Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G045006.19ON30127512581e-175
Smik_15.1756.19ON31223910341e-141
YOR006C (TSR3)6.19ON31327610291e-140
ZYRO0C07832g6.19ON28124010231e-140
Suva_15.1816.19ON33623810261e-140
SAKL0E01144g6.19ON43024210321e-139
Kpol_1037.246.19ON36628010061e-136
Skud_15.1676.19ON31227610001e-136
TPHA0J003206.19ON3422829841e-133
CAGL0E02717g6.19ON3252779741e-132
KNAG0M011506.19ON3072809661e-131
KLLA0D01111g6.19ON3142769621e-130
ACR007W6.19ON3132429561e-129
Ecym_30236.19ON3492389281e-125
KLTH0C11264g6.19ON3462379121e-122
Kwal_56.224216.19ON3372149101e-122
NCAS0H008106.19ON3232878711e-116
NDAI0D007906.19ON4013078721e-115
KAFR0L003906.19ON3292588181e-108
TBLA0A072506.19ON3042777661e-101
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G04500
         (301 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19...   489   e-175
Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {O...   402   e-141
YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}  ...   400   e-140
ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar...   398   e-140
Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {...   399   e-140
SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON...   402   e-139
Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {O...   392   e-136
Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {O...   389   e-136
TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON...   383   e-133
CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {O...   379   e-132
KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {O...   376   e-131
KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {O...   375   e-130
ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic hom...   372   e-129
Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON} s...   362   e-125
KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} simila...   355   e-122
Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {...   355   e-122
NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON...   340   e-116
NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {O...   340   e-115
KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}...   319   e-108
TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {...   299   e-101

>TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19
           YOR006C
          Length = 301

 Score =  489 bits (1258), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 241/275 (87%), Positives = 241/275 (87%)

Query: 1   MSKGKNKNREAXXXXXXXXXXXXXXRQNHKRMEMKRGTEDTKFPVKLAMWDFDHCDPKRC 60
           MSKGKNKNREA              RQNHKRMEMKRGTEDTKFPVKLAMWDFDHCDPKRC
Sbjct: 1   MSKGKNKNREAKNGHSGKGSNGHSSRQNHKRMEMKRGTEDTKFPVKLAMWDFDHCDPKRC 60

Query: 61  SGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWARLDEVP 120
           SGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWARLDEVP
Sbjct: 61  SGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWARLDEVP 120

Query: 121 FNKIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSHFSWGLG 180
           FNKIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSHFSWGLG
Sbjct: 121 FNKIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSHFSWGLG 180

Query: 181 FLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGNVNRKGTT 240
           FLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGNVNRKGTT
Sbjct: 181 FLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGNVNRKGTT 240

Query: 241 FLXXXXXXXXXXXXXXXXXXXXGKTLRYDRLGNLI 275
           FL                    GKTLRYDRLGNLI
Sbjct: 241 FLDDNEEEESSEVEESDEEEDNGKTLRYDRLGNLI 275

>Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  402 bits (1034), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 193/239 (80%), Positives = 206/239 (86%), Gaps = 1/239 (0%)

Query: 1   MSKGKNKNREAXXXXXXXXXXXXXXRQNHKRMEMKRGTED-TKFPVKLAMWDFDHCDPKR 59
           M KGKNK  E               RQNH+RMEMK    D  KFPVKLAMWDFDHCDPKR
Sbjct: 1   MGKGKNKAHEPKNGRPQRGANGHSSRQNHRRMEMKYENSDKVKFPVKLAMWDFDHCDPKR 60

Query: 60  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWARLDEV 119
           CSGKKLERLGLIKSLRVGQKFQGIVVSPNG GVVCPDD  +VE+HGASVVECSWARL+EV
Sbjct: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARLEEV 120

Query: 120 PFNKIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSHFSWGL 179
           PFNKIGGKHERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGRMDWASELLSHFSWG+
Sbjct: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180

Query: 180 GFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGNVNRKG 238
           GFLELN+ELLEIYQQCTDADSVK AE  WL K++KE +ERKSQAK+EDIWM GN+NR+G
Sbjct: 181 GFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINRRG 239

>YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}
           TSR3Protein required for correct processing of the 20S
           pre-rRNA at site D to generate mature 18S rRNA; green
           fluorescent protein (GFP)-fusion protein localizes to
           both the cytoplasm and the nucleus
          Length = 313

 Score =  400 bits (1029), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 198/276 (71%), Positives = 214/276 (77%), Gaps = 3/276 (1%)

Query: 1   MSKGKNKNREAXXXXXXXXXXXXXXRQNHKRMEMKR-GTEDTKFPVKLAMWDFDHCDPKR 59
           M KGKNK  E               RQNH+RMEMK   +E  KFPVKLAMWDFDHCDPKR
Sbjct: 1   MGKGKNKMHEPKNGRPQRGANGHSSRQNHRRMEMKYDNSEKMKFPVKLAMWDFDHCDPKR 60

Query: 60  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWARLDEV 119
           CSGKKLERLGLIKSLRVGQKFQGIVVSPNG GVVCPDD  IVE+HGASVVECSWARL+EV
Sbjct: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARLEEV 120

Query: 120 PFNKIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSHFSWGL 179
           PFNKIGGKHERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGRMDWASELLSHFSWG+
Sbjct: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180

Query: 180 GFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGNVNRKGT 239
           GFLELN+ELLEIYQQCTD DSVK AE  WL K++KE +ERKS+AK+EDIWM GN+NR+G 
Sbjct: 181 GFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNINRRGN 240

Query: 240 TFLXXXXXXXXXXXXXXXXXXXXGKTLRYDRLGNLI 275
                                   + + YD LGN I
Sbjct: 241 G--SQSDTSESEENSEQSDLEGNNQCIEYDSLGNAI 274

>ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar to
           uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 281

 Score =  398 bits (1023), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 189/240 (78%), Positives = 208/240 (86%), Gaps = 4/240 (1%)

Query: 1   MSKGKNKNREAXXXXXXXXXXXXXXRQNHKRMEMKRG----TEDTKFPVKLAMWDFDHCD 56
           M KGKNKN E               +QNHK MEMK G    +  T FPVKL MWDFDHCD
Sbjct: 1   MGKGKNKNHEVRSTRPGRGANGHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCD 60

Query: 57  PKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWARL 116
           PKRCSGKKLERLGLI+SLRVGQKFQG+VV+PNG+GVVCP+DKSIVEEHGASVVECSWARL
Sbjct: 61  PKRCSGKKLERLGLIRSLRVGQKFQGVVVTPNGTGVVCPNDKSIVEEHGASVVECSWARL 120

Query: 117 DEVPFNKIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSHFS 176
           DEVPFN+IGG+HERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLS+FS
Sbjct: 121 DEVPFNRIGGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNFS 180

Query: 177 WGLGFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGNVNR 236
           +G  FLE+N ELLEIYQQCTDA+SVK AESAWL KI+KE+++RK+QAK+EDIWMTGNVNR
Sbjct: 181 YGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNVNR 240

>Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {ON}
           YOR006C (REAL)
          Length = 336

 Score =  399 bits (1026), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 191/238 (80%), Positives = 206/238 (86%), Gaps = 1/238 (0%)

Query: 1   MSKGKNKNREAXXXXXXXXXXXXXXRQNHKRMEMKR-GTEDTKFPVKLAMWDFDHCDPKR 59
           M KGKNK  E               RQNHKRMEMK   +E T FPVKLAMWDFDHCDPKR
Sbjct: 25  MGKGKNKTHEPKNGRPQRGANGHSSRQNHKRMEMKYDNSEMTNFPVKLAMWDFDHCDPKR 84

Query: 60  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWARLDEV 119
           CSGKKLERLGLIKSLRVGQKFQGIVVSPNG+GVVCPDD  +VE+HGASVVECSWARL+EV
Sbjct: 85  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARLEEV 144

Query: 120 PFNKIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSHFSWGL 179
           PFNKIGGKHERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGRMDWAS LLSHFSWGL
Sbjct: 145 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFSWGL 204

Query: 180 GFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGNVNRK 237
           GFL+LN+ELLEIYQ+CTD++SVK AE  WL K++KE +ERKSQ+KDEDIWM GNVNRK
Sbjct: 205 GFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNRK 262

>SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 430

 Score =  402 bits (1032), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 193/242 (79%), Positives = 208/242 (85%), Gaps = 3/242 (1%)

Query: 1   MSKGKNKNREAXXXXXXXXXXXXXXRQNHKRMEMKRGTEDT---KFPVKLAMWDFDHCDP 57
           M KGKNKN E               R NHKRMEMKRG + +   KFPVKLAMWDFDHCDP
Sbjct: 1   MGKGKNKNHEERSSRPHRGANGHSSRLNHKRMEMKRGGDSSAGNKFPVKLAMWDFDHCDP 60

Query: 58  KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWARLD 117
           KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNG GVVCP+D+ IVEEHGASVVECSWARLD
Sbjct: 61  KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARLD 120

Query: 118 EVPFNKIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSHFSW 177
           EVPF +IGGKHERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGR D ASELLS+FSW
Sbjct: 121 EVPFGRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFSW 180

Query: 178 GLGFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGNVNRK 237
           GLGFLELN+ELLEIYQQCTDADSVKAAE AWL KI++E ++RK Q+K+EDIWM GNVNR+
Sbjct: 181 GLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVNRR 240

Query: 238 GT 239
            T
Sbjct: 241 RT 242

>Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {ON}
           complement(54258..55358) [1101 nt, 367 aa]
          Length = 366

 Score =  392 bits (1006), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 189/280 (67%), Positives = 216/280 (77%), Gaps = 5/280 (1%)

Query: 1   MSKGKNKNREAXXXXXXXXXXXXXXRQNHKRMEMKRG----TEDTKFPVKLAMWDFDHCD 56
           M+KGKNK  EA              + NHK MEMK+     ++D KFPVKLAMWDFDHCD
Sbjct: 1   MAKGKNKQHEARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCD 60

Query: 57  PKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWARL 116
           PKRCSGK+LERLGLIKSLRVGQKFQG+VVSPNG GV+CP+D+ IVEE GASVVECSWARL
Sbjct: 61  PKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARL 120

Query: 117 DEVPFNKIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSHFS 176
           DEVPFNKIGGKHERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGRMDWA+ELLS+FS
Sbjct: 121 DEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFS 180

Query: 177 WGLGFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGNVNR 236
           WGLGFLE+N+ELL+IYQQCTD++SVK AE  WL KI++E++ERK+QA++ DIWM GN NR
Sbjct: 181 WGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNTNR 240

Query: 237 K-GTTFLXXXXXXXXXXXXXXXXXXXXGKTLRYDRLGNLI 275
                                       K+ RYD LGN+I
Sbjct: 241 NMNGDDDEEEGNSYEALSGDDYEEENNNKSARYDNLGNII 280

>Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  389 bits (1000), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 190/276 (68%), Positives = 209/276 (75%), Gaps = 3/276 (1%)

Query: 1   MSKGKNKNREAXXXXXXXXXXXXXXRQNHKRMEMKRG-TEDTKFPVKLAMWDFDHCDPKR 59
           M KGKNK  E               RQNHK MEMK   +E  KFPVKLAMWDFDHCDPKR
Sbjct: 1   MGKGKNKTHEPKNERQQRGANGHSARQNHKHMEMKYDKSEKMKFPVKLAMWDFDHCDPKR 60

Query: 60  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWARLDEV 119
           CSGKKLERLGLI+SLRVGQKFQG+VVSPNG GVVCP+D  IVE+HGASVVECSWARL+EV
Sbjct: 61  CSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARLEEV 120

Query: 120 PFNKIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSHFSWGL 179
           PFNKIGGK+ERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVG+MDWASELLSHFSWGL
Sbjct: 121 PFNKIGGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFSWGL 180

Query: 180 GFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGNVNRKGT 239
           GFL+LN+ELLEIYQ+CTDADSVK AE  WL K++ E +ERKS  K  DIWM GN+NR+G 
Sbjct: 181 GFLDLNKELLEIYQRCTDADSVKKAEKEWLEKLEMETQERKSHTKKTDIWMMGNINRRGN 240

Query: 240 TFLXXXXXXXXXXXXXXXXXXXXGKTLRYDRLGNLI 275
                                   + + YD LGN I
Sbjct: 241 GVQSDELESGEDSEQSGLENSE--QPIEYDALGNAI 274

>TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON}
           Anc_6.19 YOR006C
          Length = 342

 Score =  383 bits (984), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 189/282 (67%), Positives = 211/282 (74%), Gaps = 11/282 (3%)

Query: 1   MSKGKNKNREAXXXXXXXXXXXXXXRQNHKRMEMK-------RGTEDTKFPVKLAMWDFD 53
           M+KGKNK+ E               R NHKRMEMK         +++  FPVKLAMWDFD
Sbjct: 1   MAKGKNKSSETRSGKPSRGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFD 60

Query: 54  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSW 113
           HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNG GVVCPDDK  VEE GASVVECSW
Sbjct: 61  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSW 120

Query: 114 ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLS 173
           ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGR+D A+ELL 
Sbjct: 121 ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLE 180

Query: 174 HFSWGLGFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGN 233
           HFSWGLGFLELN+ELLE+YQ+CTD++SVK  E  WL KI KEV+ERKSQ+++ DIW+ GN
Sbjct: 181 HFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGN 240

Query: 234 VNRKGTTFLXXXXXXXXXXXXXXXXXXXXGKTLRYDRLGNLI 275
            NR     L                     + +RYD LGN++
Sbjct: 241 TNRD----LQDMSDDEEFDSEQYYSEENTERKIRYDNLGNVL 278

>CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006c
          Length = 325

 Score =  379 bits (974), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 184/277 (66%), Positives = 209/277 (75%), Gaps = 4/277 (1%)

Query: 3   KGKNKNREAXXXXXXXXXXXXXXRQNHKRMEMKR--GTEDTKFPVKLAMWDFDHCDPKRC 60
           KGKNK+ +               R+NH+ MEMK   G++D+ FPVKLAMWDFDHCDPKRC
Sbjct: 5   KGKNKSHDEGRSNKSGGSNGHHTRRNHRHMEMKYCGGSKDSSFPVKLAMWDFDHCDPKRC 64

Query: 61  SGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWARLDEVP 120
           SGKKLERLGLIKSLRVGQKFQGIVVSPNG  VVCPDD+ IVE HGASVVECSWARL+EVP
Sbjct: 65  SGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARLEEVP 124

Query: 121 FNKIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSHFSWGLG 180
           FNKIGGKHERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGR D A ELLSHFSWGLG
Sbjct: 125 FNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFSWGLG 184

Query: 181 FLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGNVNRKGTT 240
           FLELN++LLE YQQCTD++S+K  E  WL +I +EV+ERK +A+ ED+WM GN NR  + 
Sbjct: 185 FLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTNRGNSG 244

Query: 241 FL--XXXXXXXXXXXXXXXXXXXXGKTLRYDRLGNLI 275
            +                       K +RYD LGN+I
Sbjct: 245 LMPPSDSEEEYEEEAEEEEEDTTTRKNVRYDNLGNII 281

>KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {ON}
           Anc_6.19 YOR006C
          Length = 307

 Score =  376 bits (966), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 186/280 (66%), Positives = 214/280 (76%), Gaps = 13/280 (4%)

Query: 1   MSKGKNKNR---EAXXXXXXXXXXXXXXRQNHKRMEMKR--GTEDTKFPVKLAMWDFDHC 55
           M+KGK KN+   +               R NHKRME+++  G + TKFPVK+AMWDFDHC
Sbjct: 1   MAKGKGKNKSRGDETSRGSHKGSNGHSSRLNHKRMELRQHDGVKGTKFPVKMAMWDFDHC 60

Query: 56  DPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWAR 115
           DPKRCSGKKLERLGLI SL+VGQKFQGIVVSPNG GVVCPDD++IVEE GASVVECSWAR
Sbjct: 61  DPKRCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWAR 120

Query: 116 LDEVPFNKIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSHF 175
           LDEVPFN+IGGKHERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGRMD AS+LLS+F
Sbjct: 121 LDEVPFNRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNF 180

Query: 176 SWGLGFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGNVN 235
           SWGLGFLELN+ELLE+YQ+CTD +SVK AE  WL KI++E ++RK++A+D DIWM GNVN
Sbjct: 181 SWGLGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNVN 240

Query: 236 RKGTTFLXXXXXXXXXXXXXXXXXXXXGKTLRYDRLGNLI 275
           R                            ++RYD LGN I
Sbjct: 241 RNMNKMTLSDEESDEEETEA--------SSIRYDNLGNAI 272

>KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 314

 Score =  375 bits (962), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 189/276 (68%), Positives = 210/276 (76%), Gaps = 3/276 (1%)

Query: 1   MSKGKNKNREAXXXXXXXXXXXXXXRQNHKRMEMKR-GTEDTKFPVKLAMWDFDHCDPKR 59
           M KGKNK   +              R NHKRMEMK   +  +KFPVKLAMWDFDHCDPKR
Sbjct: 1   MGKGKNK-ESSTRPRSQKGSNGHSSRLNHKRMEMKHVDSTTSKFPVKLAMWDFDHCDPKR 59

Query: 60  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWARLDEV 119
           CSGKKLERLGLIKSLRVGQKFQG+VVSPNG  VVCPDDK++VEE+GASVVECSWARLDEV
Sbjct: 60  CSGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARLDEV 119

Query: 120 PFNKIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSHFSWGL 179
           PFNKIGGK+ERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGR D A++LLS+FSWG 
Sbjct: 120 PFNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNFSWGP 179

Query: 180 GFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGNVNRKGT 239
            FLELN+ELL+IYQQCTD DSVKAAE  WL KI++E  ERK QAK EDIWM GNVNR  +
Sbjct: 180 AFLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVNR-AS 238

Query: 240 TFLXXXXXXXXXXXXXXXXXXXXGKTLRYDRLGNLI 275
             L                     + ++YD LGN+I
Sbjct: 239 RDLPGSSGEEEEEDYLNGDSLIDVRDIKYDSLGNVI 274

>ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR006C
          Length = 313

 Score =  372 bits (956), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 175/242 (72%), Positives = 197/242 (81%), Gaps = 2/242 (0%)

Query: 1   MSKGKNKNREAXXXXXXXXXXXXXXRQNHKRMEMKRG-TEDTKFPVKLAMWDFDHCDPKR 59
           M+KGKNK  E               + N +R E+K G T++T+FP KLAMWDFDHCDPKR
Sbjct: 1   MAKGKNKKTE-ERQKPAKGSSKHNGKSNQRRTELKHGHTKETEFPAKLAMWDFDHCDPKR 59

Query: 60  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWARLDEV 119
           CSGKKLERLGLIKSLR+GQKFQGIVVSPNG  VVCP+DK IVE+HG SVVECSWARLDE+
Sbjct: 60  CSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEI 119

Query: 120 PFNKIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSHFSWGL 179
           PF+KIGG+HERLLPYLVAANQVNYGRPW+LNCVEA+AACFAIVGR D A ELLSHFSWG 
Sbjct: 120 PFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGP 179

Query: 180 GFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGNVNRKGT 239
           GFLELNQELLE YQQCTD  S+KAAE AWL K+++E E+R+ Q  +EDIWM GNVNRK  
Sbjct: 180 GFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRKAP 239

Query: 240 TF 241
             
Sbjct: 240 NM 241

>Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii ACR007W
          Length = 349

 Score =  362 bits (928), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 168/238 (70%), Positives = 192/238 (80%), Gaps = 1/238 (0%)

Query: 4   GKNKNREAXXXXXXXXXXXXXXRQNHKRMEMK-RGTEDTKFPVKLAMWDFDHCDPKRCSG 62
           GK +N++               R NH+R+E K    + +KFPV LAMWDFDHCDPKRCSG
Sbjct: 2   GKGRNKDYDKNHSQKGSNGHSSRTNHRRIETKYNAIQGSKFPVTLAMWDFDHCDPKRCSG 61

Query: 63  KKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWARLDEVPFN 122
           KKLERLGLIKSLRV QKFQGIVVSPNG  VVCP+D+ I E++G SVVECSWARL+E+PF 
Sbjct: 62  KKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARLEEIPFE 121

Query: 123 KIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSHFSWGLGFL 182
           KIGG+HERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGRMD A  LLSHFSWGLGFL
Sbjct: 122 KIGGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFSWGLGFL 181

Query: 183 ELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGNVNRKGTT 240
           ELN+E+LEIYQ+CTD DS+KAAE AWL +I+ E  ER+ Q K+ DIWM GNVNRK  +
Sbjct: 182 ELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNRKNAS 239

>KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} similar
           to uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 346

 Score =  355 bits (912), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 169/237 (71%), Positives = 195/237 (82%), Gaps = 7/237 (2%)

Query: 3   KGKNKNREAXXXXXXXXXXXXXXRQNHKRMEMKRGTEDT--KFPVKLAMWDFDHCDPKRC 60
           KG NK R A                 H+ +E K G   +   FPVKLAMWDFD CDPKRC
Sbjct: 8   KGSNKQRGAHSSKPSSGHT-----STHRHVESKHGANKSGKNFPVKLAMWDFDQCDPKRC 62

Query: 61  SGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWARLDEVP 120
           SGKKLERLG+IKSLRVGQKFQGIVVSPNG  VVCP+D++IVEE+GA+VVECSWARLDEVP
Sbjct: 63  SGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARLDEVP 122

Query: 121 FNKIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSHFSWGLG 180
           FNKIGG++ERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGR+D A+ELLSHFSWGL 
Sbjct: 123 FNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFSWGLQ 182

Query: 181 FLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGNVNRK 237
           FLELN+ELLE+YQ+CTDADS+K AE AWL +I+KE +ERK++   +D+W+TGNVN K
Sbjct: 183 FLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVNHK 239

>Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {ON}
           YOR006C - Hypothetical ORF [contig 185] FULL
          Length = 337

 Score =  355 bits (910), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 162/214 (75%), Positives = 190/214 (88%), Gaps = 2/214 (0%)

Query: 26  RQNHKRMEMKRGTEDT--KFPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVGQKFQGI 83
           R +   +E K G  +    FPVKLAMWDFD CDPKRCSGKKLERLG+IKSLRVGQKFQGI
Sbjct: 21  RSSSGYVETKHGAHNNGRNFPVKLAMWDFDQCDPKRCSGKKLERLGIIKSLRVGQKFQGI 80

Query: 84  VVSPNGSGVVCPDDKSIVEEHGASVVECSWARLDEVPFNKIGGKHERLLPYLVAANQVNY 143
           VVSPNG GVVCP+DK IVEE GA+VVECSWARL+E+PFNKIGG++ERLLPYLVAANQVNY
Sbjct: 81  VVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNKIGGRNERLLPYLVAANQVNY 140

Query: 144 GRPWKLNCVEALAACFAIVGRMDWASELLSHFSWGLGFLELNQELLEIYQQCTDADSVKA 203
           GRPW+LNCVEALAACFAIVGRMD A+ELL+HFSWGLGFLELN+EL+E+YQ+CTDA+SVK 
Sbjct: 141 GRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLELNKELIEVYQKCTDAESVKE 200

Query: 204 AESAWLVKIQKEVEERKSQAKDEDIWMTGNVNRK 237
           AE++WL KI++E  ER++ +  +D+WMTGNVNR+
Sbjct: 201 AEASWLEKIEREANERRNHSATDDLWMTGNVNRR 234

>NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON}
           Anc_6.19 YOR006C
          Length = 323

 Score =  340 bits (871), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 168/287 (58%), Positives = 204/287 (71%), Gaps = 12/287 (4%)

Query: 1   MSKGKNKNREAXXXXXXXX--XXXXXXRQNHKRMEMKRG-TEDT----KFPVKLAMWDFD 53
           M KGKNK R+                 R NHK MEM++   EDT    K PVKL MWDFD
Sbjct: 1   MGKGKNKKRDDGDSKGRQHRGANGHSSRHNHKNMEMRKHENEDTSNVKKIPVKLGMWDFD 60

Query: 54  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSW 113
           HCDPKRCSGKKLERLGLIKSL++GQ+FQG+++SPNG  VV P+D  I++E GA+VVECSW
Sbjct: 61  HCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPEDADIIKEFGAAVVECSW 120

Query: 114 ARLDEVPFNKI----GGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWAS 169
           ARLDE+PF+K+    GGK+ERLLPYLVAANQVNYGRPWKLNCVEALAACFAI+GR DWA+
Sbjct: 121 ARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALAACFAIIGRSDWAA 180

Query: 170 ELLSHFSWGLGFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIW 229
           +LLS+FSWG+ FL LN+EL E+Y QCTD+DS++ A+ AWL KI +E +ERK QA+D DIW
Sbjct: 181 DLLSNFSWGMNFLTLNEELFELYSQCTDSDSIQEAQEAWLNKIDEEAKERKLQAQDNDIW 240

Query: 230 MTGNVNRKGTTFLXXXXXXXXXXXXXXXXXXXXG-KTLRYDRLGNLI 275
           + GN NR                            K+++YD LGN+I
Sbjct: 241 LMGNTNRVNDNLRDLTLSDGDEDEEEEDAEDYLTEKSVKYDNLGNVI 287

>NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {ON}
           Anc_6.19 YOR006C
          Length = 401

 Score =  340 bits (872), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 173/307 (56%), Positives = 205/307 (66%), Gaps = 32/307 (10%)

Query: 1   MSKGKNKNRE--AXXXXXXXXXXXXXXRQNHKRMEMKRGTEDT----------------- 41
           M KGKNK+R+                 R NHK MEMK+  + T                 
Sbjct: 45  MGKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHS 104

Query: 42  --KFPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKS 99
             K PVKL MWDFDHCDPKRCSGKKLERLGLIKSL++GQ+FQG+++SPNG  VV PDD  
Sbjct: 105 VKKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDAD 164

Query: 100 IVEEHGASVVECSWARLDEVPFNKI----GGKHERLLPYLVAANQVNYGRPWKLNCVEAL 155
           I++E GA+VVECSWARLDE+PF+K+    GGK+ERLLPYLVAANQVNYGRPWKLNCVEAL
Sbjct: 165 IIKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEAL 224

Query: 156 AACFAIVGRMDWASELLSHFSWGLGFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKE 215
           AACFAI+GR DWAS+LLS+FSWGL FL+LN+EL E+Y +CTD+DSVKAA+  WL KI++E
Sbjct: 225 AACFAIIGRSDWASDLLSNFSWGLNFLKLNEELFELYSKCTDSDSVKAAQEEWLDKIEQE 284

Query: 216 VEERKSQAKDEDIWMTGNVNR-------KGTTFLXXXXXXXXXXXXXXXXXXXXGKTLRY 268
             ERK QA++ DIWM GN NR          +                       K LRY
Sbjct: 285 ATERKLQAQETDIWMMGNTNRLDANLRSMNISDEDEEEEEEYDEEEDGGEHITRNKELRY 344

Query: 269 DRLGNLI 275
           D LGN+I
Sbjct: 345 DNLGNVI 351

>KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}
           Anc_6.19 YOR006C
          Length = 329

 Score =  319 bits (818), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 156/258 (60%), Positives = 191/258 (74%), Gaps = 8/258 (3%)

Query: 26  RQNHKRMEMKRG-TEDTKFPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVGQKFQGIV 84
           R N+K+ME K+  + +T FPVKLAMWDFDHCDPKRCSGKKLERL LI+SL++ QKFQGI 
Sbjct: 29  RHNNKKMEFKQHVSRETSFPVKLAMWDFDHCDPKRCSGKKLERLNLIRSLKINQKFQGIT 88

Query: 85  VSPNGSGVVCPDDKSIVEEHGASVVECSWARLDEVPFNKIGG-KHERLLPYLVAANQVNY 143
           VSPNG   V P+D+ +V E G +VVECSWAR+DE+PF+K    K +RLLPYLVAANQVNY
Sbjct: 89  VSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDRLLPYLVAANQVNY 148

Query: 144 GRPWKLNCVEALAACFAIVGRMDWASELLSHFSWGLGFLELNQELLEIYQQCTDADSVKA 203
           GRPWKLNCVEA+AAC AIVG MD A ELLSHFSWG+ FL+LN+ELLEIYQQCTD+D ++A
Sbjct: 149 GRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLEIYQQCTDSDEIEA 208

Query: 204 AESAWLVKIQKEVEERKS--QAKDEDIWMTGNVNR----KGTTFLXXXXXXXXXXXXXXX 257
           A+ AW+ +I+KEV+ERK+   A++ DIWM+GNVNR                         
Sbjct: 209 AQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNRIDESDEDNEDEDSEDEEVTYDNLGN 268

Query: 258 XXXXXGKTLRYDRLGNLI 275
                 + +RYD LGN+I
Sbjct: 269 IIENEPREVRYDNLGNII 286

>TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {ON}
           Anc_6.19 YOR006C
          Length = 304

 Score =  299 bits (766), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 152/277 (54%), Positives = 180/277 (64%), Gaps = 12/277 (4%)

Query: 1   MSKGKNKNREAXXXXXXXXXXXXXXRQNHKRMEMKRGTEDTKFPVKLAMWDFDHCDPKRC 60
           M+KGKNK  E               R+N  +  +   +  T FPVKLAMWDFDHCDPKRC
Sbjct: 1   MAKGKNKGHE-----ERSNRKSNNSRRNESKHSLSIKSTKTNFPVKLAMWDFDHCDPKRC 55

Query: 61  SGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWARLDEVP 120
           SGKKLER GL +SLRVGQ+F G+VVSPNG  VV P D+  +E++G +VVECSWARLDEVP
Sbjct: 56  SGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETIEQYGIAVVECSWARLDEVP 115

Query: 121 FNKIGGK--HERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSHFSWG 178
           FNK+GGK  +E LLPYLVAAN VNYGRPW+LNCVEA AAC AIVG  ++AS++L  FSWG
Sbjct: 116 FNKLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAFAACLAIVGFKEYASKVLEGFSWG 175

Query: 179 LGFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGNVNRKG 238
             FLELN ELL+IY  CTD+ SV+ A+  WL KI+ E +ERK +    D W+ GN NRK 
Sbjct: 176 HAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELENKERKEKMNSADAWLIGNTNRKN 235

Query: 239 TTFLXXXXXXXXXXXXXXXXXXXXGKTLRYDRLGNLI 275
                                       RYD LGNLI
Sbjct: 236 LNDFDNSSESTEDNISTVSSADE-----RYDALGNLI 267

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,699,513
Number of extensions: 964175
Number of successful extensions: 2350
Number of sequences better than 10.0: 21
Number of HSP's gapped: 2380
Number of HSP's successfully gapped: 21
Length of query: 301
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 192
Effective length of database: 40,982,805
Effective search space: 7868698560
Effective search space used: 7868698560
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)