPHIVRSEWLDTCTTEQCL 942

Query: 959 VPEEDFTPV 967
           VPEEDF+ +
Sbjct: 943 VPEEDFSSI 951

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/974 (42%), Positives = 594/974 (60%), Gaps = 45/974 (4%)

Query: 8   TSTHEVSQELQESESTEKAPPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGNKPLSVRY 67
           T  HE++ +       + +P NF+PSPDF WLC+ELF+KLE+V  + ++ LG KP  VR 
Sbjct: 39  TGEHEINAQ-------DGSPINFSPSPDFCWLCDELFIKLEEVALKKKD-LG-KPRKVRN 89

Query: 68  YEVISHFIRLWRKTVGNNIFPALVLSLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEK 127
            E+ S+F+ LWRKTVGN+I+PALVLSLPY DRR Y +KD TLVKA+C ++ LP+ S TE+
Sbjct: 90  LEITSNFVSLWRKTVGNDIYPALVLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETER 149

Query: 128 RLLKWKRRATRGVRLSNFCVEEIRKRKSEPSPGRRITIDKLNECLDHLVEERN-AKGGFK 186
           RLL WK+ A RGV+LS FCVEE++KR+ EP   +R++ID++N  LD L  E N  K  + 
Sbjct: 150 RLLHWKQNAPRGVKLSTFCVEELQKRRREPVVPKRMSIDEVNGMLDKLEHESNVGKWSYI 209

Query: 187 GLSDSPTFNFCLQNMSFIELRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDLET 246
            L++SP FN+CL++MS++ELRFFFDIVLK  ++ G E  LL+CWHPDA  Y  VVSDL  
Sbjct: 210 SLAESPAFNYCLEHMSYVELRFFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRI 269

Query: 247 VASRLWDPEHRLRRDDLSINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQ 306
           VA  L+DP  RL ++DLS+ +GYAF P +A+++ I YEK+ TKL NDF +EEKMDG+RIQ
Sbjct: 270 VAHTLYDPNERLEKNDLSVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQ 329

Query: 307 VHYMDYGAKIRFLSRRGVDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRN 366
           VHYMDYG  I + SR G++YT LYGEN   G+++N+L F   V++C+LDGEM+++D +  
Sbjct: 330 VHYMDYGNSIAYFSRNGINYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQ 389

Query: 367 VVLPFGMVKSSARQALS--TEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRV 424
            +LPFG+ KS A   ++  T G     +RP+  V DL+YLNG  L    + +RKE+L ++
Sbjct: 390 CILPFGLTKSGASHQVNFETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKI 449

Query: 425 LKPCPHAVEILPYVRCSEHTAIRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKP 484
           L P  + V +L   RCS+  AI  +L  +++ GSEGIVLK  +++Y +G R+D WIK+KP
Sbjct: 450 LIPSKNVVHLLSGPRCSDAEAITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKP 509

Query: 485 EYLEQFGENLDLVIIGRTPGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELD 544
           EYLE FGEN+DLV+IGR  G+KDS +C LAV +  E  N    +  S   +      + +
Sbjct: 510 EYLENFGENMDLVVIGRDKGRKDSFICALAVTDDSEKNNPSSYESGSDSDS------DSE 563

Query: 545 DTDGKKIIKYFISFCVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEW 604
               +  I+ FISFC IANGIS +EFKEIDR TRG W   D+R P  D + FG+K P EW
Sbjct: 564 PIIVQPKIEKFISFCSIANGISNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREW 623

Query: 605 IDPKNSIMLEVKARSLDNTESSKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQERL 664
           IDPKNS++LEVKARS+DN ES    +  G TL+  YC+RIR DK+W+   + +E    R 
Sbjct: 624 IDPKNSVVLEVKARSIDNEESKSDLYKTGSTLYNAYCKRIRHDKNWSTASTVAEYDTARE 683

Query: 665 HKSSTGVGSFNXXXXXXXXXXXXXIDPFSGQAAKKHDVFDST--NIFKGLQFYVLSDYID 722
            +S   V                      G      DV   +  +  KG  FYV S Y D
Sbjct: 684 ARSYFNVSQNAKFGKDRSSPRKRRTFHLVGDI----DVTKPSKADFLKGYYFYVTSGYFD 739

Query: 723 VSRNVRITKSEFDDLILQNSGKLVRNLISKHHSESQFRIISGKYTAECRALIERGYDILS 782
           +     I  SE  + ++   G  + NL  +  S  +  I+  K T E + LIERGYDI+ 
Sbjct: 740 LQSKKNIDASEIGEAVVSCGGTYIHNLRIR-ASLDKLYILGCKDTRELKMLIERGYDIIH 798

Query: 783 PQWILDCIRNRMVVKLEPRHCFNVSSELMTIVNGRVDEYGDSFVNPITEQQLDNLIDTNM 842
           P+W++DC++   ++++EP++ ++ S ELM     + D+YG+S+  P+TE  L  L +   
Sbjct: 799 PEWLMDCVKYGTMLQIEPKYVYSASEELMKQARNQEDKYGESYQLPVTEDTLKALAN--- 855

Query: 843 KQTEPNLMREANSELDVVPLFLFSTRAVYIPPQVFNAVDAYGLTS------KFKLH--GG 894
           KQ E     E  +  D V  +    R +     +F  +D Y   S      K+ +   GG
Sbjct: 856 KQVEEGYASEMGT--DAVSEY---ERLLIFKGWLFYILDDYAYHSSWSDIVKWNIESCGG 910

Query: 895 SIASDIPSCNLIIMPNENQRLGTQSLVEMRQSV-LQAMGRNDSTPSIPYIVTPDWVEKSI 953
            + +D+    +++   +       SL  +R ++  +  G ND  P IP IVT +WVE  +
Sbjct: 911 EVTNDLELATIVVAVKDC--FSQLSLQAVRNNIGARITGSNDVQP-IPKIVTSEWVEACM 967

Query: 954 EENCQVPEEDFTPV 967
           E    V E+++  +
Sbjct: 968 EAQYLVDEDEYAAI 981

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score =  772 bits (1993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/941 (43%), Positives = 586/941 (62%), Gaps = 63/941 (6%)

Query: 29  NFAPSPDFIWLCEELFVKLEDVQRQGREHLGNKPLSVRYYEVISHFIRLWRKTVGNNIFP 88
           NF+PSP+F WLC+EL  K+   +   ++HL  KP++VRY E+I++FI+LWR TVGN I+P
Sbjct: 6   NFSPSPEFKWLCDELLGKI--YETSSKKHLIGKPVTVRYLEIITNFIKLWRSTVGNYIYP 63

Query: 89  ALVLSLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEKRLLKWKRRATRGVRLSNFCVE 148
           AL L +P+RDRRIYN+K+ TL+KA+C YL LPK S TE RLL+WK+RA RGV+LS+FCVE
Sbjct: 64  ALRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLSDFCVE 123

Query: 149 EIRKRKSEPSPGRRITIDKLNECLDHLVEERNAKG-GFKGLSDSPTFNFCLQNMSFIELR 207
           EIRKR+ +     RITID+LN  LD + +E N K  G+  L+DS  FN+CL +M+F+E++
Sbjct: 124 EIRKRQKDYEGANRITIDELNGYLDEVSQEGNGKRMGYMALTDSRAFNYCLNHMTFMEMK 183

Query: 208 FFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDLETVASRLWDPEHRLRRDDLSINL 267
           FFFDI+LK RV+ G E+  L  WHPDA DYLSVVSDL+ ++ RL++P  RLR+ DLSI +
Sbjct: 184 FFFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQTDLSITI 243

Query: 268 GYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVDYT 327
            +AF PQLAK+  +SYE++ +KL +DF+IEEKMDGER+Q+HY++YG +I++LSRRGVD++
Sbjct: 244 SHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFS 303

Query: 328 QLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTE-- 385
            LYGEN  SG ++  L    NV+DC+LDGEMIT+DT++++VLPFG+VKSSA   + +E  
Sbjct: 304 YLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSELA 363

Query: 386 GIC-SQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHT 444
           GI  ++ ++P+ +  DLVYLNG SL  L L +RK++L ++L P   +VEI+ Y++     
Sbjct: 364 GIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAE 423

Query: 445 AIRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGRTPG 504
           AI+ SLE++ISMGSEGIVLK   ++Y +G+RN  WIK+KPEYLEQFGEN+DL+IIGR  G
Sbjct: 424 AIKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGREQG 483

Query: 505 KKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIANG 564
           KKDS  CGL++     D NE+  K                          FISFC IANG
Sbjct: 484 KKDSFFCGLSI----SDPNEVAEKPR------------------------FISFCTIANG 515

Query: 565 ISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDNTE 624
           +S +EFK+I+RKT G W    +  PS +LL FG+K+P EWI P++S++LEVKAR++D  E
Sbjct: 516 LSNEEFKDIERKTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTKE 575

Query: 625 SSKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQERLHKSSTGVGSFNXXXXXXXXX 684
           S K+K+ +GCTLH GYC++IR DKDW    SFSE    +  ++       +         
Sbjct: 576 SEKRKYRSGCTLHFGYCKQIRYDKDWKTVASFSEFEDMKDARNFYNKRKSHQVTDGKKRA 635

Query: 685 XXXXIDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDYIDVSRNVRITKSEFDDLILQNSGK 744
                      +     V   +N F   +F V+SDY D ++  RI++ +   +IL++ G+
Sbjct: 636 SKRAKIGIVNSSEPTALVAPVSNTFSNCRFRVISDYFDSTKRRRISQEDLCSVILEHGGE 695

Query: 745 LVRNLISKHHSESQFRIISGKYTAECRALIERGYDILSPQWILDCIRNRMVVKLEPRHCF 804
           +V      +  +    II  K T EC+ L+     I+ P WI  CI             F
Sbjct: 696 IVYTSDENNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSCIEEGYKTPFTESDIF 755

Query: 805 NVSSELMTIVNGRVDEYGD--SFVNPITEQQLDNLIDT---NMKQTEPNLMREANSELDV 859
                      G ++   D   F        L++L++T    +K  + +L+      L  
Sbjct: 756 ----------RGELESSMDCSQFYTDFNTASLNHLLETANRGIKNPDSDLL------LPE 799

Query: 860 VPLFLFSTRAVYIPPQVFNAVDAYGLTSKF--KLHGGSIASDIPSCNLIIMPNENQRLGT 917
           VPLFLFS   + +     N +D   L  +F  K HGG +   I + ++II+ N+   +  
Sbjct: 800 VPLFLFSNLKLAVLNSE-NVLDTSILEVEFAIKCHGGELVH-IENASIIIVFND--FISR 855

Query: 918 QSLVEMRQSVLQAMGR--NDSTPSIPYIVTPDWVEKSIEEN 956
           + L  +RQ +     +   +STP IP +V   W   SI++N
Sbjct: 856 EDLFSLRQKIASKAVKESTESTPRIPRMVDISWALDSIKDN 896

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score =  120 bits (300), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 106/411 (25%), Positives = 178/411 (43%), Gaps = 55/411 (13%)

Query: 268 GYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVDYT 327
           G    P LAK      E +       F  E K DGER QVH M+ G  IR  SR   + T
Sbjct: 330 GIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDGT-IRIYSRNSENMT 388

Query: 328 QLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTEGI 387
           + Y E         +L      R  ++D E + +D ++  +LPF ++ +  R+ +  + +
Sbjct: 389 ERYPEI----QFHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDV 444

Query: 388 CSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTAIR 447
                R  L   DL+YLNG SL+K  L  R++ L  VLK  P  ++    +   E + ++
Sbjct: 445 ---KVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSELQ 501

Query: 448 KSLEKSISMGSEGIVLK---SYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGR--T 502
             LE+S+S   EG+++K     +++YE   R+  W+K+K +YLE  G++LDL ++G    
Sbjct: 502 TYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLGAYYG 561

Query: 503 PGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIA 562
            GK+     G  +     DL E E                              + C I 
Sbjct: 562 RGKRTGTYGGFLLGCYNPDLEEFE------------------------------TCCKIG 591

Query: 563 NGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDN 622
            G S++  + +  + +   + +    P  D+    S  P+ W +P  +++ EV    L  
Sbjct: 592 TGFSEEVLQSLHAQLKDTVIAA----PRGDVSYDDSSPPDVWFEP--AMLFEVLTADLSL 645

Query: 623 T---ESSKKKFAAGCTLHGGYCRRIRDDK---DWTGCYSFSELWQERLHKS 667
           +   ++ +  +  G +L      RIR+DK   D T      E +Q + + S
Sbjct: 646 SPVYKAGRDVYGKGISLRFPRFLRIREDKSVTDATSSDQIVEFYQRQANSS 696

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score =  117 bits (292), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 113/422 (26%), Positives = 185/422 (43%), Gaps = 65/422 (15%)

Query: 263 LSINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRR 322
           + +  G    P LAK      E + T  N  F  E K DGER QVH +  G+ +R  SR 
Sbjct: 348 IKLTPGIPLKPMLAKPTKSISEVLDTFQNIQFTSEYKYDGERAQVHLLPDGS-MRIYSRN 406

Query: 323 GVDYTQLYGE-NLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQA 381
           G D TQ Y E N+Q     +YL   +     +LD E + +D +   +LPF ++ +  R++
Sbjct: 407 GEDMTQRYPELNIQ-----DYLVDSTTTTQLILDCEAVAWDVELQKILPFQVLSTRKRKS 461

Query: 382 LSTEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCS 441
           +  + I     R  L   D++  N  SLI   L +R++ L+ + KPCP   +    +  S
Sbjct: 462 VDLKDI---KVRVCLFAFDILRHNNDSLINNTLRERRDILHSITKPCPGQFQFATELTTS 518

Query: 442 EHTAIRKSLEKSISMGSEGIVLKSY---KARYEIGARNDYWIKVKPEYLEQFGENLDLVI 498
               ++  L+K+I    EG+++KS     + YE   R+  W+K+K +YL+  G++LDL +
Sbjct: 519 NLDELQTFLDKAIKDSCEGLMVKSLDGTDSHYEPSKRSRNWLKLKKDYLQGMGDSLDLCV 578

Query: 499 IGR--TPGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFI 556
           +G     GK+     G  +                A  N D+E               F 
Sbjct: 579 LGAYYGRGKRTGTYGGFLL----------------ACYNQDTEE--------------FE 608

Query: 557 SFCVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVK 616
           + C I  G S +  + +    +   ++S    P A+ +   S  P+ W +P  +++ EV 
Sbjct: 609 TCCKIGTGFSDEMLQTLYNGLKETAIES----PRANFVFDSSAEPDVWFNP--TMVFEVL 662

Query: 617 ARSLDNTESSKKKFAAGCTLHGG-----YCR--RIRDDK---DWTGCYSFSELWQERLHK 666
              L    S    + AG T++G      + R  RIR DK   D T      + ++ + H 
Sbjct: 663 TADL----SLSPIYKAGSTVYGKGISLRFPRFIRIRTDKSVNDATSSEQVIDFYENQSHL 718

Query: 667 SS 668
            S
Sbjct: 719 QS 720

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score =  115 bits (288), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 105/409 (25%), Positives = 176/409 (43%), Gaps = 55/409 (13%)

Query: 268 GYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVDYT 327
           G    P LAK      E +       F  E K DGER QVH +  G+ +   SR G + T
Sbjct: 326 GIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQVHLLPDGS-MNIYSRNGENMT 384

Query: 328 QLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTEGI 387
           + Y E      + +YL         +LD E + +DT++  +LPF ++ +  R+ +  + +
Sbjct: 385 ERYPEL----HIRDYLADPETTHSLILDCEAVAWDTEQGKILPFQILSTRKRKGVEAKDV 440

Query: 388 CSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTAIR 447
                R  L   D++  NG SLI   L +R+E+L RVLKP     +    +  S    ++
Sbjct: 441 ---KVRVCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQFANELNSSNLEDVQ 497

Query: 448 KSLEKSISMGSEGI---VLKSYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGR--T 502
           K LE+S+    EG+   VL+  ++ YE   R+  W+K+K +YL+  G++LDL ++G    
Sbjct: 498 KYLEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYG 557

Query: 503 PGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIA 562
            GK+     G  +    +D  E E                              + C I 
Sbjct: 558 RGKRTGTYGGFLLGCYNQDTGEFE------------------------------TCCKIG 587

Query: 563 NGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDN 622
            G S +    +  K + + ++     P A  +   S  P+ W +P  +++ EV    L  
Sbjct: 588 TGFSDEMLVSLYEKLKPSSLEQ----PKAFYVYDSSAEPDVWFEP--TMLFEVLTADLSL 641

Query: 623 T---ESSKKKFAAGCTLHGGYCRRIRDDK---DWTGCYSFSELWQERLH 665
           +   ++    +  G +L      RIRDDK   D T      EL++ +++
Sbjct: 642 SPIYKAGNSAYGKGISLRFPRFIRIRDDKDVEDATSSEQIVELYESQVN 690

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score =  114 bits (286), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 105/418 (25%), Positives = 182/418 (43%), Gaps = 59/418 (14%)

Query: 264 SINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRG 323
           S+  G    P LAK      E +       F  E K DGER QVH ++ G  +R  SR G
Sbjct: 394 SLRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGT-MRIYSRNG 452

Query: 324 VDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALS 383
            + T+ Y E      + +++   +  +  +LD E + +D ++  +LPF ++ +  R+ + 
Sbjct: 453 ENMTERYPEI----HIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVL 508

Query: 384 TEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEH 443
            + +     R  L   D++  N   LI   L +R+E L+RV  P P   +    +  S  
Sbjct: 509 AKDV---KVRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNL 565

Query: 444 TAIRKSLEKSISMGSEGIVLK---SYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIG 500
             ++K L++S++   EG+++K     ++ YE   R+  W+K+K +YLE  G++LDL ++G
Sbjct: 566 DELQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLG 625

Query: 501 R--TPGKKDSLMCG--LAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFI 556
                GK+     G  L  Y                           +D  G+     F 
Sbjct: 626 AYYGRGKRTGTYGGFLLGCY---------------------------NDNTGE-----FE 653

Query: 557 SFCVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVK 616
           + C I  G S +  +++  K +   +      P A  +   S  P+ W +P  S++ EV 
Sbjct: 654 TCCKIGTGFSDEMLQQLHEKLKATVIDG----PKATYIYDSSAEPDVWFEP--SLLFEVL 707

Query: 617 ARSLDNT---ESSKKKFAAGCTLHGGYCRRIRDDK---DWTGCYSFSELWQERLHKSS 668
              L  +   ++    +  G +L      RIR+DK   D T      EL++ + H+SS
Sbjct: 708 TADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSEQIIELYENQSHRSS 765

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score =  113 bits (283), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 103/409 (25%), Positives = 173/409 (42%), Gaps = 55/409 (13%)

Query: 268 GYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVDYT 327
           G    P LAK      E +       F  E K DGER QVH +  G+ +R  SR G + T
Sbjct: 349 GIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGS-MRIYSRNGENMT 407

Query: 328 QLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTEGI 387
           + Y E      +++++         +LD E + +D D+NV+LPF ++ +  R+ +  E +
Sbjct: 408 ERYPEI----NISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDV 463

Query: 388 CSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTAIR 447
                R  L   D++  N   LI   L +R+ +L R+LKP P  +++   V       ++
Sbjct: 464 ---KVRVCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQ 520

Query: 448 KSLEKSISMGSEGI---VLKSYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGR--T 502
             L++S+    EG+   VL   ++ YE   R+  W+K+K +YL+  G++LDL ++G    
Sbjct: 521 LYLDQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYG 580

Query: 503 PGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIA 562
            GK+     G  +    +D  E E                              + C I 
Sbjct: 581 RGKRTGTYGGFLLGCYNQDTGEFE------------------------------TCCKIG 610

Query: 563 NGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDN 622
            G S +  + +  K     +      P A  +   S  P+ W++P  S++ EV    L  
Sbjct: 611 TGFSDEMLQNLYEKLSPTEIPE----PKAFYVYSESAQPDVWLEP--SMLFEVLTADLSL 664

Query: 623 T---ESSKKKFAAGCTLHGGYCRRIRDDK---DWTGCYSFSELWQERLH 665
           +   ++    +  G +L      RIRDDK   D T      E ++ + H
Sbjct: 665 SPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQSH 713

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score =  110 bits (276), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 106/413 (25%), Positives = 181/413 (43%), Gaps = 53/413 (12%)

Query: 268 GYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVDYT 327
           G    P LAK      E +      +F  E K DGER QVH +  G ++R  SR G + T
Sbjct: 355 GIPLKPMLAKPTKAINEVLDAFQGEEFTCEYKYDGERGQVHLLSNG-EMRIYSRNGENMT 413

Query: 328 QLYGE-NLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTEG 386
           + Y E +++   V +  N D  V   +LD E++ +D ++N +LPF ++ +  R+ +  + 
Sbjct: 414 ERYPELHIEDFLVKDESNTDKEV-SLILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKD 472

Query: 387 ICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTAI 446
           +     R  L   D++Y NG  LI   L +R++ L+ V K  P   +    +  +E   I
Sbjct: 473 V---KVRVCLFAFDILYYNGEGLITKTLRERRKILHEVTKCVPGEFQYATSLITAELDEI 529

Query: 447 RKSLEKSISMGSEGIVLK---SYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGR-- 501
           +K L+++I    EG+++K     ++RYE   R+  W+K+K +YL   G++LDL ++G   
Sbjct: 530 QKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVMGAYY 589

Query: 502 TPGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVI 561
             GK+     G  +    +D  E E                              + C I
Sbjct: 590 GKGKRTGTYGGFLLGCYNQDSGEYE------------------------------TCCKI 619

Query: 562 ANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLD 621
             G S +   ++    R   ++  +   + D     S  P+ W +PK  ++ EV    L 
Sbjct: 620 GTGFSDEMLTKLYELFREEEIEVPKSFYNFD----SSAEPDIWFEPK--VLFEVLTADLS 673

Query: 622 NT---ESSKKKFAAGCTLHGGYCRRIRDDK---DWTGCYSFSELWQERLHKSS 668
            +   ++    +  G +L      RIRDDK   D T      E+++ + H  S
Sbjct: 674 LSPIYKAGSATYDKGISLRFPRFLRIRDDKSVEDATSSDQIIEMYENQSHIQS 726

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score =  110 bits (275), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 105/413 (25%), Positives = 178/413 (43%), Gaps = 55/413 (13%)

Query: 264 SINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRG 323
           +I  G    P LAK      E +       F  E K DGER QVH +  G  +R  SR G
Sbjct: 353 TIQPGIPLKPMLAKPTKAINEVLDRFQGQTFTSEYKYDGERAQVHLLKDGT-MRIYSRNG 411

Query: 324 VDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALS 383
            + T+ Y E +Q   + ++L   ++    +LD E + +D ++N +LPF ++ +  R+ ++
Sbjct: 412 ENMTERYPE-IQ---IKDFLADPASTTSLILDCEAVAWDKEQNKILPFQVLTTRKRKDVN 467

Query: 384 TEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEH 443
              +     R  L   D++  N + LI  PL +R+E L+ V KP     +    +  S  
Sbjct: 468 INEV---KVRVCLFAFDILLHNDMRLINEPLSKRREVLHEVTKPVEGEFQYATQMTTSNL 524

Query: 444 TAIRKSLEKSISMGSEGIVLK---SYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIG 500
             ++K L++S+    EG+++K     ++ YE   R+  W+K+K +YLE  G++LDL ++G
Sbjct: 525 DELQKFLDESVKNSCEGLMVKMMDGVESYYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLG 584

Query: 501 R--TPGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISF 558
                GK+     G  +                   N DSE               F + 
Sbjct: 585 AYFGRGKRTGTYGGFLL----------------GCYNADSED--------------FETC 614

Query: 559 CVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKAR 618
           C I  G S++  + +  K     +      P    +   S  P+ W +P  +++ EV   
Sbjct: 615 CKIGTGFSEEMLQTLYEKLSPTVIDG----PKGTYVFDSSAEPDVWFEP--TMLFEVLTA 668

Query: 619 SLDNT---ESSKKKFAAGCTLHGGYCRRIRDDK---DWTGCYSFSELWQERLH 665
            L  +   ++    +  G +L      RIRDDK   D T      E++Q + H
Sbjct: 669 DLSLSPIYKAGSSVYDKGISLRFPRFLRIRDDKSVEDATSSEQIIEMYQNQSH 721

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  109 bits (272), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 100/413 (24%), Positives = 174/413 (42%), Gaps = 55/413 (13%)

Query: 264 SINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRG 323
           ++  G    P LAK      E +       F  E K DGER QVH +D G  +R  SR G
Sbjct: 384 TLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGT-MRIYSRNG 442

Query: 324 VDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALS 383
            + T+ Y E      + +++      ++ +LD E + +D ++  +LPF ++ +  R+ + 
Sbjct: 443 ENMTERYPEI----KITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVE 498

Query: 384 TEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEH 443
              +     R  L   D++  NG  LI   L +R+E L +V K  P   +    +     
Sbjct: 499 LSDV---KVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNL 555

Query: 444 TAIRKSLEKSISMGSEGIVLKSYK---ARYEIGARNDYWIKVKPEYLEQFGENLDLVIIG 500
             ++K L++S++   EG+++K  +   + YE   R+  W+K+K +YLE  G++LDL ++G
Sbjct: 556 DELQKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLG 615

Query: 501 R--TPGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISF 558
                GK+     G  +    +D  E E                              + 
Sbjct: 616 AYYGRGKRTGTYGGFLLGCYNQDTGEFE------------------------------TC 645

Query: 559 CVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKAR 618
           C I  G S +  +++  +     +      P A  +   S  P+ W +P  + + EV   
Sbjct: 646 CKIGTGFSDESLQQLHERLTPTIIDG----PKATFVFDSSAEPDVWFEP--TTLFEVLTA 699

Query: 619 SLDNT---ESSKKKFAAGCTLHGGYCRRIRDDK---DWTGCYSFSELWQERLH 665
            L  +   ++    FA G +L      RIR+DK   D T      EL++ + H
Sbjct: 700 DLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATSSEQIVELYENQSH 752

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score =  104 bits (259), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 96/411 (23%), Positives = 175/411 (42%), Gaps = 55/411 (13%)

Query: 268 GYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVDYT 327
           G    P LAK      E +       F  E K DGER QVH +  G+ +R  SR G + T
Sbjct: 357 GIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGS-MRIYSRNGENMT 415

Query: 328 QLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTEGI 387
           + Y E      +++++   +     +LD E + +D ++N +LPF ++ +  R+ ++ E +
Sbjct: 416 ERYPEI----RISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDV 471

Query: 388 CSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTAIR 447
                R  L   D++  N   LI  PL +R+  L R L P P  +++   V       ++
Sbjct: 472 ---KVRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQ 528

Query: 448 KSLEKSISMGSEGI---VLKSYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGR--T 502
             L++++    EG+   +L+  ++ YE   R+  W+K+K +YL+  G++LDL ++G    
Sbjct: 529 HYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYG 588

Query: 503 PGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIA 562
            GK+     G  +    +D  E E                              + C I 
Sbjct: 589 RGKRTGTYGGFLLGCYNQDSGEYE------------------------------TCCKIG 618

Query: 563 NGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDN 622
            G S++  + +  +     + +    P A  +   S  P+ W +P  +++ EV    L  
Sbjct: 619 TGFSEEMLQTLFDRLSPTAIPT----PKAFYVHSESAPPDVWFEP--TLLFEVLTADLSL 672

Query: 623 T---ESSKKKFAAGCTLHGGYCRRIRDDK---DWTGCYSFSELWQERLHKS 667
           +   ++    +  G +L      R+RDDK   + T      E ++ + H S
Sbjct: 673 SPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQVVEFYESQSHVS 723

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score =  103 bits (256), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 102/409 (24%), Positives = 173/409 (42%), Gaps = 55/409 (13%)

Query: 268 GYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVDYT 327
           G    P LAK      E +       F  E K DGER QVH    G+ ++  SR G D T
Sbjct: 334 GIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDGS-MKIYSRNGEDMT 392

Query: 328 QLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTEGI 387
           + Y E      V +Y+      +  ++D E + +D ++  +LPF ++ +  R+ +  + +
Sbjct: 393 ERYPEI----DVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKGVELKDV 448

Query: 388 CSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTAIR 447
                R  L   D++ LN   LI    ++R++ L           +    +  +    ++
Sbjct: 449 ---KVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTTTNFDELQ 505

Query: 448 KSLEKSISMGSEGIVLK---SYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGR--T 502
           K L++S+    EG+++K     ++ YE   R+  W+K+K +YLE  G++LDLV++G    
Sbjct: 506 KYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVVLGAYYG 565

Query: 503 PGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIA 562
            GK+     G  +                   NLDSE               F + C I 
Sbjct: 566 RGKRTGTYGGFLL----------------GCYNLDSEE--------------FETCCKIG 595

Query: 563 NGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDN 622
            G S +  +++  K +   V+     PS +++   S   + W +P  S++ EV    L  
Sbjct: 596 TGFSDEMLQDLYTKLKDTTVEH----PSTNVIYDSSAPADVWFEP--SMLFEVLTADLSL 649

Query: 623 TESSKKKFAA---GCTLHGGYCRRIRDDKDWTGCYSFS---ELWQERLH 665
           +   K  F A   G +L      RIRDDK+ T   S     E ++ + H
Sbjct: 650 SPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDATSSDQVIEFYESQAH 698

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score =  103 bits (256), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 99/406 (24%), Positives = 170/406 (41%), Gaps = 67/406 (16%)

Query: 268 GYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVDYT 327
           G    P LAK      E +      +F+ E K DGER QVH ++ G ++R  SR G + T
Sbjct: 356 GIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLE-GGEMRIYSRNGENMT 414

Query: 328 QLYGE--------------NLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGM 373
           + Y E              N Q G      N    V+D +LD E++ +D ++  +LPF +
Sbjct: 415 ERYPELDVKDFLCVVKAITNDQEGE-----NAIQPVKDIILDCEVVAWDVEQKKILPFQV 469

Query: 374 VKSSARQALSTEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVE 433
           + +  R+ +  + +     R  L   DL+YLN   +I   L +R+E L +V    P   +
Sbjct: 470 LTTRKRKNVDLKDV---KVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQ 526

Query: 434 ILPYVRCSEHTAIRKSLEKSISMGSEGIVLK---SYKARYEIGARNDYWIKVKPEYLEQF 490
               +  S+   ++  L++++    EG+++K     ++ YE   R+  W+K+K +YL+  
Sbjct: 527 YATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGV 586

Query: 491 GENLDLVIIGR--TPGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDG 548
           G++LDLV++G     GK+     G  +    ED  E E                      
Sbjct: 587 GDSLDLVVMGAYFGKGKRTGSYGGFLLGCYNEDTQEFE---------------------- 624

Query: 549 KKIIKYFISFCVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPK 608
                   + C I  G S +    +    +   + +    P    +   S  P+ W   K
Sbjct: 625 --------TCCKIGTGFSDEMLGNLHTLLQPTEIDN----PPMTYIYDSSAEPDVWFQAK 672

Query: 609 NSIMLEVKARSLDNT---ESSKKKFAAGCTLHGGYCRRIRDDKDWT 651
             ++ EV    L  +   ++   ++  G +L      RIR+DKD T
Sbjct: 673 --VLFEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVT 716

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score =  103 bits (256), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 97/409 (23%), Positives = 171/409 (41%), Gaps = 55/409 (13%)

Query: 268 GYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVDYT 327
           G    P LAK      E +       F  E K DGER QVH ++ G  +R  SR G + T
Sbjct: 388 GIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGT-MRIYSRNGENMT 446

Query: 328 QLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTEGI 387
           + Y E      + +++      ++ +LD E + +D D+  +LPF ++ +  R+ +    +
Sbjct: 447 ERYPEI----NITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELNDV 502

Query: 388 CSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTAIR 447
                +  L   D++  N   LI   L +R+E+L +V K  P   +    +  +    ++
Sbjct: 503 ---KVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQ 559

Query: 448 KSLEKSISMGSEGIVLKSYK---ARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGR--T 502
           K L++S++   EG+++K  +   + YE   R+  W+K+K +YLE  G++LDL ++G    
Sbjct: 560 KFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYG 619

Query: 503 PGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIA 562
            GK+     G  +    +D  E E                              + C I 
Sbjct: 620 RGKRTGTYGGFLLGCYNQDTGEFE------------------------------TCCKIG 649

Query: 563 NGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDN 622
            G S +  + +  +     +      P A  +   S  P+ W +P  + + EV    L  
Sbjct: 650 TGFSDEMLQLLHDRLTPTIIDG----PKATFVFDSSAEPDVWFEP--TTLFEVLTADLSL 703

Query: 623 T---ESSKKKFAAGCTLHGGYCRRIRDDK---DWTGCYSFSELWQERLH 665
           +   ++    F  G +L      RIR+DK   D T      EL++ + H
Sbjct: 704 SPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQSH 752

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score =  102 bits (255), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 98/409 (23%), Positives = 172/409 (42%), Gaps = 55/409 (13%)

Query: 268 GYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVDYT 327
           G    P LAK      E +       F  E K DGER QVH ++ G  +R  SR G + T
Sbjct: 478 GIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGT-MRIYSRNGENMT 536

Query: 328 QLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTEGI 387
           + Y E      + +++      ++ +LD E + +D D+  +LPF ++ +  R+ +    +
Sbjct: 537 ERYPEI----KITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVELNDV 592

Query: 388 CSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTAIR 447
                R  L   D++  N   LI + L +R+E+L +V K  P   +    +  +    ++
Sbjct: 593 ---KVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQ 649

Query: 448 KSLEKSISMGSEGIVLK---SYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGR--T 502
           K L++S++   EG+++K     ++ YE   R+  W+K+K +YLE  G++LDL ++G    
Sbjct: 650 KFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYG 709

Query: 503 PGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIA 562
            GK+     G  +    +D  E E                              + C I 
Sbjct: 710 RGKRTGTYGGFLLGCYNQDTGEFE------------------------------TCCKIG 739

Query: 563 NGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDN 622
            G S +  + +  +     +      P A  +   S  P+ W +P  + + EV    L  
Sbjct: 740 TGFSDEMLQLLHARLTPTIIDG----PKATYVFDSSAEPDVWFEP--TTLFEVLTADLSL 793

Query: 623 T---ESSKKKFAAGCTLHGGYCRRIRDDK---DWTGCYSFSELWQERLH 665
           +   ++    F  G +L      RIR+DK   D T      EL++ + H
Sbjct: 794 SPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQSH 842

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score =  100 bits (249), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 98/409 (23%), Positives = 174/409 (42%), Gaps = 55/409 (13%)

Query: 268 GYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVDYT 327
           G    P LAK      E +       F  E K DGER QVH ++ G  +R  SR G + T
Sbjct: 339 GIPLKPMLAKPTKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDGT-MRIYSRNGENMT 397

Query: 328 QLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTEGI 387
           + Y E     ++ +++    + +  +LD E + +D  +  +LPF ++ +  R+ +  + +
Sbjct: 398 ERYPEI----SIRDFVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDV 453

Query: 388 CSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTAIR 447
                R  L   D++  NG   I   L +R+E L +V KP     +    +  S    ++
Sbjct: 454 ---KVRVCLFAFDIICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQ 510

Query: 448 KSLEKSISMGSEGIVLKSY---KARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGR--T 502
           K L++S+    EG+++K     ++ YE   R+  W+K+K +YL+  G++LDL ++G    
Sbjct: 511 KFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAYYG 570

Query: 503 PGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIA 562
            GK+     G  +    +D  E E                              + C I 
Sbjct: 571 RGKRTGTYGGFLLGCYNQDSGEFE------------------------------TCCKIG 600

Query: 563 NGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDN 622
            G S +  +++  +    + K+    P A  +   S  P+ W +P  + + EV    L  
Sbjct: 601 TGFSDEMLQQLYER----FSKTTLDGPKATYVFDSSAEPDVWFEP--TTLFEVLTADLSL 654

Query: 623 T---ESSKKKFAAGCTLHGGYCRRIRDDK---DWTGCYSFSELWQERLH 665
           +   ++    +  G +L      R+RDDK   D T      EL+Q++ H
Sbjct: 655 SPVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQSH 703

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 96/409 (23%), Positives = 172/409 (42%), Gaps = 55/409 (13%)

Query: 268 GYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVDYT 327
           G    P LAK      E +       F  E K DGER QVH ++ G  +R  SR G + T
Sbjct: 388 GIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGT-MRIYSRNGENMT 446

Query: 328 QLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTEGI 387
           + Y E      + +++   ++ ++ +LD E + +D ++  +LPF ++ +  R+ +    +
Sbjct: 447 ERYPEI----KITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVELHDV 502

Query: 388 CSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTAIR 447
                +  L   D++  N   LI   L +R+E L +V K  P   +    +  +    ++
Sbjct: 503 ---KVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQ 559

Query: 448 KSLEKSISMGSEGIVLKSY---KARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGR--T 502
           K L++S++   EG+++K     ++ YE   R+  W+K+K +YLE  G++LDL ++G    
Sbjct: 560 KFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYG 619

Query: 503 PGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIA 562
            GK+     G  +    +D  E E                              + C I 
Sbjct: 620 RGKRTGTYGGFLLGCYNQDTGEFE------------------------------TCCKIG 649

Query: 563 NGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDN 622
            G S +  + +  +     +      P A  +   S  P+ W +P  + + EV    L  
Sbjct: 650 TGFSDEMLQLLHERLTPTIIDG----PKATFVFDASAEPDVWFEP--TTLFEVLTADLSL 703

Query: 623 T---ESSKKKFAAGCTLHGGYCRRIRDDK---DWTGCYSFSELWQERLH 665
           +   ++    F  G +L      RIR+DK   D T      EL++ + H
Sbjct: 704 SPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIIELYENQSH 752

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 99/414 (23%), Positives = 175/414 (42%), Gaps = 57/414 (13%)

Query: 264 SINLGYAFVPQLAKKMTISYEKICTKLNND-FLIEEKMDGERIQVHYMDYGAKIRFLSRR 322
           S+  G    P LAK  T +  +I  +   + F  E K DGER QVH +  G  +R  SR 
Sbjct: 383 SLRPGIPLKPMLAKP-TKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDGT-MRIYSRN 440

Query: 323 GVDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQAL 382
           G + T+ Y E      +A+ L   + + DC    E + +D ++N +LPF ++ +  R+ +
Sbjct: 441 GENMTERYPEIHIRDFIADPLVTSTLILDC----EAVAWDNEQNKILPFQVLSTRKRKDV 496

Query: 383 STEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSE 442
             + +     +  L   D++  N   LI   L +R++ L  V K      +    +  S 
Sbjct: 497 DLKDV---KVKVCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSN 553

Query: 443 HTAIRKSLEKSISMGSEGIVLK---SYKARYEIGARNDYWIKVKPEYLEQFGENLDLVII 499
              ++K L++S+    EG+++K     ++ YE   R+  W+K+K +YLE  G++LDL +I
Sbjct: 554 LDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVI 613

Query: 500 GR--TPGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFIS 557
           G     GK+  +  G  +    +D  E E                              +
Sbjct: 614 GAYYGRGKRTGMYGGFLLGCYNQDTGEFE------------------------------T 643

Query: 558 FCVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKA 617
            C I  G S +  +++  +     +      P A  +   S  P+ W +P  +++ EV  
Sbjct: 644 CCKIGTGFSDEMLQQLYTRLTPTVLDG----PKATFVYDSSAEPDVWFEP--TLLFEVLT 697

Query: 618 RSLDNT---ESSKKKFAAGCTLHGGYCRRIRDDK---DWTGCYSFSELWQERLH 665
             L  +   ++    +  G +L      R R+DK   D T      EL++ + H
Sbjct: 698 ADLSLSPIYKAGSSTYDKGISLRFPRFIRTREDKGVEDATSSEQIIELYENQAH 751

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 96/411 (23%), Positives = 180/411 (43%), Gaps = 56/411 (13%)

Query: 268 GYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVDYT 327
           G    P LAK      E +       F+ E K DGER Q+H +  G  +R  SR G + T
Sbjct: 366 GIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGT-MRIYSRNGENMT 424

Query: 328 QLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTEGI 387
           + Y E      + ++L+ D +    +LD E + +D ++  +LPF ++ +  R+ +  + +
Sbjct: 425 ERYPEI----DIRDFLS-DPSTESLILDCEAVAWDKEQGKILPFQVLSTRKRKDVDAKDV 479

Query: 388 CSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTAIR 447
                R  L   DL+  NG  LI   L +R++ L +V KP          +  +    ++
Sbjct: 480 ---KVRVCLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQ 536

Query: 448 KSLEKSISMGSEGIVLKSY---KARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGR--T 502
             L++S+    EG+++K     ++ YE   R+  W+K+K +YL   G++LDL ++G    
Sbjct: 537 HFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLGAYYG 596

Query: 503 PGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIA 562
            GK+     G  +    +D  E E                              + C I 
Sbjct: 597 RGKRTGTYGGFLLGCYNQDTGEYE------------------------------TCCKIG 626

Query: 563 NGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDN 622
            G S++  +++  + +   +++    P+A  +   ++ P+ W +P  +++ EV A  L  
Sbjct: 627 TGFSEELLQQLYDRLKPTAMEA----PAAFYVYDSAQQPDVWFEP--TLLFEVLAADLSL 680

Query: 623 T---ESSKKKFAAGCTLHGGYCRRIRDDK---DWTGCYSFSELWQERLHKS 667
           +   ++   ++  G +L      RIRDDK   + T      +L++ + H S
Sbjct: 681 SPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVDLYEAQAHLS 731

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score = 94.0 bits (232), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 93/403 (23%), Positives = 174/403 (43%), Gaps = 57/403 (14%)

Query: 273 PQLAKKMTISYEKICTKLNND-FLIEEKMDGERIQVHYMDYGAKIRFLSRRGVDYTQLYG 331
           P LAK  T S  +I  +  +  F  E K DGER QVH ++ G  +R  SR G + T+ Y 
Sbjct: 365 PMLAKP-TKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGT-MRIYSRNGENMTERYP 422

Query: 332 ENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTEGICSQG 391
           E      + +++   S+ +  +LD E + +D ++N +LPF ++ +  R+ +    I    
Sbjct: 423 EI----HIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEI---K 475

Query: 392 HRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTAIRKSLE 451
            R  L   D++  N   LI   L +R++ L+ + K      +    +  +    ++  L+
Sbjct: 476 VRVCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLD 535

Query: 452 KSISMGSEGIVLK---SYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGR--TPGKK 506
           +S+    EG+++K     ++ YE   R+  W+K+K +YL   G++LDL ++G     GK+
Sbjct: 536 QSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKR 595

Query: 507 DSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIANGIS 566
                G  +    +D  E E                              + C I  G S
Sbjct: 596 TGNYGGFLLGCYNQDTGEFE------------------------------TACKIGTGFS 625

Query: 567 QQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDNT--- 623
            +  +++  + +   +     LP A  +   S  P+ W +P  +++ EV    L  +   
Sbjct: 626 DEVLQQLHERLKSTVID----LPKATYVFDPSAEPDVWFEP--TLLFEVLTADLSLSPVY 679

Query: 624 ESSKKKFAAGCTLHGGYCRRIRDDK---DWTGCYSFSELWQER 663
           ++    +  G +L      R+R+DK   D T      E+++ +
Sbjct: 680 KAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVEMYENQ 722

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 95/413 (23%), Positives = 170/413 (41%), Gaps = 55/413 (13%)

Query: 264 SINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRG 323
           S+  G    P LAK      E      N  F  E K DGER QVH M+ G+ +R  SR G
Sbjct: 339 SLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMNDGS-MRIYSRNG 397

Query: 324 VDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALS 383
            + T+ Y E      V +++   +  +  ++D E + +D +   +LPF ++ +  R+ + 
Sbjct: 398 ENMTERYPEI----NVTDFIKDLNLTKSLIIDCEAVAWDREEKKILPFQVLSTRKRKDVD 453

Query: 384 TEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEH 443
            + I     R  L   D++  N   LI   L +R+E L+ V +           +  +  
Sbjct: 454 IKDI---KVRICLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKELSTNNL 510

Query: 444 TAIRKSLEKSISMGSEGI---VLKSYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIG 500
             ++  L++S+    EG+   VL    + YE   R+  W+K+K +YL+  G++LDL ++G
Sbjct: 511 DELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLG 570

Query: 501 R--TPGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISF 558
                GK+     G  +    +D  E E                              + 
Sbjct: 571 AFYGRGKRTGTYGGFLLGCYNQDTGEFE------------------------------TA 600

Query: 559 CVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKAR 618
           C I  G S +  + +  + +   +      P A  +   S  P+ W +P  +++ EV   
Sbjct: 601 CKIGTGFSDEVLQSLYDRLKSTTIDG----PKATYIYDSSAQPDVWFEP--TLLFEVLTA 654

Query: 619 SLDNT---ESSKKKFAAGCTLHGGYCRRIRDDK---DWTGCYSFSELWQERLH 665
            L  +   ++    ++ G +L      R+R+DK   + T      EL++ + H
Sbjct: 655 DLSMSPIYKAGASTYSKGISLRFPRFIRLREDKSVEEATSSEQIIELYENQSH 707

>KLLA0B02200g Chr2 (196341..197741) [1401 bp, 466 aa] {ON} highly
           similar to uniprot|Q01159 Saccharomyces cerevisiae
           YGL130W CEG1 mRNA guanylyltransferase (mRNA capping
           enzyme), alpha subunit
          Length = 466

 Score = 38.5 bits (88), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 44/103 (42%), Gaps = 14/103 (13%)

Query: 397 MVLDLVYLNGVSLIKLPLYQRKEFLNR-VLKP-------CPHAVEILPYVRCSEHTAIRK 448
           ++ D + +NG SL++ P   R   L +   KP        P      P+    +H     
Sbjct: 146 LMFDCLAVNGRSLVQSPTSSRLAHLGKEFFKPYYDLRSYFPDRCSTFPFKISMKHMNFSY 205

Query: 449 SLEK------SISMGSEGIVLKSYKARYEIGARNDYWIKVKPE 485
            L K      S+   S+G++    +A Y IG ++ Y +K KPE
Sbjct: 206 DLAKVAKTLDSLPHVSDGLIFTPVQAAYHIGGKDSYLLKWKPE 248

>TDEL0D01440 Chr4 complement(282138..283949) [1812 bp, 603 aa] {ON}
           Anc_1.276 YJL090C
          Length = 603

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 31/60 (51%)

Query: 741 NSGKLVRNLISKHHSESQFRIISGKYTAECRALIERGYDILSPQWILDCIRNRMVVKLEP 800
           NS   V++  S+H  ++   I      A  +A IE+G  I+  +WILDC R    ++ +P
Sbjct: 147 NSSHFVKDCKSRHDQKTVVFISDTLQGARVQAAIEQGIPIVHYKWILDCQRRNATLEYDP 206

>KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.80
          YGL035C
          Length = 335

 Score = 36.6 bits (83), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 29/61 (47%)

Query: 16 ELQESESTEKAPPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGNKPLSVRYYEVISHFI 75
          + Q+  S +K+  + AP P    +C+  F +LE   R  R H G KP +  +   +  F 
Sbjct: 2  DTQKKTSQKKSNSDEAPRPHVCPICQRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFS 61

Query: 76 R 76
          R
Sbjct: 62 R 62

>NCAS0D04100 Chr4 (774815..776164) [1350 bp, 449 aa] {ON} Anc_6.228
           YGL130W
          Length = 449

 Score = 35.8 bits (81), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 44/103 (42%), Gaps = 14/103 (13%)

Query: 397 MVLDLVYLNGVSLIKLPLYQRKEFLNR-VLKPC-------PHAVEILPYVRCSEHTAIRK 448
           ++ D + +NG SL++ P   R   L +   KP        P+     P+    +H     
Sbjct: 145 LMFDCLAINGRSLMQSPTSSRLAHLGKDFFKPYYDLRSIYPNHCNTFPFKISMKHMDFSY 204

Query: 449 SLEK------SISMGSEGIVLKSYKARYEIGARNDYWIKVKPE 485
           +L K       +   S+G++    K  Y IG ++ Y +K KPE
Sbjct: 205 ALVKVANSLDKLPHLSDGLIFTPVKMPYNIGGKDSYLLKWKPE 247

>TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa]
           {ON} Anc_4.80 YGL035C
          Length = 390

 Score = 35.8 bits (81), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 21/49 (42%)

Query: 28  PNFAPSPDFIWLCEELFVKLEDVQRQGREHLGNKPLSVRYYEVISHFIR 76
           PN AP P    +C   F +LE   R  R H G KP S  +      F R
Sbjct: 65  PNEAPRPHVCPVCNRAFHRLEHQTRHIRTHTGEKPHSCDFPGCTKKFSR 113

>KNAG0F01900 Chr6 (367193..368566) [1374 bp, 457 aa] {ON} Anc_6.228
           YGL130W
          Length = 457

 Score = 35.0 bits (79), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 46/104 (44%), Gaps = 16/104 (15%)

Query: 397 MVLDLVYLNGVSLIKLPLYQRKEFLNR-VLKPC-------PHAVEILPYVRCSEH----- 443
           ++ D + +NG SLI+ P   R   L +   KP        P      P     +H     
Sbjct: 145 LMFDCLAINGRSLIQSPTSSRLAHLGKEFFKPYYDLRSFYPDHCSTFPLKLSMKHMDFSY 204

Query: 444 --TAIRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPE 485
               + +SL+K   M S+G++    +A Y++G ++   +K KPE
Sbjct: 205 ELVKVAQSLDKLPHM-SDGLIFTPVRAPYQVGGKDSLLLKWKPE 247

>TPHA0A05820 Chr1 complement(1319614..1320444) [831 bp, 276 aa]
          {ON} Anc_3.518 YGL209W
          Length = 276

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 35/75 (46%), Gaps = 2/75 (2%)

Query: 21 ESTEKAPPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGNKPLSVRYYEVISHFIRL--W 78
          +S EK P + +  P F   C   F +LE  +R  + H G KP   ++ + I  F R    
Sbjct: 23 KSKEKFPNDNSERPFFCESCGRGFYRLEHKKRHLKIHTGEKPYKCKFEQCIKSFSRSDEL 82

Query: 79 RKTVGNNIFPALVLS 93
          R+    +I PA  LS
Sbjct: 83 RRHSKIHISPATKLS 97

>SAKL0E13860g Chr5 complement(1141665..1143575) [1911 bp, 636 aa]
           {ON} some similarities with uniprot|P11938 Saccharomyces
           cerevisiae YNL216W RAP1 DNA-binding protein involved in
           either activation or repression of transcription
           depending on binding site context also binds telomere
           sequences and plays a role in telomeric position effect
           (silencing) and telomere structure
          Length = 636

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 50/109 (45%), Gaps = 22/109 (20%)

Query: 691 PFSGQAAKKHDVFDSTNIFKGLQFYVLSDYIDVSRNVRITKSEFDDLILQNSGKLVRNLI 750
           P +G+   KHD+     IF  L+FY+  D           K E  +LI +N G+++  L 
Sbjct: 21  PVTGE---KHDLKKGDGIFHHLKFYIAQDE---------NKQELTELIQKNGGEVLSELP 68

Query: 751 SKHHSESQFRIISGKYTAECRALIERGYDILSPQWILDCIRNRMVVKLE 799
           +   ++S   ++S   T             ++P++I  C  N +++KL+
Sbjct: 69  TADGTKS--LVVSPFNTTNLPT--------VTPKYIKTCCENNVLMKLQ 107

>YGL035C Chr7 complement(431548..433062) [1515 bp, 504 aa] {ON}
          MIG1Transcription factor involved in glucose
          repression; sequence specific DNA binding protein
          containing two Cys2His2 zinc finger motifs; regulated
          by the SNF1 kinase and the GLC7 phosphatase
          Length = 504

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 29/61 (47%), Gaps = 1/61 (1%)

Query: 17 LQESESTEK-APPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGNKPLSVRYYEVISHFI 75
          L+ES+S  K A  + AP P    +C   F +LE   R  R H G KP +  +   +  F 
Sbjct: 19 LKESKSKSKVAAKSEAPRPHACPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFS 78

Query: 76 R 76
          R
Sbjct: 79 R 79

>Suva_7.133 Chr7 (262417..263796) [1380 bp, 459 aa] {ON} YGL130W
           (REAL)
          Length = 459

 Score = 33.9 bits (76), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 45/104 (43%), Gaps = 16/104 (15%)

Query: 397 MVLDLVYLNGVSLIKLPLYQRKEFLNR-VLKPC-------PHAVEILPYVRCSEH----- 443
           ++ D + +NG  L++ P   R   L +   KP        P+     P+    +H     
Sbjct: 149 LMFDCLAINGRCLVQSPTSSRLAHLGKEFFKPYFDLRAAYPNRCTTFPFKISMKHMDFSY 208

Query: 444 --TAIRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPE 485
               + KSLEK +   S+G++    KA Y  G ++   +K KPE
Sbjct: 209 QLVKVAKSLEK-LPHLSDGLIFTPVKAPYTAGGKDSLLLKWKPE 251

>Skud_7.249 Chr7 complement(434181..435689) [1509 bp, 502 aa] {ON}
          YGL035C (REAL)
          Length = 502

 Score = 33.9 bits (76), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 37/79 (46%), Gaps = 3/79 (3%)

Query: 1  MESAEILTSTHEVSQE--LQESESTEK-APPNFAPSPDFIWLCEELFVKLEDVQRQGREH 57
          M+S   +T   +V  E  L++S+S  K A  + AP P    +C   F +LE   R  R H
Sbjct: 1  MQSPYPVTQMSKVDDESLLKDSKSKSKTAAKSEAPRPHACPICHRAFHRLEHQTRHMRIH 60

Query: 58 LGNKPLSVRYYEVISHFIR 76
           G KP +  +   +  F R
Sbjct: 61 TGEKPHACDFPGCVKRFSR 79

>CAGL0I09570g Chr9 complement(914062..915411) [1350 bp, 449 aa] {ON}
           highly similar to uniprot|Q01159 Saccharomyces
           cerevisiae YGL130w mRNA guanylyltransferase
          Length = 449

 Score = 32.0 bits (71), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 48/233 (20%), Positives = 87/233 (37%), Gaps = 46/233 (19%)

Query: 397 MVLDLVYLNGVSLIKLPLYQRKEFLNR-VLKPC-------PHAVEILPYVRCSEHTAIRK 448
           ++ D + +NG SL++ P   R   L +   KP        P      P+    +H     
Sbjct: 145 LMFDCLAINGRSLVQSPTSSRLAHLGKEFYKPYYDLRSIYPDKCATFPFKLSMKHMDFSY 204

Query: 449 SLEK------SISMGSEGIVLKSYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGRT 502
           SL K       +   S+G++    +  Y +G ++   +K KPE       ++D  +I   
Sbjct: 205 SLVKVANSLDKLPHLSDGLIFTPVRTPYAVGGKDSLLLKWKPEQ----ENSVDFKLILEI 260

Query: 503 PGKKDSLMC-----------------GLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDD 545
           P  +D+ +                   L V++G  D+N       + + N +   D+ + 
Sbjct: 261 PMTEDNSVAKKDPRRWYYNYDAKPTFALYVWQGGSDVN-------TKLQNFEQPFDKREM 313

Query: 546 TDGKKIIKYFISFCVIANGISQQEFKEIDRKTRGAWVK--SDQRLPSADLLRF 596
              +K  K F    +  +    QE K ++    G  V+   D    S  +LRF
Sbjct: 314 QVLEKTYKRFAELSI--SDEQWQELKNLEEPLNGRIVECTKDPETGSWTMLRF 364

>CAGL0G07843g Chr7 (744599..746395) [1797 bp, 598 aa] {ON} highly
           similar to uniprot|P53261 Saccharomyces cerevisiae
           YGR103w
          Length = 598

 Score = 32.0 bits (71), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 45/107 (42%), Gaps = 7/107 (6%)

Query: 689 IDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDYI-DVSRNVRITKSEFDDLILQNSGKLVR 747
           +D F      K D+    + F      +  D++  V R V I   EF  LIL   GK++ 
Sbjct: 322 LDEFEDHNKNKGDILAQPSKFSSPTATLFEDFVFYVGREVPIEAIEF--LILSCGGKVIS 379

Query: 748 NL-ISKHHSESQFRIISGKYTAECRALIER---GYDILSPQWILDCI 790
              + +    ++F +    +    R +++    G   + PQW+ DCI
Sbjct: 380 EAAMDQIEGNTEFDLSKVTHQIVDRPVLKHKVAGRTYIQPQWVFDCI 426

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 103,258,813
Number of extensions: 4595995
Number of successful extensions: 13178
Number of sequences better than 10.0: 63
Number of HSP's gapped: 13284
Number of HSP's successfully gapped: 65
Length of query: 969
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 850
Effective length of database: 39,836,145
Effective search space: 33860723250
Effective search space used: 33860723250
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)