Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G044906.20ON1093109356580.0
ZYRO0C07810g6.20ON1099109424710.0
Sklu_YGOB_Anc_6.20b6.20ON1088110621290.0
Smik_13.1576.20ON1090108320780.0
Suva_13.1606.20ON1090109520580.0
Skud_13.1526.20ON1090109120580.0
Sklu_YGOB_Anc_6.20singletonOFF84985018190.0
ACR006C6.20ON1071109116730.0
Ecym_30246.20ON1079108815800.0
CAGL0L07634g6.20ON1130111515810.0
Kwal_56.224246.20ON1089109615700.0
Kpol_1037.256.20ON1105110515660.0
KLTH0C11242g6.20ON1097110315450.0
YML002W6.20ON73772714250.0
KLLA0D01133g6.20ON1067110114440.0
NCAS0H008206.20ON1146114114401e-180
TPHA0J003306.20ON1107110813931e-173
KNAG0M011606.20ON1131113113101e-161
NDAI0D008006.20ON1193120112211e-148
TBLA0A072606.20ON1204117211601e-139
KAFR0L004006.20ON9428717572e-84
YML003WsingletonOFF2902835747e-66
TBLA0G015506.265ON20688771.1
TDEL0B004508.876ON44456753.2
TDEL0D033903.287ON32378743.4
TBLA0C062908.876ON503124753.7
SAKL0D02882g3.287ON313117726.2
TPHA0C049608.876ON53856727.1
TDEL0A067806.265ON20044707.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G04490
         (1093 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {...  2184   0.0  
ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] ...   956   0.0  
Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1...   824   0.0  
Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML00...   805   0.0  
Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML00...   797   0.0  
Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML00...   797   0.0  
Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF} A...   705   0.0  
ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON} ...   649   0.0  
Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to...   613   0.0  
CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa]...   613   0.0  
Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML00...   609   0.0  
Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON} (56141...   607   0.0  
KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] ...   599   0.0  
YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative p...   553   0.0  
KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some ...   560   0.0  
NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6....   559   e-180
TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.2...   541   e-173
KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6...   509   e-161
NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6....   474   e-148
TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_...   451   e-139
KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20...   296   2e-84
YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative p...   225   7e-66
TBLA0G01550 Chr7 complement(410811..411431) [621 bp, 206 aa] {ON...    34   1.1  
TDEL0B00450 Chr2 (79835..81169) [1335 bp, 444 aa] {ON} Anc_8.876...    33   3.2  
TDEL0D03390 Chr4 complement(631409..632380) [972 bp, 323 aa] {ON...    33   3.4  
TBLA0C06290 Chr3 complement(1521582..1523093) [1512 bp, 503 aa] ...    33   3.7  
SAKL0D02882g Chr4 complement(238458..239399) [942 bp, 313 aa] {O...    32   6.2  
TPHA0C04960 Chr3 (1069045..1070661) [1617 bp, 538 aa] {ON} Anc_8...    32   7.1  
TDEL0A06780 Chr1 complement(1182697..1183299) [603 bp, 200 aa] {...    32   7.5  

>TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {ON}
            Anc_6.20 YML002W
          Length = 1093

 Score = 2184 bits (5658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1059/1093 (96%), Positives = 1059/1093 (96%)

Query: 1    MPYHXXXXXXXXXXAVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSP 60
            MPYH          AVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSP
Sbjct: 1    MPYHLPVLLNPLVNAVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSP 60

Query: 61   LQELCYSYEFVASHVLLIDEQNAEYMTTAPPSQVKFDTLNGKKVIVRSQNRIILTSDGFQ 120
            LQELCYSYEFVASHVLLIDEQNAEYMTTAPPSQVKFDTLNGKKVIVRSQNRIILTSDGFQ
Sbjct: 61   LQELCYSYEFVASHVLLIDEQNAEYMTTAPPSQVKFDTLNGKKVIVRSQNRIILTSDGFQ 120

Query: 121  VKKRCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAESVRTQRVQISQTLGSGKRETKD 180
            VKKRCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAESVRTQRVQISQTLGSGKRETKD
Sbjct: 121  VKKRCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAESVRTQRVQISQTLGSGKRETKD 180

Query: 181  GSSPTLDSSQGSKSSFDNILRIHPDWALKFNELFAEYRSTPEGDDPHIELFHDIIRRAYS 240
            GSSPTLDSSQGSKSSFDNILRIHPDWALKFNELFAEYRSTPEGDDPHIELFHDIIRRAYS
Sbjct: 181  GSSPTLDSSQGSKSSFDNILRIHPDWALKFNELFAEYRSTPEGDDPHIELFHDIIRRAYS 240

Query: 241  AMRSDALFASMPDLSDLIYDYVELNLYDDIWVRITHHFKDSEVESNGLRYLSLHQLETGL 300
            AMRSDALFASMPDLSDLIYDYVELNLYDDIWVRITHHFKDSEVESNGLRYLSLHQLETGL
Sbjct: 241  AMRSDALFASMPDLSDLIYDYVELNLYDDIWVRITHHFKDSEVESNGLRYLSLHQLETGL 300

Query: 301  YPDKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTLRNLSRVDKSIQEV 360
            YPDKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTLRNLSRVDKSIQEV
Sbjct: 301  YPDKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTLRNLSRVDKSIQEV 360

Query: 361  SPVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSITFGVLGYAISTLEAAVC 420
            SPVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSITFGVLGYAISTLEAAVC
Sbjct: 361  SPVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSITFGVLGYAISTLEAAVC 420

Query: 421  YFDELKGSKKMSRLESECENARSLVDKLXXXXXXVNLIHYQKTLSYRTEQGESLLSICIA 480
            YFDELKGSKKMSRLESECENARSLVDKL      VNLIHYQKTLSYRTEQGESLLSICIA
Sbjct: 421  YFDELKGSKKMSRLESECENARSLVDKLSSESSSVNLIHYQKTLSYRTEQGESLLSICIA 480

Query: 481  NGKNDILQELLSDERSFPLEDILEDQTTEGCTLLMQSLKCGNGDAASLIVDLIKSSCTQE 540
            NGKNDILQELLSDERSFPLEDILEDQTTEGCTLLMQSLKCGNGDAASLIVDLIKSSCTQE
Sbjct: 481  NGKNDILQELLSDERSFPLEDILEDQTTEGCTLLMQSLKCGNGDAASLIVDLIKSSCTQE 540

Query: 541  EMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDWDVKDSSGHTALFTIFRSYDQPNYD 600
            EMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDWDVKDSSGHTALFTIFRSYDQPNYD
Sbjct: 541  EMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDWDVKDSSGHTALFTIFRSYDQPNYD 600

Query: 601  DMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLLHILKRSISILLEYESVDVNARNRKG 660
            DMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLLHILKRSISILLEYESVDVNARNRKG
Sbjct: 601  DMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLLHILKRSISILLEYESVDVNARNRKG 660

Query: 661  LTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPLLLCSIDYAKNPLILHEIAKQSAMDTA 720
            LTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPLLLCSIDYAKNPLILHEIAKQSAMDTA
Sbjct: 661  LTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPLLLCSIDYAKNPLILHEIAKQSAMDTA 720

Query: 721  FGKCFVHTLKYESSSWLVNITVQADRKGNFETVEFHLKTVQNFFRTVLRTCPMTFLPLDS 780
            FGKCFVHTLKYESSSWLVNITVQADRKGNFETVEFHLKTVQNFFRTVLRTCPMTFLPLDS
Sbjct: 721  FGKCFVHTLKYESSSWLVNITVQADRKGNFETVEFHLKTVQNFFRTVLRTCPMTFLPLDS 780

Query: 781  TLNQLASLGKARLSSIGKLETVCYLRSLTNCFNVLINSQELPKDILANESKLLSWIKVQY 840
            TLNQLASLGKARLSSIGKLETVCYLRSLTNCFNVLINSQELPKDILANESKLLSWIKVQY
Sbjct: 781  TLNQLASLGKARLSSIGKLETVCYLRSLTNCFNVLINSQELPKDILANESKLLSWIKVQY 840

Query: 841  KAFRNGTTHIFSKKVEPEEMSIIQGFLRFNQAELSTLRSKLHVMKKLAIFLRLKSSDVEQ 900
            KAFRNGTTHIFSKKVEPEEMSIIQGFLRFNQAELSTLRSKLHVMKKLAIFLRLKSSDVEQ
Sbjct: 841  KAFRNGTTHIFSKKVEPEEMSIIQGFLRFNQAELSTLRSKLHVMKKLAIFLRLKSSDVEQ 900

Query: 901  SVELLLPLGSEGMGDLYPLTDHKFSCTTVYGNDSMILLVEDIDLMLKCTIRLYDHINNLL 960
            SVELLLPLGSEGMGDLYPLTDHKFSCTTVYGNDSMILLVEDIDLMLKCTIRLYDHINNLL
Sbjct: 901  SVELLLPLGSEGMGDLYPLTDHKFSCTTVYGNDSMILLVEDIDLMLKCTIRLYDHINNLL 960

Query: 961  QVKIPEWWKLYGELLNFRKQYAQNFPHLVKNGETSTDAXXXXXXXXXXXXXXXXXXSFSI 1020
            QVKIPEWWKLYGELLNFRKQYAQNFPHLVKNGETSTDA                  SFSI
Sbjct: 961  QVKIPEWWKLYGELLNFRKQYAQNFPHLVKNGETSTDAGIIGKILEGKKEKLEKRLSFSI 1020

Query: 1021 AETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAYICRGVIKRWVRENIKELKERLIHIQ 1080
            AETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAYICRGVIKRWVRENIKELKERLIHIQ
Sbjct: 1021 AETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAYICRGVIKRWVRENIKELKERLIHIQ 1080

Query: 1081 RDLRNISGQKLRS 1093
            RDLRNISGQKLRS
Sbjct: 1081 RDLRNISGQKLRS 1093

>ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] {ON}
            similar to uniprot|Q04257 Saccharomyces cerevisiae
            YML003W/YML002W Hypothetical ORF
          Length = 1099

 Score =  956 bits (2471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/1094 (45%), Positives = 713/1094 (65%), Gaps = 21/1094 (1%)

Query: 1    MPYHXXXXXXXXXXAVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSP 60
            M YH          +VFNC NPS S  KKLF  LK  +FILLVPP ++LL   D  SGS 
Sbjct: 1    MAYHIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSS 60

Query: 61   LQELCYSYEFVASHVLLIDEQN-AEYMTTAPPSQVKFDTLNGKKVIVRSQNRIILTSDGF 119
            + +LC +Y+FVASH+LL+ +   ++       SQ ++ TLN K+V VRS +  ILT++GF
Sbjct: 61   MNDLCQNYDFVASHILLLQQDTYSDGGFNLSASQTEYKTLNDKRVAVRSSSGEILTTEGF 120

Query: 120  QVKKRCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAESVRTQRVQISQTLGSGKRETK 179
             +++R  I   +L  NFN+YL    KF ++ ID P+    +R  ++ I + L  G     
Sbjct: 121  PLRRRARIQNVELITNFNDYLNGSEKFALVHIDHPLIGTLIR--KIDIPRGLAQGNFNGV 178

Query: 180  DG-SSPTLDSSQGSKSSFDNILRIHPDWALKFNELFAEYRSTPEGDDPHIELFHDIIRRA 238
            D   S   D +Q S SSF+NILR+HPDW+   N  F  YRSTP  + P+ ELF  I+++ 
Sbjct: 179  DAKGSLVRDLTQKSWSSFENILRLHPDWSNILNGYFNRYRSTPLTEGPYEELFRMIVKQV 238

Query: 239  YSAMRSDALFASMPDLSDLIYDYVELNLYDDIWVRITHHFKDSEVESNGLRYLSLHQLET 298
            ++ M +D LF  +P L DLI+DYVELNL+DD+W+RI + ++  E+++  L++LS+++LET
Sbjct: 239  HAKMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVNSYRKDEIDTEPLKFLSINELET 298

Query: 299  GLYPDKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTLRNLSRV---DK 355
             LY  K+E+F L+ V +ME NI+LA+NSF  LPL H HA+KA  LI+TL++LS     D 
Sbjct: 299  ELYQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLINTLQSLSNTREQDM 358

Query: 356  SIQEVSPVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSITFGVLGYAISTL 415
             IQ + P+ + ADTL+S FVLV+CRTQ++N+K  LFYL+ F+K+E SI FG+LGYAISTL
Sbjct: 359  DIQTL-PITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDENSIKFGILGYAISTL 417

Query: 416  EAAVCYFDELKGSKKMSRLESECENARSL---VDKLXXXXXXVNLIHYQKTLSYRTEQGE 472
            EA V YFD LKG+KK+ +L+ +   A+ L   +         +++  ++  L +RT QGE
Sbjct: 418  EAVVFYFDGLKGTKKLQKLQDDSNKAKELYILISDKSTGQAVLDISQFRSNLEFRTPQGE 477

Query: 473  SLLSICIANGKNDILQELLSD-ERSFPLEDILEDQTTEGCTLLMQSLKCGNGDAASLIVD 531
            S+LS CI N KN +L ELL + E  FPLEDIL+D+T +G TLL+Q+LKC N +AA +IV+
Sbjct: 478  SVLSQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTLLIQALKCDNSEAAQMIVE 537

Query: 532  LIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDWDVKDSSGHTALFTIF 591
            ++++SCT++E+  Y NR+DK++RT AHYLTHE+NILE IG + +W  +DS+GHT LFTIF
Sbjct: 538  VLQNSCTEQELREYVNRADKNRRTVAHYLTHEMNILESIGKYINWKSQDSNGHTPLFTIF 597

Query: 592  RSYDQPNYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLLHILKRSISILLEYESV 651
            R YDQ NY+ MI A+FR A  WY      F F+ HED K NTLLHI+K ++SILL+Y++V
Sbjct: 598  RCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNTLLHIIKNNVSILLDYDNV 657

Query: 652  DVNARNRKGLTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPLLLCSIDYAKNPLILHEI 711
            D+N  N+KGLTPLM+Y +YNR DN K+I+ D+R+IL K+QHP  L S DYA+NPL+L E+
Sbjct: 658  DINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSFLNSFDYARNPLVLKEL 717

Query: 712  AKQSAMDTAFGKCFVHTLKYESSSWLVNITVQ--ADRKGNFETVEFHLKTVQNFFRTVLR 769
              Q+   TAF   FVH LKYE+ SW  +ITV+  A     ++TV+ H+KT+QN F+ +L+
Sbjct: 718  VSQAIKTTAFELAFVHHLKYEAPSWFFHITVKIGAGADEEYKTVKLHIKTLQNLFQVLLK 777

Query: 770  TCPMTFLPLDSTLNQLASLGKARLSSIGKLETVCYLRSLTNCFNVLINSQELPKDILANE 829
                +FLPL+  L  L++L K+R+ SI KLET+ +   LT+CF+VL+    L K +L  E
Sbjct: 778  MHFASFLPLEKALEDLSNLYKSRMPSIAKLETLYFFYMLTDCFDVLLRHDNLNKLVL-RE 836

Query: 830  SKLLSWIKVQYKAFRNGTTHIFSKKVEPEEMSIIQGFLRFNQAELSTLRSKLHVMKKLAI 889
            S+L+SWI+ Q K   N       K VEPEE+ I+  FLRFN+ ELS ++ KL  MKKL I
Sbjct: 837  SRLVSWIRSQDKKCNNSKKLQKQKNVEPEEIGIMASFLRFNRGELSAVKLKLMTMKKLLI 896

Query: 890  FLRLKSSDVEQSVELLLPLGSEG--MGDLYPLTDHKFSCTTVYGNDSMILLVEDIDLMLK 947
            FL+LK++D+  S + L   G+E     D     D + +C   +G ++ +  V +I  +  
Sbjct: 897  FLKLKNTDLTHSYQFLSLFGTEYNLAQDRLLFKDLEINC-CAFGEEATMTFVREIAFLEN 955

Query: 948  CTIRLYDHINNLLQVKIPEWWKLYGELLNFRKQYAQNFPHLVKNGETSTDAXXXXXXXXX 1007
            CT +L D +  LL V IPEWWKLYG++L   K Y Q FP++ +N    +           
Sbjct: 956  CTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFPNISRN---DSGTGIIASFFEG 1012

Query: 1008 XXXXXXXXXSFSIAETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAYICRGVIKRWVRE 1067
                     S  +A+ ++ M + G  I+  HE LAE+LSK+MEFK  +   G+++R VRE
Sbjct: 1013 KREKMESKLSSDLADCKKRMRRVGDRISSTHEILAEELSKYMEFKSNFFINGILRRAVRE 1072

Query: 1068 NIKELKERLIHIQR 1081
            NI  LK RL+ +++
Sbjct: 1073 NINILKGRLVEMRK 1086

>Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1088
            aa] {ON} ANNOTATED BY YGOB -
          Length = 1088

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/1106 (40%), Positives = 667/1106 (60%), Gaps = 38/1106 (3%)

Query: 1    MPYHXXXXXXXXXXAVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSP 60
            MPYH          +VFNCP PSTS LKK+F++L+D++FIL+VP  + LL   D  +GS 
Sbjct: 1    MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS 60

Query: 61   LQELCYSYEFVASHVLLIDEQNAEYMTTAPPSQVKFDTLNGKKVIVRSQNRIILTSDGFQ 120
            LQ+LCY+YEFVA+H++++ +++++Y      S  +F TLNGK V++RSQN I+LT DGF 
Sbjct: 61   LQDLCYTYEFVANHIIIL-KKDSKY------SDQEFKTLNGKTVLIRSQNGIVLTGDGFP 113

Query: 121  VKKRCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAESVRTQRVQISQTLGSGKRETKD 180
             K+RC IT T+LF+NFN+YL     FP++ ID+P+ +++V+   +Q+      G R T  
Sbjct: 114  SKRRCKITNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVF-----GVRSTNT 168

Query: 181  GSSP-TLDSSQGSKSSFDNILRIHPDWALKFNELFAEYR----STPEGDDPHIELFHDII 235
             S P + D +Q   SSF+ + R+HP    +F+ LF E R    +  +G D  ++ F    
Sbjct: 169  SSLPLSTDLTQREVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKFN 228

Query: 236  RRAYSAMRSDALFASMPDLSDLIYDYVELNLYDDIWVRITHHFKDSEVES----NGLRYL 291
              A+  +R +  F +   L   +++YVELNLYDDIW +IT  ++D E+E+    N L+Y+
Sbjct: 229  YEAFELIRHERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYI 288

Query: 292  SLHQLETGLYPDKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTLRNLS 351
            ++ Q+ T  YP+K  +F+LK V   E ++E A + F RL  + +H++K   ++DTL+ L+
Sbjct: 289  AISQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLT 348

Query: 352  RVDK-SIQEVSPVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSITFGVLGY 410
               +    ++  V I ADTL+ L VLV+CR+Q++NLK  LFYLQNF+ +E +I FGV+ Y
Sbjct: 349  DYSEFPDADIEDVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAY 408

Query: 411  AISTLEAAVCYFDELKGSKKMSRLESECENARSLVDKLXXXXXXVN-LIHYQKTLSYRTE 469
            A+STLEA +CYF++ + S K+  LE  C   +   D L       + L  Y+  L  RT 
Sbjct: 409  ALSTLEAVLCYFEDAENSGKIRSLEFNCRRNKQFWDHLSCKAVSFDSLKSYRDILRIRTA 468

Query: 470  QGESLLSICIANGKNDILQELLSD-ERSFPLEDILEDQTTEGCTLLMQSLKCGNGDAASL 528
             GES LS+CI  G    ++ LL + E   PLEDIL+DQT  G TLLMQ+L+ GN   A +
Sbjct: 469  GGESCLSVCIQKGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNTRMADV 528

Query: 529  IVDLIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDWDVKDSSGHTALF 588
            +++++  SCT  E+  Y NR ++ KRTAAHYLT ++ + ++IG FFDW+ KD SGHT LF
Sbjct: 529  LLEILCQSCTINELREYLNRRNRWKRTAAHYLTQDLQMADKIGIFFDWEAKDISGHTPLF 588

Query: 589  TIFRSYDQPNYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLLHILKRSISILLEY 648
             IFRSYD P+Y  M+  +FR A++WY  R   F F+ H+D K NTLLH++K +I ILLE 
Sbjct: 589  AIFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQ 648

Query: 649  ESVDVNARNRKGLTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPLLLCSIDYAKNPLIL 708
            E++DVN  N+KGLTPLMVY KYNRLDN K IL D R+I+ K Q  L L   DY KNP+I 
Sbjct: 649  ENIDVNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVKNPVIQ 708

Query: 709  HEIAKQSAMDTAFGKCFVHTLKYESSSWLVNITVQA-DRKGNFETVEFHLKTVQNFFRTV 767
             E+   +A  T FG+   HT ++E++ W + IT++  DR+ +F+TV+ +++ +Q   +  
Sbjct: 709  AELGFHAAEKTKFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAIQGLLQVY 768

Query: 768  LRTCPMTFLPLDSTLNQLASLGKARLSSIGKLETVCYLRSLTNCFNVLINSQELPKDILA 827
            LR  PM+FLP+D+ L  L  +GK  L S+GKLE   +L  LT    ++   +E  K +  
Sbjct: 769  LRRNPMSFLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEFKKALYL 828

Query: 828  NESKLLSWIKVQYKAFRNGTTHIFSKKVEPEEMSIIQGFLRFNQAELSTLRSKLHVMKKL 887
              S L++WI+   +   N      S+++EPEE++ IQ FLRFN +ELS +R K+ +++KL
Sbjct: 829  PASDLVNWIRESGRKRTN-----VSRRIEPEEINSIQSFLRFNLSELSLIRDKISILQKL 883

Query: 888  AIFLRLKSSDVEQSVELLLPLGSEGMGDLYPLTDHKFSCTTVYGND----SMILLVEDID 943
            +IF  LK+ D+ Q+  +L    S+ +          F  + +   D    S  +L  +ID
Sbjct: 884  SIFSELKAQDINQARCMLF---SQSVRLEDTAISQAFGISGLSEKDSEDLSATILTSNID 940

Query: 944  LMLKCTIRLYDHINNLLQVKIPEWWKLYGELLNFRKQYAQNFPHLVKNGETSTDAXXXXX 1003
             + +CT +L   I+ LLQ K+  WWKLY ELL+ R QY +NFP+ VK      +      
Sbjct: 941  FLKECTNKLVGKIDQLLQGKLTRWWKLYAELLDARNQYNKNFPNSVK-PHLDDNKGLFGT 999

Query: 1004 XXXXXXXXXXXXXSFSIAETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAYICRGVIKR 1063
                         S  I      +      +  +HE+LAE+LS ++EFK  Y+  G+I+ 
Sbjct: 1000 YVEGKRSKLEEKLSAQIKSCLERLQTLTYEVKQEHEALAEELSIYLEFKTNYLRTGIIQD 1059

Query: 1064 WVRENIKELKERLIHIQRDLRNISGQ 1089
            +    I  LK+ + H +R L+N   Q
Sbjct: 1060 FTVGKINTLKDTMRHFKRSLKNYKEQ 1085

>Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  805 bits (2078), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/1083 (39%), Positives = 664/1083 (61%), Gaps = 29/1083 (2%)

Query: 15   AVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSPLQELCYSYEFVASH 74
            A+FNCP P  S LKKLF+ LK  +FILL PP + LL+ +D  +  PL ELCY+ EF+ SH
Sbjct: 16   AIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKLPLHELCYNAEFINSH 75

Query: 75   VLLIDEQNAEYMTTAPPSQVKFDTLNGKKVIVRSQNRIILTSDGFQVKKRCHITKTDLFV 134
            +LL+ E N+   T +  S   ++TL+GK V+++ +N +I   +GFQV++R  I  T +  
Sbjct: 76   ILLMTE-NSFINTNSRDSH--YETLDGKTVVIQWKNNVIHALNGFQVRRRLKILGTKILP 132

Query: 135  NFNEYLLQEYKFPILCIDEPICAESVRTQRVQISQTLGSGKRETKDGSSPTLDSSQGSKS 194
            NFN+Y      F I+ I++P+  ESV    +Q   +     +      + +LDSSQ  +S
Sbjct: 133  NFNDYFEGATDFVIIYIEQPLSCESVPNDYLQCFHSYKKIPKSVYSVHNLSLDSSQQERS 192

Query: 195  SFDNILRIHPDWALKFNELFAEYRSTPEGDDPHIELFHDIIRRAYSAMRSDALFASMPDL 254
            SF+NIL IHP    +  E+F+ YR+    DDP  ++F  I+++A+  M+SD+LF   P+L
Sbjct: 193  SFENILHIHPTRLTQLGEMFSNYRTLAPSDDPSEKIFECIVQQAFEGMKSDSLFKKFPNL 252

Query: 255  SDLIYDYVELNLYDDIWVRITHHFKDSEVESNGLRYLSLHQLETGLYPDKFEEFNLKSVV 314
             DLI++Y ELNLYDDIW R+T HFK  EV +   +Y S++ L    Y   F EF L+ V 
Sbjct: 253  YDLIHEYFELNLYDDIWSRLTSHFKSYEVGTEEYKYFSINHLLADFYSKDFREFKLQDVT 312

Query: 315  SMENNIELAMNSFSRLPLAHAHADKAMYLIDTLRNLS-RVDKSIQEV------SPVAIGA 367
             +E  + LA   F +L L H++ +K+  L++TL+ LS   D    ++      + +A+ A
Sbjct: 313  FIEKRVHLASKHFQKLTLTHSYTEKSKILVETLQELSGTTDMGSHQLDVPGRLNNLAMDA 372

Query: 368  DTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSITFGVLGYAISTLEAAVCYFDELK- 426
            DTL+SLFVLVICR++ ++LK  L+YLQNF+ N +S  FG+LGYA+STLEA VCYF++ K 
Sbjct: 373  DTLISLFVLVICRSEQKHLKSHLYYLQNFSNNSSSSKFGILGYAVSTLEAVVCYFEDFKK 432

Query: 427  GSKKMSRLESECENARSLVDKLX---XXXXXVNLIHYQKTLSYRTEQGESLLSICIANGK 483
             S  M++     +  + LV+ L          NL  Y+  L YR  QG+S+LSICI+N K
Sbjct: 433  NSDNMAKANVLLQKTKRLVNMLSCENVTNKVENLATYKDILPYRNGQGQSILSICISNNK 492

Query: 484  NDILQELLSDERS-FPLEDILEDQTTEGCTLLMQSLKCGNGDAASLIVDLIKSSCTQEEM 542
            N IL ++LS+  S FPLED+LED+T +G TLL++S+K GN +AA +++ ++  +CT+EE+
Sbjct: 493  NHILLDILSEYDSIFPLEDLLEDETIDGSTLLIESIKSGNLEAAKILIRIMMLNCTEEEL 552

Query: 543  FAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDWDVKDSSGHTALFTIFRSYDQPNYDDM 602
             +Y NR+DK  RT AHYLTHEI+IL+ IGN+ DW  K+S G T LF+IFRSYDQPNY+ M
Sbjct: 553  ISYINRTDKYSRTVAHYLTHEIDILKSIGNYVDWKRKNSGGQTPLFSIFRSYDQPNYEAM 612

Query: 603  IRASFRCAAEWYACRMRPFCFTVHEDRKENTLLHILKRSISILLEYESVDVNARNRKGLT 662
            ++ +F  A  WY  + R F +  H D K N LLH+LK   SILL+   +D+N  N KGLT
Sbjct: 613  VKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLHVLKTDASILLQLTKLDINGENYKGLT 672

Query: 663  PLMVYAKYNRLDNTKSILTDKRVILGKIQHPLLLCSIDYAKNPLILHEIAKQSAMDTAFG 722
            PLMVY KY RL+N ++I+ D+R++L KIQ        DYAK+  +L ++ ++ A D+ FG
Sbjct: 673  PLMVYVKYKRLNNIEAIIKDQRLVLEKIQKSTFFTCFDYAKDHTVLSKVGERGAKDSLFG 732

Query: 723  KCFVHTLKYESSSWLVNITVQADRKGNFETVEFHLKTVQNFFRTVLRTCPMTFLPLDSTL 782
              + H+L+Y + +  VNIT  +D +  F     ++KT+Q   R++L+  P TFLPL+  +
Sbjct: 733  LIYFHSLRYHNLNAAVNITFASDTEKPFSNTVINMKTIQGLLRSILKDNPFTFLPLNIYI 792

Query: 783  NQLASLGKARLSSIGKLETVCYLRSLTNCFNVLINSQELPKDILANESKLLSWIKVQY-K 841
            ++++ L ++ ++ IGK + +  L  L+NCFNVL+  +++PK +  +E+ +L W+++   K
Sbjct: 793  DEISQLSRSDVTIIGKADVMSLLHKLSNCFNVLLFLKKVPKSLFTDEASILYWMRINTSK 852

Query: 842  AFRNGTTHIFSKKVEPEEMSIIQGFLRFNQAELSTLRSKLHVMKKLAIFLRLKSSDVEQS 901
              +   +    K +EPEE+++IQ FLRFN  E+S+ ++ L +++K+ IF+ LKS+D +  
Sbjct: 853  RNQKQPSKENYKTMEPEEINMIQSFLRFNFDEISSFKASLSILRKILIFISLKSNDFKDV 912

Query: 902  VELLLPLG----SEGMGDLYP--LTDHKFSCTTVYGNDSMILLVEDIDLMLKCTIRLYDH 955
             + L  +G    +    D +   LT+H      ++ + S+  L+E +  + +CTI+L + 
Sbjct: 913  NDNLNEMGKSIYNAKAADAFAGNLTNH-----NMFNDYSLAKLLEHVRFLEECTIQLSNL 967

Query: 956  INNLLQVKIPEWWKLYGELLNFRKQYAQNFPHLVKNGETSTDAXXXXX--XXXXXXXXXX 1013
            +  +L  KIP WWK YGEL+   K Y + FP +VK   T+  +                 
Sbjct: 968  VQLILLEKIPNWWKHYGELITLHKNYRKAFPSVVKPKSTTDTSGHIQLGGFIETKREQSE 1027

Query: 1014 XXXSFSIAETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAYICRGVIKRWVRENIKELK 1073
               +  I  + +S+ + G+ I   HE LAE+LS +MEF+ A + +  I  +   NI  L+
Sbjct: 1028 QRLAVQIKVSSKSLKELGSEIFVAHEKLAEELSNYMEFRKACLNQRNIVAFAATNISVLQ 1087

Query: 1074 ERL 1076
            E +
Sbjct: 1088 ENI 1090

>Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  797 bits (2058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/1095 (38%), Positives = 668/1095 (61%), Gaps = 33/1095 (3%)

Query: 3    YHXXXXXXXXXXAVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSPLQ 62
            YH          A+FNCP P  S LKKLF+NL+ R+FILL PP   LL+ +D  +  PL 
Sbjct: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKLPLH 63

Query: 63   ELCYSYEFVASHVLLIDEQNAEYMTTAPPSQVKFDTLNGKKVIVRSQNRIILTSDGFQVK 122
            ELCY+ +F+ SH+LL  E +  Y+ T       ++TL+GK V+V+ +N +I T +GF ++
Sbjct: 64   ELCYNADFINSHILLTTENS--YINTTLRDD-HYETLDGKTVVVQWKNNVIHTLNGFPLR 120

Query: 123  KRCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAESVRTQRVQISQTLGSGKRETKDGS 182
            +R  I  T +  NFN+Y      F IL ID+P+  E V    +    +     +  ++  
Sbjct: 121  RRLKILDTKILPNFNDYFKGAEYFAILYIDQPLGCEFVPNDYLHCFNSYEETSKTARNAP 180

Query: 183  SPTLDSSQGSKSSFDNILRIHPDWALKFNELFAEYRSTPEGDDPHIELFHDIIRRAYSAM 242
            +  +D+SQ  +SSF+NIL IHP W  +  +LF+ YR     DDP  ++F +++ +A+  M
Sbjct: 181  NLLMDTSQLERSSFENILHIHPAWLTQLGQLFSNYRRAALNDDPSKKMFEELVEQAFDGM 240

Query: 243  RSDALFASMPDLSDLIYDYVELNLYDDIWVRITHHFKDSEVESNGLRYLSLHQLETGLYP 302
            +SD+LF +  +L DLI+DY ELNLY+DIW R+T HFK  EV +    Y S++QL T  Y 
Sbjct: 241  KSDSLFKNFSNLYDLIHDYFELNLYEDIWSRLTIHFKGYEVNTENCEYFSVNQLLTDYYS 300

Query: 303  DKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTLRNLS--------RVD 354
              FE F L  +  +E  + +A   F +L L+H++A+K+  L++TL++LS        + D
Sbjct: 301  KDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVETLQHLSGTTDMGSHKPD 360

Query: 355  KSIQEVSPVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSITFGVLGYAIST 414
             S    + + + ADTL+SLFVLV+CR++ ++++  L+YLQNF+ N +S  FG+LGYAIST
Sbjct: 361  LS-NGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNFSNNSSSSKFGILGYAIST 419

Query: 415  LEAAVCYFDELKGSKKMSRLESE-CENARSLVDKLX--XXXXXVN-LIHYQKTLSYRTEQ 470
            LEA VCYF+    +       +  C   R L+DKL        VN L  Y+  L+YR EQ
Sbjct: 420  LEAVVCYFENFNKNNNNVAKANLLCIKTRDLLDKLSCENPTNEVNDLATYKDILAYRNEQ 479

Query: 471  GESLLSICIANGKNDILQELLSD-ERSFPLEDILEDQTTEGCTLLMQSLKCGNGDAASLI 529
            G+S+LS+CI N KNDIL ++LS+ E  FP+EDILED+T +G TLL++S+K GN +A  ++
Sbjct: 480  GQSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGSTLLIESIKVGNLEATKIL 539

Query: 530  VDLIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDWDVKDSSGHTALFT 589
            + ++  +CT EE+  Y N++DK  R+ AHYLTHE++IL+ IG++ +W  K+SSG T LF+
Sbjct: 540  IRIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIGSYINWKQKNSSGQTPLFS 599

Query: 590  IFRSYDQPNYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLLHILKRSISILLEYE 649
            IFRSYDQPNY++M++ +F  A+ WY      F ++ H D K N+LLH+LK  +SILL+  
Sbjct: 600  IFRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKGNSLLHVLKTDVSILLQLT 659

Query: 650  SVDVNARNRKGLTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPLLLCSIDYAKNPLILH 709
             +++N  N KGLTPLMVY KY RL N  +I  D R+IL K+Q+       DYAK+ L+L 
Sbjct: 660  KLNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQNSTFFTCFDYAKDRLVLS 719

Query: 710  EIAKQSAMDTAFGKCFVHTLKYESSSWLVNITVQADRKGNFETVEFHLKTVQNFFRTVLR 769
            +I ++ A D+ FG  ++H+L+Y + +  VN+T  +  +  F T   ++KT+Q   R++++
Sbjct: 720  KIGERGANDSIFGLIYLHSLRYHNLNATVNVTSVSKTEEPFVTAVINMKTIQGLLRSIVK 779

Query: 770  TCPMTFLPLDSTLNQLASLGKARLSSIGKLETVCYLRSLTNCFNVLINSQELPKDILANE 829
              P TFLP+D+ ++ ++ L ++ L+ IGK +    L  LTNCFNVL+  +++P+++  +E
Sbjct: 780  DNPFTFLPIDNYIDGISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQNLFTDE 839

Query: 830  SKLLSWIKVQYKAFRN--GTTHIFSKKVEPEEMSIIQGFLRFNQAELSTLRSKLHVMKKL 887
            + +L W+++   + RN    +    K +EPEE+++IQ FLRFN  E+ + ++ L++++K+
Sbjct: 840  ASVLYWMRIN-TSRRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEILSFKASLNILRKI 898

Query: 888  AIFLRLKSSDVEQSVELLLPLGSE----GMGDLYP--LTDHKFSCTTVYGNDSMILLVED 941
             IFL LKSSD E +   LL +G++       D +   + +HK     ++ + S+  L+E 
Sbjct: 899  LIFLSLKSSDFEDAYASLLKMGTKVTNGKAADAFTTIIKNHK-----MFSDLSLDELLEH 953

Query: 942  IDLMLKCTIRLYDHINNLLQVKIPEWWKLYGELLNFRKQYAQNFPHLVKNGETSTDAXXX 1001
            +  + +CTI+L++ I  +L  +IP WWK YGE L   K Y + FP  VK   T+  +   
Sbjct: 954  VQFLEECTIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAVKPKSTAGTSSHI 1013

Query: 1002 XX--XXXXXXXXXXXXXSFSIAETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAYICRG 1059
                             S  I  + + + + G+ I   HE+LAE+LS +MEF+ A + + 
Sbjct: 1014 PLGGFIETKREQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYMEFRKACLDQR 1073

Query: 1060 VIKRWVRENIKELKE 1074
             I  +  +NI  L+E
Sbjct: 1074 TIVAFAIKNISVLQE 1088

>Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  797 bits (2058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/1091 (38%), Positives = 666/1091 (61%), Gaps = 21/1091 (1%)

Query: 3    YHXXXXXXXXXXAVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSPLQ 62
            YH          A+FNCP P  S LKKLF+NLK R+FILL PP   LL+ +D  +  PL 
Sbjct: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKLPLH 63

Query: 63   ELCYSYEFVASHVLLIDEQNAEYMTTAPPSQVKFDTLNGKKVIVRSQNRIILTSDGFQVK 122
            ELCY+ +F+ SH+LL  E N+   TT   S   ++TL+GK V+++ +N II   +GF ++
Sbjct: 64   ELCYNVDFINSHILLTTE-NSYLNTTLRDSH--YETLDGKAVVIQWKNNIIHALNGFPIR 120

Query: 123  KRCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAESVRTQRVQISQTLGSGKRETKDGS 182
            +R  I +T +  NFN+Y      F IL ID+P+  E      ++   +     +  +  S
Sbjct: 121  QRLKILETKVLPNFNDYFEGAADFAILFIDQPLNCEVAPNDYLKCFDSYEEVPKNAQSVS 180

Query: 183  SPTLDSSQGSKSSFDNILRIHPDWALKFNELFAEYRSTPEGDDPHIELFHDIIRRAYSAM 242
            +  ++S +  +SSFDNIL IH     +  +LF+ YR     DDP  ++F DI+++++  M
Sbjct: 181  NLPVNSYEQERSSFDNILHIHSARLAQLGQLFSNYRRLAPNDDPSKKMFEDIVQQSFDGM 240

Query: 243  RSDALFASMPDLSDLIYDYVELNLYDDIWVRITHHFKDSEVESNGLRYLSLHQLETGLYP 302
            +SD+LF +  +L DLI+DY ELNLYDDIW R+  HFK  EV++   +Y S++QL    + 
Sbjct: 241  KSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLVTHFKGYEVDTEKYKYFSVNQLLADFFS 300

Query: 303  DKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTLRNLS---RVDKSIQE 359
              F+EF L  +  +E  + +A   F +L L H++A+K+  L++TL+ LS    +    QE
Sbjct: 301  KDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILVETLQQLSGPTEISSHQQE 360

Query: 360  V----SPVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSITFGVLGYAISTL 415
            +    + + + ADTLLSLFVLV+CR++ ++LK  L+YLQNF+ N +S  FG+LGYAISTL
Sbjct: 361  LPNGLNSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSSTKFGILGYAISTL 420

Query: 416  EAAVCYFDEL-KGSKKMSRLESECENARSLVDKLXX---XXXXVNLIHYQKTLSYRTEQG 471
            EA VCYF++  K ++ +++     +  R L+DKL          NL  Y+  L YR EQG
Sbjct: 421  EAVVCYFEDFDKNNENLAKANVSYQKTRELLDKLSSENPTNEIENLATYEDNLQYRNEQG 480

Query: 472  ESLLSICIANGKNDILQELLSD-ERSFPLEDILEDQTTEGCTLLMQSLKCGNGDAASLIV 530
            +S+LSICI N KN IL ++L++ E  FP+EDILED+T +G TLL++S+K GN +AA +++
Sbjct: 481  QSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLDGSTLLIESIKTGNIEAAKILI 540

Query: 531  DLIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDWDVKDSSGHTALFTI 590
             ++  +C++ E+ +Y N++DK  RT AHYLTHE++IL+ IG++ DW  K+SSG T LF+I
Sbjct: 541  GIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKSIGSYVDWKRKNSSGQTPLFSI 600

Query: 591  FRSYDQPNYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLLHILKRSISILLEYES 650
            FR+YDQPNY++M++ +F  A  WY      F +  H D K N+LLHILK  +SILL+   
Sbjct: 601  FRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDSKGNSLLHILKSDVSILLQLSK 660

Query: 651  VDVNARNRKGLTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPLLLCSIDYAKNPLILHE 710
            +D+N RN KGLTPLM+Y KY R+ N  +I  D R+IL K+Q+       DYAK+  +L +
Sbjct: 661  LDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEKVQNSTFFTCFDYAKDHSVLSK 720

Query: 711  IAKQSAMDTAFGKCFVHTLKYESSSWLVNITVQADRKGNFETVEFHLKTVQNFFRTVLRT 770
            I ++ A D+ FG  ++H+L+Y + +   NIT  ++    F T   ++KT+Q   R++L+ 
Sbjct: 721  IGERGARDSLFGLVYLHSLRYHNLNATTNITTASNTDKPFLTTVINMKTIQGLLRSILKD 780

Query: 771  CPMTFLPLDSTLNQLASLGKARLSSIGKLETVCYLRSLTNCFNVLINSQELPKDILANES 830
               TFLPL+S +++++ L ++ L+ IGK +    L  LTNCFNVL+  +++P+++  +E+
Sbjct: 781  NQFTFLPLNSYIDEISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQNLFTDEA 840

Query: 831  KLLSWIKVQY-KAFRNGTTHIFSKKVEPEEMSIIQGFLRFNQAELSTLRSKLHVMKKLAI 889
             +L W+++   K  +   +    K +EPEE+++IQ FLRFN  E+S+ ++ L++++K+ I
Sbjct: 841  SVLYWMRINTSKRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKILI 900

Query: 890  FLRLKSSDVEQSVELLLPLGSEGM-GDLYPLTDHKFSCTTVYGNDSMILLVEDIDLMLKC 948
            FL LKS+D E + + L  +G + + G+        F+   ++ + ++  L+E +  + +C
Sbjct: 901  FLSLKSNDFEDTYDSLREMGRKIINGEAADAFARIFTNHNMFSDLALAELLEHVSFLEQC 960

Query: 949  TIRLYDHINNLLQVKIPEWWKLYGELLNFRKQYAQNFPHLVKNGETSTDAXXXX---XXX 1005
            TI+L   +  +L  KI +WWK YGE L  +K Y + FP +VK  +++TD           
Sbjct: 961  TIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVK-PKSATDTPSHIPLGSFI 1019

Query: 1006 XXXXXXXXXXXSFSIAETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAYICRGVIKRWV 1065
                       +  I  + + + + G+ I   HE LAE+LS +MEF+ A + +  I  + 
Sbjct: 1020 ETKREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNYMEFRKACLDQRTIVAFA 1079

Query: 1066 RENIKELKERL 1076
              NI   +E +
Sbjct: 1080 TTNIGIFQEYI 1090

>Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF}
           ANNOTATED BY YGOB -
          Length = 849

 Score =  705 bits (1819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/850 (43%), Positives = 539/850 (63%), Gaps = 25/850 (2%)

Query: 1   MPYHXXXXXXXXXXAVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSP 60
           MPYH          +VFNCP PSTS LKK+F++L+D++FIL+VP  + LL   D  +GS 
Sbjct: 1   MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS 60

Query: 61  LQELCYSYEFVASHVLLIDEQNAEYMTTAPPSQVKFDTLNGKKVIVRSQNRIILTSDGFQ 120
           LQ+LCY+YEFVA+H++++ +++++Y      S  +F TLNGK V++RSQN I+LT DGF 
Sbjct: 61  LQDLCYTYEFVANHIIIL-KKDSKY------SDQEFKTLNGKTVLIRSQNGIVLTGDGFP 113

Query: 121 VKKRCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAESVRTQRVQISQTLGSGKRETKD 180
            K+RC IT T+LF+NFN+YL     FP++ ID+P+ +++V+   +Q+      G R T  
Sbjct: 114 SKRRCKITNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVF-----GVRSTNT 168

Query: 181 GSSP-TLDSSQGSKSSFDNILRIHPDWALKFNELFAEYR----STPEGDDPHIELFHDII 235
            S P + D +Q   SSF+ + R+HP    +F+ LF E R    +  +G D  ++ F    
Sbjct: 169 SSLPLSTDLTQREVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKFN 228

Query: 236 RRAYSAMRSDALFASMPDLSDLIYDYVELNLYDDIWVRITHHFKDSEVES----NGLRYL 291
             A+  +R +  F +   L   +++YVELNLYDDIW +IT  ++D E+E+    N L+Y+
Sbjct: 229 YEAFELIRHERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYI 288

Query: 292 SLHQLETGLYPDKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTLRNLS 351
           ++ Q+ T  YP+K  +F+LK V   E ++E A + F RL  + +H++K   ++DTL+ L+
Sbjct: 289 AISQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLT 348

Query: 352 RVDK-SIQEVSPVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSITFGVLGY 410
              +    ++  V I ADTL+ L VLV+CR+Q++NLK  LFYLQNF+ +E +I FGV+ Y
Sbjct: 349 DYSEFPDADIEDVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAY 408

Query: 411 AISTLEAAVCYFDELKGSKKMSRLESECENARSLVDKLXXXXXXVN-LIHYQKTLSYRTE 469
           A+STLEA +CYF++ + S K+  LE  C   +   D L       + L  Y+  L  RT 
Sbjct: 409 ALSTLEAVLCYFEDAENSGKIRSLEFNCRRNKQFWDHLSCKAVSFDSLKSYRDILRIRTA 468

Query: 470 QGESLLSICIANGKNDILQELLSD-ERSFPLEDILEDQTTEGCTLLMQSLKCGNGDAASL 528
            GES LS+CI  G    ++ LL + E   PLEDIL+DQT  G TLLMQ+L+ GN   A +
Sbjct: 469 GGESCLSVCIQKGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNTRMADV 528

Query: 529 IVDLIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDWDVKDSSGHTALF 588
           +++++  SCT  E+  Y NR ++ KRTAAHYLT ++ + ++IG FFDW+ KD SGHT LF
Sbjct: 529 LLEILCQSCTINELREYLNRRNRWKRTAAHYLTQDLQMADKIGIFFDWEAKDISGHTPLF 588

Query: 589 TIFRSYDQPNYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLLHILKRSISILLEY 648
            IFRSYD P+Y  M+  +FR A++WY  R   F F+ H+D K NTLLH++K +I ILLE 
Sbjct: 589 AIFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQ 648

Query: 649 ESVDVNARNRKGLTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPLLLCSIDYAKNPLIL 708
           E++DVN  N+KGLTPLMVY KYNRLDN K IL D R+I+ K Q  L L   DY KNP+I 
Sbjct: 649 ENIDVNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVKNPVIQ 708

Query: 709 HEIAKQSAMDTAFGKCFVHTLKYESSSWLVNITVQA-DRKGNFETVEFHLKTVQNFFRTV 767
            E+   +A  T FG+   HT ++E++ W + IT++  DR+ +F+TV+ +++ +Q   +  
Sbjct: 709 AELGFHAAEKTKFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAIQGLLQVY 768

Query: 768 LRTCPMTFLPLDSTLNQLASLGKARLSSIGKLETVCYLRSLTNCFNVLINSQELPKDILA 827
           LR  PM+FLP+D+ L  L  +GK  L S+GKLE   +L  LT    ++   +E  K +  
Sbjct: 769 LRRNPMSFLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEFKKALYL 828

Query: 828 NESKLLSWIK 837
             S L++WI+
Sbjct: 829 PASDLVNWIR 838

>ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YML002W and
            YML003W; YML002W and YML003W represent one ORF in this
            genome
          Length = 1071

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/1091 (35%), Positives = 596/1091 (54%), Gaps = 36/1091 (3%)

Query: 1    MPYHXXXXXXXXXXAVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSP 60
            MPYH          AVFNCP P  S LKKLF+N KD+KFIL+VP  + LL   D  +  P
Sbjct: 1    MPYHLPVLLNPLVNAVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVP 60

Query: 61   LQELCYSYEFVASHVLLIDEQNAEYMTTAPPSQVKFDTLNGKKVIVRSQNRIILTSDGFQ 120
            L ELCY+YEFVASH L+        +  A  ++++F T+NGK V++R Q+ II       
Sbjct: 61   LTELCYNYEFVASHTLV-------QLQEARVTELEFQTINGKSVVIRPQSGIITAQPS-- 111

Query: 121  VKKRCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAESVRTQRVQISQTLGSGKRETKD 180
              K+C I + +L  +FN+YLL    F +L ID P+  E      +++   L     + + 
Sbjct: 112  -AKKCRIQRCELLRSFNDYLLGRTAFALLYIDRPLVGE------IELITPLRVFGPQEQP 164

Query: 181  GSSPTLDSSQGSKSSFDNILRIHPDWALKFNELFAE----YRSTPEGDDPHIELFHDIIR 236
                 +  +  +    +  LR+HP    + +E+F +     R         + LFH+++ 
Sbjct: 165  LQYQRITQTADAPLPLEQFLRLHPQLGNQLDEVFKDAKERMRYIALSLKELVRLFHELVE 224

Query: 237  RAYSAMRSDALFASMPDLSDLIYDYVELNLYDDIWVRITH-HFKDSEVESNGL---RYLS 292
            + Y  ++ D  F +  +L +++  YVELN+Y+D+W ++   + K+      G    R +S
Sbjct: 225  KVYCLIKLDKNFRNYLNLLEMVQGYVELNMYEDVWRKLVQLNGKNEPDRVPGYYITRSIS 284

Query: 293  LHQLETGLYPDKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTLRNLSR 352
            L+QL T +YP++ ++FNL  V  +E  +  A   FS+L L ++H +KA  LI T + L+ 
Sbjct: 285  LNQLSTSIYPEELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKARILISTFQKLT- 343

Query: 353  VDKSIQEVSPVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSITFGVLGYAI 412
              K+ Q      I ADTLL L V+V+CR Q++NLK  L YL+ FA+N   + FG+LGY++
Sbjct: 344  -TKTSQATLDPMIDADTLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDVKFGLLGYSL 402

Query: 413  STLEAAVCYFDELKGSKKMSRLESECENARSLVDKLXXXXXXVNLIHYQKTLSYRTEQGE 472
            STLEA V YFD    S K+ RL ++C+  +   + L      +NL  +++ L  RT   E
Sbjct: 403  STLEAVVGYFDIGGSSIKLERLITQCQRNKIFWN-LIEQGIPINLKEHEEVLISRTPSCE 461

Query: 473  SLLSICIANGKNDILQELLSDERS-FPLEDILEDQTTEGCTLLMQSLKCGNGDAASLIVD 531
            S+LS+CI  G+ D+  +++++ +S F LEDIL+D     C+LL+Q+L+ GN D    ++D
Sbjct: 462  SVLSLCIQYGRQDVFYDIIANYQSHFTLEDILQDVNQSNCSLLIQALQAGNKDITEAVID 521

Query: 532  LIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDWDVKDSSGHTALFTIF 591
            L+ ++CT  EM+AY N+ D   RT  HYL     I++++G F DW  KD + HT LFT+ 
Sbjct: 522  LLIANCTNTEMYAYINKCDIAGRTVGHYLPQNYEIVDRLGKFVDWKRKDLNMHTPLFTVC 581

Query: 592  RSYDQPNYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLLHILKRSISILLEYESV 651
            R+YD P+Y +++   F+   ++Y+ R + F F  HED   NTLLHI+K  I + L     
Sbjct: 582  RAYDHPSYLELLSKCFQHCFDFYSTRGKRFSFADHEDPLGNTLLHIIKDGIQLALSTPGA 641

Query: 652  DVNARNRKGLTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPLLLCSIDYAKNPLILHEI 711
            +VN  N +G+TPLMVYAKYNR++N + IL DKR+IL K+Q P  L +IDY KNP+IL+ I
Sbjct: 642  NVNKCNTRGMTPLMVYAKYNRIENIREILNDKRLILSKLQDPQSLKAIDYVKNPIILNLI 701

Query: 712  AKQSAMDTAFGKCFVHTLKYESSSWLVNITVQADRKGNFETVEFHLKTVQNFFRTVLRTC 771
                A ++ +G   VH +KYE ++W + IT     + +++T  + LK +Q+  +   +  
Sbjct: 702  GTAMAKNSLYGCLSVHNIKYEENAWYLWITSSLSPE-SYKTSSYALKDIQSLLQIYNKKH 760

Query: 772  PMTFLPLDSTLNQLASLGKARLSSIGKLETVCYLRSLTNCFNVLINSQELPKDILANESK 831
            PM+FLP+D  L  L +LGK+ + S+  LE    L +LT   +++   ++        ES+
Sbjct: 761  PMSFLPIDHHLETLKTLGKSGIISVINLENSMLLEALTFSLSIIQQREDYKNVFSYTESE 820

Query: 832  LLSWIKVQYKAFRNGTTHIFSKKVEPEEMSIIQGFLRFNQAELSTLRSKLHVMKKLAIFL 891
            L +W++      +         K+EPEE+  IQ FL+F+  E + LR K  V+KKL IF 
Sbjct: 821  LSTWLRASMVKQKPNK----RDKIEPEEIHSIQNFLKFSLTEFNYLREKFTVLKKLIIFE 876

Query: 892  RLKSSDVEQSVELLLPLGSEGMGDLYPLTDHKFSCTTVYGNDSMILLVEDIDLMLKCTIR 951
              KS D+E S  +L   G E +  + P    + S      ND +    + +D M  C   
Sbjct: 877  HYKSHDIECSQRILYSQG-EIIASVVPSKRLRTSPFDNEFNDGIDPFEQAVDFMCMCLDS 935

Query: 952  LYDHINNLLQVKIPEWWKLYGELLNFRKQYAQNFPHLVK-NGETSTDAXXXXXXXXXXXX 1010
            L   I  +L  K+  WW LYGE+ N +K+Y +NFP   K N  +S D+            
Sbjct: 936  LTSKIVEVLDSKVSTWWTLYGEITNLQKEYQRNFPEKGKPNSASSEDSKGFFVSYMEDKR 995

Query: 1011 XXXXXXSFS-IAETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAYICRGVIKRWVRENI 1069
                    S ++    ++    A + H HE LAE++S F+  K       ++K +V   I
Sbjct: 996  QKLESKLQSRLSVCSENLQHLDAELKHCHELLAEEISFFISSKNFAYMNFMVKAYVNRRI 1055

Query: 1070 KELKERLIHIQ 1080
            K+ K  L+ I+
Sbjct: 1056 KQHKNMLLAIE 1066

>Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to
            Ashbya gossypii ACR006C
          Length = 1079

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/1088 (34%), Positives = 593/1088 (54%), Gaps = 49/1088 (4%)

Query: 1    MPYHXXXXXXXXXXAVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSP 60
            MPYH          AVFNCP P+TS LKKLF+N+K ++FILLVP  D LL   D  SG P
Sbjct: 1    MPYHLPVLLNPLVNAVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLP 60

Query: 61   LQELCYSYEFVASHVLLIDEQNAEYMTTAPPSQVKFDTLNGKKVIVRSQNRIILTSDGFQ 120
            L ELCY+Y+FVASH+L+        +  +  ++ ++ TLNG  VI+RSQ  I+++     
Sbjct: 61   LSELCYNYDFVASHILI-------QLQESKVTEQEYRTLNGNSVIIRSQAGIVMSKPEL- 112

Query: 121  VKKRCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAESVRTQRVQISQTLGSGKRETKD 180
              ++C +   ++  NFN+YL     FP+L ID P+    VR   +Q+      G  E  +
Sbjct: 113  --RKCRVKSYEVLRNFNDYLSNVIYFPLLHIDRPLVGALVRNDELQVF-----GSYEMHN 165

Query: 181  GS-SPTLDSSQGSKSSFDNILRIHPDWALKFNELFAEYRSTPEGD----DPHIELFHDII 235
             S S T+++   +   F+  +R++P    + +  F   R     +    D  I++F D++
Sbjct: 166  PSKSKTINTISENHIPFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQLDKLIKIFKDLV 225

Query: 236  RRAYSAMRSDALFASMPDLSDLIYDYVELNLYDDIWVRITHHFKDSEVES----NGLRYL 291
               Y  ++ D  F +  +L ++  +YVELN+Y+DIW+++       E +     +  +Y+
Sbjct: 226  IDVYGVIKEDKNFRNYMELLNVTQEYVELNMYEDIWLKLVQLNGSKEPDRVSGYSSTKYI 285

Query: 292  SLHQLETGLYPDKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTLRNLS 351
            SL+ + T LYP+    F+L+ V  +E  +  A + F++L L ++H +KA  ++ T + L+
Sbjct: 286  SLNNVATILYPEGTNSFDLRVVTEVEKRVVKATDCFAKLSLTNSHNEKAKIVVSTFQILT 345

Query: 352  RVDKSIQEVSPVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSITFGVLGYA 411
                    + P  I ADTL+ L ++V+CR+Q++NLK  L YL+ FA     + FG+ GY+
Sbjct: 346  -TKMEYTSIDP-TIDADTLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDDVKFGLTGYS 403

Query: 412  ISTLEAAVCYFDELKGSKKMSRLESECENARSLVDKLXXXXXXVNLIHYQKTLSYRTEQG 471
            +ST+EA + YF+   G++K+ +L S  E  R   D L      V+L  Y+ +L  R+   
Sbjct: 404  LSTIEAVLAYFEAGDGTEKLKKLISLSEANRVFWD-LIRSGVAVSLSSYKNSLISRSSNC 462

Query: 472  ESLLSICIANGKNDILQE-LLSDERSFPLEDILEDQTTEGCTLLMQSLKCGNGDAASLIV 530
            ES LSICI  G+ D+++E LL+ +    LED+L D      TLL+Q+L+ G+ + A L++
Sbjct: 463  ESSLSICIHAGRLDLIKEILLNYQEQIKLEDLLFDVNQANSTLLIQALETGHDEIAELLI 522

Query: 531  DLIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDWDVKDSSGHTALFTI 590
            D++ S+CT  E + Y NRS+   RT AHYL    +I+E+IG + DW  KD + HT LF I
Sbjct: 523  DVMISNCTNNEFYEYVNRSNSAGRTVAHYLPQAFSIIEKIGLYLDWRKKDVNMHTPLFII 582

Query: 591  FRSYDQPNYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLLHILKRSISILLEYES 650
             R+YDQ +Y +M+  SF    E+   R   F FT HED   N+LLHI+K  I  +L   +
Sbjct: 583  CRAYDQLHYSEMLSRSFEYVFEYCRRRGEDFSFTDHEDPMGNSLLHIMKGGIQSILSQPN 642

Query: 651  VDVNARNRKGLTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPLLLCSIDYAKNPLILHE 710
            ++VN  N KG+TPLM+YAKYNR++N + IL DKR+I+ KIQ+P  L +IDY KNP+IL+ 
Sbjct: 643  INVNKSNIKGMTPLMLYAKYNRIENIRDILEDKRLIVSKIQNPQTLKAIDYVKNPMILNL 702

Query: 711  IAKQSAMDTAFGKCFVHTLKYESSSWLVNITVQADRKGNFETVEFHLKTVQNFFRTVLRT 770
            I    A ++ +G      +K+E + W + ITV+     ++ T+   +K +Q   +   + 
Sbjct: 703  IGTHIAKNSLYGLLSADGIKFEDNCWYLWITVKFS-DNSYSTLRQSVKNIQGLLQFYNKK 761

Query: 771  CPMTFLPLDSTLNQLASLGKARLSSIGKLETVCYLRSLTNCFNVLINSQELPKDILANES 830
             PM FLP+D  L+ L ++GK  +  +  LE   +L  LT   +V+    E    +  NES
Sbjct: 762  HPMNFLPIDHILSILKNIGKPGILPVINLENSIFLGLLTQLLSVIGQRNEYMAVLRYNES 821

Query: 831  KLLSWIKVQ-YKAFRNGTTHIFSKKVEPEEMSIIQGFLRFNQAELSTLRSKLHVMKKLAI 889
             L +W++   +K   N       +++EPEE+S IQ FL+FN +E S ++ K  +++KL +
Sbjct: 822  DLSTWLRTNNFKPRANK-----DERIEPEEVSSIQSFLKFNLSEFSEIKEKFTILRKLVV 876

Query: 890  FLRLKSSDVEQSVELL---LPLGSEGMGDLYPLTDHKFSCTTVYGNDSMILLVEDIDLML 946
            F  LK+ D+E +  ++   + + S  +G   P  +  F  +    N S+    + I+ + 
Sbjct: 877  FQSLKAQDIECAQRIIYQQMEIVSNSVG---PSVEKTFIGSN--ENYSLDSFQQAIEFIA 931

Query: 947  KCTIRLYDHINNLLQVKIPEWWKLYGELLNFRKQYAQNFPHLVKN----GETSTDAXXXX 1002
             C   L   I  +L  K+  WW+LYGEL + R++Y +NFP   K+    GE S       
Sbjct: 932  MCLETLSSKIQYVLDSKVTLWWRLYGELSSLRREYQRNFPSDFKSSDVSGEESKGFFESY 991

Query: 1003 XXXXXXXXXXXXXXSFSIAETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAYICRGVIK 1062
                             +  T+  +      +  DHE+LAE++S F+ FK       V+K
Sbjct: 992  IEGKRQKTEDKLQARLRVCITK--LQTLSGELKKDHENLAEEISFFVTFKNFAYESFVMK 1049

Query: 1063 RWVRENIK 1070
             +    IK
Sbjct: 1050 TYANICIK 1057

>CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa] {ON}
            some similarities with uniprot|Q04257 Saccharomyces
            cerevisiae YML002w and some similarities with
            uniprot|Q04257 Saccharomyces cerevisiae YML003w
          Length = 1130

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/1115 (33%), Positives = 603/1115 (54%), Gaps = 65/1115 (5%)

Query: 15   AVFNCPNPSTSNLKKLFSNL-KDRKFILLVPPCDRLLDCNDKLSGSPLQELCYSYEFVAS 73
            A+ NC  P++S LKKL++ L K  K+++LVPP + LL  +DK S S L +LCY+  F ++
Sbjct: 19   AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDKESNSELHDLCYTPNFASA 78

Query: 74   HVLLIDEQNAEYMTTAPPSQVK----------FDTLNGKKVIVRSQNRIILTSD--GFQV 121
            H+LL+D  + E         +K             ++     +  +NR+I   +  G Q+
Sbjct: 79   HILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYEFNKLGDQI 138

Query: 122  KKRCHITKTDLFVNFNEYL-LQEYKFPILCIDEPICAESVRTQ--------RVQISQTLG 172
            K R  I   +    FN Y+   +    I+ ID+     ++           R    +++ 
Sbjct: 139  KNRAKILDIESIPIFNNYMKTTDNTITIMYIDDVFLNGTLECNLRSDIDLLRSPSMRSIP 198

Query: 173  SGKRETKDGSSPTLDSSQGSKSSFDNILRIHPDWALKFNELFAEYRSTPEGDDPHIELFH 232
            + KR +      T   +  SK++FD+ILR++  W+ KF + F ++R     DD  I++FH
Sbjct: 199  TAKRPSLINKKSTDYENSKSKATFDSILRVNKHWSSKFEQHFQKFRLLANQDDLPIDVFH 258

Query: 233  DIIRRAYSAMRSDALFASMPDLSDLIYDYVELNLYDDIWVRITHHFKDSEVESNGLRYLS 292
            +II   +  M SD LF ++ DL ++IY+YVELNL+DDIW  I    K+ E++ N    +S
Sbjct: 259  NIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMILRMNKEVEIDLNPFGNIS 318

Query: 293  LHQLETGLYPDKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTLRNL-- 350
            ++Q+++     ++ +F L++V++ E NI+ A  S  ++  A  +  KA  LI TLR L  
Sbjct: 319  IYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESASNYKSKANILILTLRTLTG 378

Query: 351  --------SRVDKSIQEVSPVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETS 402
                    S+ D       P+AI AD L++LFVLV CR Q++NLK  L YLQNF  N++ 
Sbjct: 379  NKENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIKNLKCHLSYLQNFYNNDSD 438

Query: 403  ITFGVLGYAISTLEAAVCYFDELKGSKKMSRLESECENARSLVDKLXXXXXXVN------ 456
              FG+LGYA+STLEA VCYF++LK  +   +L   C +   LV  L              
Sbjct: 439  TKFGILGYALSTLEAVVCYFEQLKEKENYRKLIDFCNSNERLVKVLSSTKKYETNAALYF 498

Query: 457  LIHYQKTLSYRTEQGESLLSICIANGKNDILQELLSD-ERSFPLEDILEDQTTEGCTLLM 515
            L  Y+ +L YR   G+SLL++CI +G+ND L  +L++ E  FP+ED+L D++ +G TLL+
Sbjct: 499  LRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNEYETLFPIEDLLADESIDGSTLLI 558

Query: 516  QSLKCGNGDAASLIVDLIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFD 575
            Q++K  N  +ASL+++++K +CT+ E+ AY NR D +KRTA H+LT+E+ +L+ +G + +
Sbjct: 559  QAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAGHFLTNELEVLKLMGKYIN 618

Query: 576  WDVKDSSGHTALFTIFRSYDQPNYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLL 635
            W  KD++G T LFTIFRSYDQ NYD+M+  S   A  WY    + F +  H D+K NTLL
Sbjct: 619  WVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLNGKNFNYLDHVDKKGNTLL 678

Query: 636  HILKRSISILLEYESVDVNARNRKGLTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPLL 695
            HILK ++ ILL  + ++VNA NR G TPLM   +Y R +N + +L D R+ +   Q    
Sbjct: 679  HILKCNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIRDLLCDPRLRVDITQKNNA 738

Query: 696  LCSIDYAKNPLILHEIAKQSAMDTAFGKCFVHTLKYESSSWLVNITVQADRKGNFETVEF 755
            L + D++K+  I H + +   +++ +   + HTLKY +S W +++TV+   K   +T  F
Sbjct: 739  LTAFDFSKDDEITHLLGEHELLNSPWLAVYAHTLKYTNSRWNLSLTVKL--KDAPKTTNF 796

Query: 756  HLKTVQNFFRTVLRTCPMTFLPLDSTLNQLASLGKARLSSIGKLETVCYLRSLTNCFNVL 815
             LKT++   R V++     FLP+   +  L S  + R S + +++ +  L  ++ C + L
Sbjct: 797  TLKTLRGILRVVIKNNMTVFLPVQELVEDLISFNRIRFSELMRIKVLEMLPFISFCLSAL 856

Query: 816  INSQELPKDILANESKLLSWIKVQYKAFRNGTTHIFSKKVEPEEMSIIQGFLRFNQAELS 875
            ++ + L  ++   E   + W+K+     +       +  + PE++S+IQ FL+FN  E+ 
Sbjct: 857  VHIKVLDLNVFQTEENAIKWVKMNGSVDKKTNQ---TSDITPEDISMIQNFLKFNITEIE 913

Query: 876  TLRSKLHVMKKLAIFLRLKSSDVEQSVELLLPLGSEGMGDLYPLTDHKFSCTTVY-GNDS 934
              ++KL + +KL++F RLKS D+  S E  + + S+       L+  +F  T  Y   D+
Sbjct: 914  RTKNKLEIAEKLSLFSRLKSKDLLNSNENYVTIVSQ-------LSSKRFRSTLKYSAEDT 966

Query: 935  MIL-------LVEDIDLMLKCTIRLYDHINNLLQVKIPEWWKLYGELLNFRKQYAQNFPH 987
             +L       L+  I  +  C  +L++HI ++    I  WW +YGELLN  K Y + FP 
Sbjct: 967  KLLSVRAEKALLSKITYLKICAQKLHNHILSITTTMISNWWHIYGELLNAHKHYTRAFPE 1026

Query: 988  LVKNGETSTDAXXXXXXXXXXXXXXXXXXSFSIAETRRSMNQAGAIIAHDHESLAEQLSK 1047
            L      + D                   S  I +    +N  G  I   HE  AE++S+
Sbjct: 1027 LANVTTENRDLALHRMISNPKRIKLEERLSEKIKDITEQLNSVGHDIKQMHELAAEEVSR 1086

Query: 1048 FMEFKGAYICRGVIKRWVRENIKELKERLIHIQRD 1082
            F++ K  +     ++ ++  + +E      HI++D
Sbjct: 1087 FIDLKTKFTLEYALQSYLTISKQE------HIEKD 1115

>Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML002W -
            Hypothetical ORF [contig 185] FULL
          Length = 1089

 Score =  609 bits (1570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/1096 (33%), Positives = 605/1096 (55%), Gaps = 45/1096 (4%)

Query: 1    MPYHXXXXXXXXXXAVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSP 60
            MPY+          AVFNCP P  S+LKK+FS ++  +F+L+ PP + LL+  D  SG P
Sbjct: 1    MPYYLPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLP 60

Query: 61   LQELCYSYEFVASHVLLIDEQNAEYMTTAPPSQVKFDTLNGKKVIVRSQNRIILTSDGFQ 120
            LQ+LCY+  FV+ H++L+D +           + ++ TL+GK +++RSQ  II T+  F 
Sbjct: 61   LQDLCYATGFVSDHIVLLDGREG-------LQEEEYKTLSGKTILLRSQQGIIFTAAAFD 113

Query: 121  VKKRCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAESVRTQRVQISQTLGSGKRETKD 180
             ++RC I + +L  NFNEYL  +  FPI+ +D P+     R    Q  +   +  +E  +
Sbjct: 114  TRRRCRIQRAELLTNFNEYLKGDTTFPIIHVDFPLTGRLARRDEWQCFRV--TKNQEHTN 171

Query: 181  GSSPTLDSSQGSKS-SFDNILRIHPDWALKFNELFAEYR----STPEGDDPHIELFHDII 235
            G   +   S G  + S + +LRI+P++    N++    R    S+  G       F    
Sbjct: 172  GPKNSGKLSHGDNNISLEQLLRINPEYGESLNDIVKAQRISLNSSVTGTTHLASHFVQTC 231

Query: 236  RRAYSAMRSDALFASMPDLSDLIYDYVELNLYDDIWVRITHHFKDSEVESNG----LRYL 291
            ++A   +R+   F  +P+L   +++Y+ELNLYDD W ++T+  +DSE+ES+     L+++
Sbjct: 232  KKALDVVRAYPAFQVLPNLPICVHEYIELNLYDDYWAQLTNSLRDSEIESSSDYSLLKHI 291

Query: 292  SLHQLETGLYPDKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTLRNLS 351
            S+ Q+ + LYP   E+F+L+ +   E N++ A+ SF ++ + + H+ KA  +I+TL+ LS
Sbjct: 292  SVSQVPSFLYPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAKAKVIIETLQTLS 351

Query: 352  RVDKSIQEVSPVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSITFGVLGYA 411
            R    + +   V I ADTL+SLFV+V+C  Q+++L+  LFYLQ F K+   +TFG+L Y 
Sbjct: 352  R--SLLVDDRAVTIDADTLVSLFVVVVCHAQVKDLRSHLFYLQEFTKDTNLVTFGILAYG 409

Query: 412  ISTLEAAVCYFDELKGSKKMSRLESECENARSLVDKLXXXXXXVN---LIHYQKTLSYRT 468
            +STLEA +CYF+     +K++ LE  C    S    +      +N    +     L  RT
Sbjct: 410  MSTLEAVLCYFE---SPEKVASLEKYCRANLSHWKSISEGSIDLNADTTVPLDDLLKIRT 466

Query: 469  EQGESLLSICIANGKNDILQELLSDERS--FPLEDILEDQTTEGCTLLMQSLKCGNGDAA 526
              G+S L++C+ + + +   EL+ + R   FPLED+L D+TT+G  LL+  L+ G    A
Sbjct: 467  SDGQSCLAVCLQHRRTEEF-ELIKNTREAWFPLEDLLHDETTDGSNLLIHMLESGCDRLA 525

Query: 527  SLIVDLIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDWDVKDSSGHTA 586
             ++++ + S+CT++E+ A+ N ++K +R+  HYL H   +++ +G+  +W+ +D +GHT 
Sbjct: 526  VMLINTLISNCTKDELIAFLNHTNKYQRSCGHYLMHAPQLIDLVGDILNWEQRDCNGHTP 585

Query: 587  LFTIFRSYDQPNYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLLHILKRSISILL 646
            LF I R+YD+P+Y DM+ A++R A      R   F  + H D K NTLLH++K  +SILL
Sbjct: 586  LFAIVRAYDRPDYFDMVSAAYRAAVGQSKVRNSRFRVSNHTDDKGNTLLHVIKSDVSILL 645

Query: 647  EYESVDVNARNRKGLTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPLLLCSIDYAKNPL 706
                +DVNA N KGLTPLMVY +YNR+ N ++IL D+R+I+GK Q    L   DY KNP 
Sbjct: 646  ADPFIDVNATNAKGLTPLMVYVRYNRIGNVRTILQDQRLIIGKHQSGAYLSCFDYVKNPA 705

Query: 707  ILHEIAKQSAMDTAFGKCFVHTLKYESSSWLVNITVQ-ADRKGNFETVEFHLKTVQNFFR 765
            +L E+ K ++         VH++K E   W++ ITV   +++   +  +  L+ +Q F  
Sbjct: 706  VLKELGKYASYLPFEFSINVHSVKREGDEWVLWITVTGGEKQVPVKVFKRSLRFIQAFLT 765

Query: 766  TVLRTCPMTFLPLDSTLNQLASLGKARLSSIGKLETVCYLRSLTNCFNVLINSQELPKDI 825
                  PMTF+P+D  L +L +L ++R+  + K++T  +L+  +   + +++ + L  D 
Sbjct: 766  LFSDAHPMTFVPVDELLRELRALSQSRILILNKMDTKRFLKRCSVTLS-MVSQERLFADA 824

Query: 826  LANESKLLSWIKVQYKAFRNGTTHIFSKKVEPEEMSIIQGFLRFNQAELSTLRSKLHVMK 885
               +S L         +  + T ++  K +EPEE+  IQ  L+FN +E+S L++ + +MK
Sbjct: 825  FT-DSNLNLSSSRGLGSSESFTQNM--KMMEPEEVRSIQSILKFNLSEISALKTAMLLMK 881

Query: 886  KLAIFLRLKSSDVEQSVELLLPLGSE----GMGDLYPLTDHKFSCTTVYGNDSMILLVED 941
            KLA+F  LK  D+ ++    +  G++      G +    DH  +       D    +  +
Sbjct: 882  KLAVFEGLKGKDLSEAC---MTFGAKCKYVTQGKIQSF-DHFLNVQAPNLFD-FEGIANN 936

Query: 942  IDLMLKCTIRLYDHINNLLQVKIPEWWKLYGELLNFRKQYAQNFPHLVKNGETSTDAXXX 1001
            I L   C+  L  HI  +L   IP+WW  YGELL+ R++Y ++FP        S ++   
Sbjct: 937  IALCELCSSLLCKHIGQVLNDDIPKWWHTYGELLSLRREYKKSFPD-ANRPHVSENSGLF 995

Query: 1002 XXXXXXXXXXXXXXXSFSIAETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAYICRGVI 1061
                           +  I  T   +++    I  D+E LA +L+ F+ FK  ++ +  I
Sbjct: 996  GSYIETKRTKLEQSYAARINHTSVRLSEISTKINQDNERLAVELNNFINFKNEFL-KSAI 1054

Query: 1062 KRWVRENIKELKERLI 1077
            K     NIK L+E+L+
Sbjct: 1055 KEHADTNIKRLREQLV 1070

>Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON}
            (56141..59458) [3318 nt, 1106 aa]
          Length = 1105

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/1105 (32%), Positives = 607/1105 (54%), Gaps = 38/1105 (3%)

Query: 1    MPYHXXXXXXXXXXAVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSP 60
            + YH          AVFNCP+P  S L+KLF  +K + F+L+VPP + LL   D   G  
Sbjct: 4    LSYHMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEKGLT 63

Query: 61   LQELCYSYEFVASHVLLIDEQNAEYMTTAPPSQV-----KFDTLNGKKVIVRSQNRIILT 115
            L+ELCY +EFVASH++L  + ++  +     +       ++ +LN  ++++++ N I L 
Sbjct: 64   LKELCYEFEFVASHIILDTDNSSNNLQVKGKNSNETLDNRYKSLNNNQLLIKNNNIIPLD 123

Query: 116  SDGFQVKKRCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAE---SVRTQRVQISQTLG 172
             +    KK+  I    +  NFNEYL    K+ I+  D P        +  +   IS+   
Sbjct: 124  FNNSTQKKKYKIIDIKILPNFNEYLSGSEKYTIIYTDYPFSNSWLPKIEIESFYISKKES 183

Query: 173  SGKRE---TKDGSSPTLDSSQGSKSSFDNILRIHPDWALKFNELFAEYRSTPEGDDPHIE 229
            +  +    T   S  + D +Q +KSSF +I+ IH +W   F+    ++++          
Sbjct: 184  NNIKAAQITNHKSPLSQDLAQKTKSSFRHIINIHKEWNNIFDSYIIDFKNKQLNLTSLPI 243

Query: 230  LFHDIIRRAYSAMRSDALFASM-PDLSDLIYDYVELNLYDDIWVRITHHFKDSE-VESNG 287
             F +I+ +AY  M+ + +F S   DL +LI++Y+E + Y+ IW  I  +  D++ + +  
Sbjct: 244  YFREIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIWDHIDRNMIDNQFLHTEM 303

Query: 288  LRYLSLHQLETGLYPDKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTL 347
            + +LS+ QLE  LY   F++FNL +V+ +E  ++ A + F ++  + +H++K   LID L
Sbjct: 304  MDFLSIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSHSEKCQILIDAL 363

Query: 348  RNLSRVDKSIQEVSPVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSITFGV 407
            + L+  D    E  P+ + ADTL++LF+LVICR+++  L+  L+YLQNF+ +E ++ FG+
Sbjct: 364  QKLTSYDDVHYE--PLMVDADTLMNLFLLVICRSKVPFLRNHLYYLQNFSTDENNVKFGL 421

Query: 408  LGYAISTLEAAVCYFDELKGSKKMSRLESECENARSLVDKLXXXX--XXVNLIHYQKTLS 465
            LGY IST EA +CY  + +  +K ++    C   + L+ K+          +  Y+    
Sbjct: 422  LGYGISTFEATLCYLKDFQAGEKFNKQVLNCIRNKELISKISSEADHSTFQVKLYKDCFK 481

Query: 466  YRTEQGESLLSICIANGKNDILQE-LLSDERSFPLEDILEDQTTEGCTLLMQSLKCGNGD 524
            +R E GES+L++CI + KN+ L E LL+ E  FPLEDIL+D+  EG TLLM++LK  N  
Sbjct: 482  FRNEMGESILALCIKHKKNETLFEILLNFEDMFPLEDILDDEDIEGTTLLMKALKVENEV 541

Query: 525  AASLIVDLIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDWDVKDSSGH 584
             A LIVD+++SSC+++E+  YFNR+D ++R AAHY+T++I++L++IG FF+W +KD  G+
Sbjct: 542  GAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAAHYITNQIDVLKRIGLFFNWKIKDDKGY 601

Query: 585  TALFTIFRSYDQPNYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLLHILKRSISI 644
            T L TI R+YDQ  Y+ MI  +F  A +WY  R +   F  H D KENTLLHILK  I +
Sbjct: 602  TPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLNFKDHNDSKENTLLHILKCDIQV 661

Query: 645  LLEYESVDVNARNRKGLTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPLLLCSIDYAKN 704
            LL+Y+++++NA N K +TPLM Y KYNR+ N + I+ D+R+ILGK Q    L   D+ KN
Sbjct: 662  LLKYDNININAHNLKYITPLMTYVKYNRVSNIQEIIRDERLILGKYQKHTFLDCYDFVKN 721

Query: 705  PLILHEIAKQSAMDTAFGKCFVHTLKYESSSWLVNITVQADRKGNFETVEFHLKTVQNFF 764
             +I  ++  +S  ++ F     ++L+ E+S+W++  T +   + ++ T    LK + N  
Sbjct: 722  TIIFEDLGVRSVRNSMFNLFSAYSLRVENSNWVLYFTFKDTNQDSYITKSVSLKILFNII 781

Query: 765  RTVLRTCPMTFLPLDSTLNQLASLGKARLSS-IGKLETVCYLRSLTNCFNVLINSQELPK 823
            +   +  P+ F+P    L +L  + K   ++ I KL+   +L  ++N F  LI + +   
Sbjct: 782  KKYNKLYPLHFIPHKEVLLRLTGIVKNNPNNGIQKLKNRAFLNLISNYFGTLIETDDFDT 841

Query: 824  DILANESKLLSWIKVQYKAFRNGTTHIFSKKVEPEEMSIIQGFLRFNQAELSTLRSKLHV 883
            ++  N   L  WIK      R      + K++  +++++I+ F++FN  EL  L   L +
Sbjct: 842  ELFKNPESLTKWIKA---GKRKHKKENYYKRMTLDDINMIKSFVQFNINELGKLNRTLAI 898

Query: 884  MKKLAIFLRLKSSDVEQSVELLLPLG--------SEGMGDLYPLTDHKFSCTTVYGNDSM 935
            +KKL  FL LK +DV +S +L    G        S  M  +  L   K      Y     
Sbjct: 899  LKKLCTFLALKINDVNESYKLFRNFGALLQQKDISNQMKKIDGLIKPK------YFQSIF 952

Query: 936  ILLVEDIDLMLKCTIRLYDHINNLLQVKIPEWWKLYGELLNFRKQYAQNFPHLVKNGETS 995
            ++L++ I  +  CTI + D+ N+L++  IPEW  ++  L N +KQY ++F     +    
Sbjct: 953  LILLDQISFLEICTIHMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDFSDF--DSRNG 1010

Query: 996  TDAXXXXXXXXXXXXXXXXXXSFSIAETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAY 1055
             +                   S  I E     ++  A I + HE+LAE+ +KF+ FK  +
Sbjct: 1011 LNENILSRYTKNKREAAEKRISEEIIENTTLFDKVTAHIWYAHENLAEEFNKFLTFKSRF 1070

Query: 1056 ICRGVIKRWVRENIKELKERLIHIQ 1080
                ++   +   I  LK+++++I+
Sbjct: 1071 FKDVILNMIIPSAIATLKDQVLNIE 1095

>KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] {ON}
            similar to uniprot|Q04263 Saccharomyces cerevisiae
            YML002W Hypothetical ORF
          Length = 1097

 Score =  599 bits (1545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/1103 (32%), Positives = 603/1103 (54%), Gaps = 45/1103 (4%)

Query: 1    MPYHXXXXXXXXXXAVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSP 60
            MPY+          AVFNCP P  S L+K+F+ ++ ++F L+ P  + LL+  D  SGS 
Sbjct: 1    MPYYLPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSS 60

Query: 61   LQELCYSYEFVASHVLLIDEQNAEYMTTAPPSQVKFDTLNGKKVIVRSQNRIILTSDGFQ 120
            LQ+LCYS  FV+ H+LL+      +       + ++ TL+GK + +R+Q + + T +GF 
Sbjct: 61   LQDLCYSASFVSDHILLLGGGGCSH-------EEEYKTLSGKTITLRNQQKALFTGEGFD 113

Query: 121  VKKRCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAESVRTQRVQISQTLGSGKRETKD 180
             ++RC + +T+L  NFNEY      +PI+ +D P+     R       +       +T  
Sbjct: 114  ARRRCQVLETELLSNFNEYFQGSSTYPIIHVDFPLTGRLARRDEWPGFKAYRFASTDTTS 173

Query: 181  GSSPTLDSSQGSKSSFDNILRIHPDWALKFNELFAEYR----STPEGDDPHIELFHDIIR 236
             +S +L +S   K+S + +LR HP +  K + +    R    S+    D     F     
Sbjct: 174  ANS-SLAASTEPKASLEQMLRAHPSYGDKLSAIIRTQRAALSSSTYNADNLAAHFMQTCE 232

Query: 237  RAYSAMRSDALFASMPDLSDLIYDYVELNLYDDIWVRITHHFKDSEVESNG----LRYLS 292
            +A +A++ D  F + P+L   I++YVE+NLYDD W ++T+  KDSE+E+      LR +S
Sbjct: 233  KALAAIQEDQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQSDFSILRNIS 292

Query: 293  LHQLETGLYPDKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTLRNLSR 352
            + Q+ + LYP   ++F+++ V  +E N+  A+    RLP+ ++H+ KA  +++TL+ +SR
Sbjct: 293  ISQVPSFLYPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVIVETLQTVSR 352

Query: 353  VDKSIQEVSPVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSITFGVLGYAI 412
              +   +V  +++ ADTL+SL V+V+C+ ++++LK  LFYLQ FAK+  SITFG+L Y +
Sbjct: 353  SLEINDKV--ISVDADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNSITFGILAYGM 410

Query: 413  STLEAAVCYFDELKGSKKMSRLESECENARSLVDKLXXXXX---XVNLIHYQKTLSYRTE 469
            STLEA + YF+     +K+  LE  C +  S  + L         +N    +  L  RT 
Sbjct: 411  STLEAVLSYFE---SREKLKLLEKHCSSNASYWEALADGKLPLGSLNPSEVKDILRTRTP 467

Query: 470  QGESLLSICIANGKNDILQELLSD-ERSFPLEDILEDQTTEGCTLLMQSLKCGNGDAASL 528
             G S LSIC+ N + ++   L +  E  FPLED+L D+T EG  LL+Q L  G    +  
Sbjct: 468  AGLSCLSICLQNRQPNLFLHLATKFEHCFPLEDLLNDETVEGSNLLIQMLDNGCSSLSGN 527

Query: 529  IVDLIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDWDVKDSSGHTALF 588
             ++++  SCT+ E+ ++ N  ++ +R++ HYL H ++++ ++G F +W+ +D +GHT LF
Sbjct: 528  FIEMLFRSCTKTELESFLNHVNRYQRSSGHYLMHALDLIVKVGKFINWEQRDCNGHTPLF 587

Query: 589  TIFRSYDQPNYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLLHILKRSISILLEY 648
             I R+YD  +YD M+  +++ A  W   + + F  + H+D K NTLLH++K ++S++L+ 
Sbjct: 588  AIIRTYDHTDYDAMVLEAYKSARLWCTLKGKQFRLSKHQDNKGNTLLHVIKSNVSVVLDD 647

Query: 649  ESVDVNARNRKGLTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPLLLCSIDYAKNPLIL 708
              V+VN+ N+KGLTP+MVYA+YNRLDN KSIL DKR+I+ K Q+   L   DY KNP++L
Sbjct: 648  PLVNVNSFNKKGLTPIMVYARYNRLDNIKSILRDKRLIIQKCQNGSYLTCFDYIKNPVVL 707

Query: 709  HEIAKQSAMDTAFGKCFVHTLKYESSSWLVNIT-VQADRKGNFETVEFHLKTVQNFFRTV 767
             E+ K +       +   H +K+E   W++ +T V +      + ++  LK +Q+F  + 
Sbjct: 708  GELGKHAFFLPQSYQIRAHNIKFEGDEWVLWMTLVGSVPNAPAKVIQRSLKFIQSFLISF 767

Query: 768  LRTCPMTFLPLDSTLNQLASLGKARLSSIGKLETVCYLRSLTNCFNVLINSQELPKDILA 827
             +T  MTF+P +S   +L+ L K ++ SI +LET  +LR  +   + LI  QE  + I  
Sbjct: 768  SKTNSMTFIPAESLAEELSLLAKMKIISINRLETKHFLRRASVVLS-LICRQEEFEHIFN 826

Query: 828  NESKLLSWIKVQYKAFRNGTTHIFSKKVEPEEMSIIQGFLRFNQAELSTLRSKLHVMKKL 887
            N S  L       +     +T+     +EPEE++ IQ  ++FN+ E+  ++S   ++KKL
Sbjct: 827  NPSGSLVNAAEHVQEQEANSTY---GMIEPEEVASIQKIMKFNRTEILAIKSGALMLKKL 883

Query: 888  AIFLRLKSSDVEQSVELLLPLGSEGMGDLYPLTDHKFSCTTVYGNDSMIL-------LVE 940
            AIF  LK  D+E+S  +    G+         T      T V+G+    L       L  
Sbjct: 884  AIFGILKGKDLERSHTMFQSHGNN-------FTKIIGRSTNVFGSLKHSLPQCEFGYLAN 936

Query: 941  DIDLMLKCTIRLYDHINNLLQVKIPEWWKLYGELLNFRKQYAQNFPHLVKNGETSTDAXX 1000
            +  L+   +  L   I+ +L   IP WWK YGEL++ R +Y +NFP  V+    + +   
Sbjct: 937  NTALLELSSRLLVQKIDKILNHDIPHWWKTYGELVSLRHEYNKNFPDDVR-PRVAENTGF 995

Query: 1001 XXXXXXXXXXXXXXXXSFSIAETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAYICRGV 1060
                               I  + +++ +   ++   +ESLA +L+ F+ FK  +     
Sbjct: 996  ISSYIETKRVRLEQGLVGRINRSSKNLLRFSLMLRRSNESLAVELNNFINFKAEFWVSAT 1055

Query: 1061 IKRWVRENIKELKERLIHIQRDL 1083
            IK     NIK L+E+L+ ++  L
Sbjct: 1056 IKEHAAMNIKWLQEQLVCLEEAL 1078

>YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative
            protein of unknown function; expression induced by heat
            and by calcium shortage
          Length = 737

 Score =  553 bits (1425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/727 (39%), Positives = 457/727 (62%), Gaps = 21/727 (2%)

Query: 363  VAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSITFGVLGYAISTLEAAVCYF 422
            + + ADTL+SLFVLV+CR++ ++LK  L+YLQNF+ N +S  FG+LGYA+STLEA VCYF
Sbjct: 15   MTMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGILGYAVSTLEAVVCYF 74

Query: 423  DEL-KGSKKMSRLESECENARSLVDKLX---XXXXXVNLIHYQKTLSYRTEQGESLLSIC 478
            ++  K +  +++  + CE  ++L+DKL          +L  Y+  L+YR EQG+S+LSIC
Sbjct: 75   EDFNKNTGNVAKANTLCEKTKNLLDKLSCENPTNEVEDLATYKDILTYRNEQGQSILSIC 134

Query: 479  IANGKNDILQELLSD-ERSFPLEDILEDQTTEGCTLLMQSLKCGNGDAASLIVDLIKSSC 537
            I N KN IL ++LS+ E  FP+ED+LED+T +G TLL++S+K GN +AA +++ ++  +C
Sbjct: 135  ITNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNLEAAKVLIKIMLFNC 194

Query: 538  TQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDWDVKDSSGHTALFTIFRSYDQP 597
            T+EE+ +Y N++DK  RT AHYLTHE++IL+ IGN+ DW  K+SSG T LF+IFRSYDQP
Sbjct: 195  TEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSGQTPLFSIFRSYDQP 254

Query: 598  NYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLLHILKRSISILLEYESVDVNARN 657
            NY++M++ +F  A  WY      F +  H D K N+LLH+LK +I ILL+   +D+N  N
Sbjct: 255  NYEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIPILLQLTKLDINEEN 314

Query: 658  RKGLTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPLLLCSIDYAKNPLILHEIAKQSAM 717
             KGLTPLMVY KY RL N  +I  D+R+IL K+Q+       DYAK+  +L +I ++   
Sbjct: 315  YKGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAKDHSVLSKIGERGVK 374

Query: 718  DTAFGKCFVHTLKYESSSWLVNITVQADRKGNFETVEFHLKTVQNFFRTVLRTCPMTFLP 777
            D+ FG  + H+L+Y + +   NIT  ++ +  F T   ++KT+Q   R++L+  P TFLP
Sbjct: 375  DSLFGLIYFHSLRYHNLNATTNITSVSNAEKPFATTVINMKTIQGLLRSILKDNPFTFLP 434

Query: 778  LDSTLNQLASLGKARLSSIGKLETVCYLRSLTNCFNVLINSQELPKDILANESKLLSWIK 837
            L++ +++++ L ++ L+ IGK +    L  LTNCFNVL+  +++P+++  +E+ +L W++
Sbjct: 435  LNTYIDEISHLNRSDLTIIGKTDVTSLLHQLTNCFNVLLFLKKIPENLFTDEASILYWMR 494

Query: 838  VQY-KAFRNGTTHIFSKKVEPEEMSIIQGFLRFNQAELSTLRSKLHVMKKLAIFLRLKSS 896
            +   K  +  +     K +EPEE+++IQ FLRFN  E+S+ ++ L++++K+ IF+ LKS 
Sbjct: 495  INTSKRNQKPSGKENPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKVLIFINLKSD 554

Query: 897  DVEQSVELLLPLG-----SEGMGDLYP-LTDHKFSCTTVYGNDSMILLVEDIDLMLKCTI 950
            D E + + L  +G     SE        +T+H      ++   S+  L+E++  + +CTI
Sbjct: 555  DFEDAYKGLNEMGRKLINSEASSAFKGIITNH-----NMFSELSLAALLENVRFLEQCTI 609

Query: 951  RLYDHINNLLQVKIPEWWKLYGELLNFRKQYAQNFPHLVK---NGETSTDAXXXXXXXXX 1007
            +L   +  +L  KIP WWK YGE L   K Y + FP++VK     +TS+ A         
Sbjct: 610  QLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVKPKSASDTSSRA-PLGGFIET 668

Query: 1008 XXXXXXXXXSFSIAETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAYICRGVIKRWVRE 1067
                     +  I  + + + + G+ I   HE LAE+LS +MEF+ A + +  +  +   
Sbjct: 669  KREQSEQRLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFRKACLDQRSLVAFATT 728

Query: 1068 NIKELKE 1074
            NI  L+E
Sbjct: 729  NISVLQE 735

>KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some
            similarities with uniprot|Q04257 Saccharomyces cerevisiae
            YML002W and some similarities with uniprot|Q04257
            Saccharomyces cerevisiae YML003W Hypothetical ORF
          Length = 1067

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/1101 (32%), Positives = 580/1101 (52%), Gaps = 65/1101 (5%)

Query: 1    MPYHXXXXXXXXXXAVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSP 60
            MPYH          A+FNCP+P TS+LK++FS L D +F +LVP  + LL   D  SG  
Sbjct: 1    MPYHLPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLE 60

Query: 61   LQELCYSYEFVASHVLLIDEQNAEYMTTAPPSQVKFDTLNGKKVIVRSQNRIILTSDGFQ 120
            L ELCY Y+FVASH+++I +   +           F TLNG+K+ +R +N  I+T DGF 
Sbjct: 61   LAELCYHYDFVASHIVVIKDPTKDVPDQRSIYNTDFTTLNGRKLSIRYRNSTIVTGDGFT 120

Query: 121  VKKRCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAESVRTQRVQISQTLGSGKRETKD 180
             +++  I + +L   FN+YL      PIL I  P+C + V    +Q+   +   K   ++
Sbjct: 121  ERRKITIKEINLLPTFNDYLKGSNYTPILHISMPLCGDLVPLDELQVFSKVAGNKYSKQE 180

Query: 181  GSSPTLDSSQGSKSSFD----NILRIHPDWALKFNELFAEYRSTPEGDDPHIELFH--DI 234
             +    D  Q     F+    +I  +    AL F+   A  +          E  +  D 
Sbjct: 181  QAPLPFDEEQKKVLYFEQRIQSISDVAERVALTFHLTKARIKKAISVIGIRTEWLNTRDS 240

Query: 235  IRRAYSAMRSDALFASMPDLSDLIYDYVELNLYDDIWVRITHHFKDSEVES----NGLRY 290
            IR+  S    D     + DL  +IYDYVEL L+ DI  +++   +D E+E       LR 
Sbjct: 241  IRQIISL---DKRLNHLEDLDAMIYDYVELKLFTDIQQQLSEIVEDQELEHRFDFKALRS 297

Query: 291  LSLHQLETGLYPDKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTLRNL 350
            +SL+Q+ T  YP   + F+L SVV +E ++  A+     + L   H+ K   L  T+R L
Sbjct: 298  ISLNQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGKLEVLSTTMRLL 357

Query: 351  SRVDKSIQEVSPVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSITFGVLGY 410
            SR      E++ ++  ADTLLSLFVL+ICR+Q+  L   L YL NF  +ETSI FG+ GY
Sbjct: 358  SR------EINGISTDADTLLSLFVLLICRSQVTGLVRTLTYLTNFEISETSIKFGLQGY 411

Query: 411  AISTLEAAVCYFDELKGSKKMSRLESECENARSLVDKLXXXXXXVNLIHYQKTLSYRTEQ 470
             +ST EAA+ +F +      +  L  +C + + +   +      V        L  RT+ 
Sbjct: 412  VLSTFEAALSFFHQ----DTVDSLTKKCASNKKIWASIQKHSK-VEAELLSSNLRIRTDS 466

Query: 471  GESLLSICIANGKNDILQELLSD-ERSFPLEDILEDQTTEGCTLLMQSLKCGNGDAASLI 529
            GESLLSICI +  N++L  LL++ E  FPLEDIL+D+     TLL+Q+L+  N  AA+++
Sbjct: 467  GESLLSICIQSHNNEVLTTLLANFESEFPLEDILDDRDFALSTLLIQALQVQNSQAAAIL 526

Query: 530  VDLIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDWDVKDSSGHTALFT 589
             ++I  SCT+ E+ +Y N  +   R  AHY+  +I++LE +G +F+W+ KD +GHT LF 
Sbjct: 527  SEIILKSCTESEVRSYLNSPNLHNRITAHYIMQDISLLESVGRYFNWEHKDINGHTPLFA 586

Query: 590  IFRSYDQPNYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLLHILKRSISILLEYE 649
            +FRSYD  NYD+++        +WYA   +PF F +HED K NTLLH++K  I  LL+  
Sbjct: 587  VFRSYDAVNYDEIVTKVLDQVVKWYANNNKPFNFKIHEDPKGNTLLHVMKSGIESLLKLP 646

Query: 650  SVDVNARNRKGLTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPLLLCSIDYAKNPLILH 709
             V+VN  + KGLTPLM+Y++YNR+ N ++I+ D+R++   +Q PL++ S+D+ KNP +  
Sbjct: 647  DVNVNKPDSKGLTPLMIYSRYNRITNIETIMKDERLLCDLVQQPLVMTSLDFTKNPKVTK 706

Query: 710  EIAKQSAMDTAFGK--CFVHTLKYESSSWLVNITVQADRKGNFETVEFHLKTVQNFFRTV 767
             I     +D  F +    +H+L++E   W + I  +    G F+  ++ L  +Q + R +
Sbjct: 707  TI-----LDATFNREPVVIHSLRFEERKWKIGIFSE----GIFK--KYSLDLIQYYLRYL 755

Query: 768  LRTCPMTFLPLDSTLNQLASLGKARLSSIGKLETVCYLRSLTNCFNVLINSQE---LPKD 824
                P +F P+    N+L  LG   +  + +L++    + L   F+  +N++    L KD
Sbjct: 756  KIMYPCSFHPVQLLTNELRLLGIYGVPGVLRLQSYHTFKKLDMLFSY-VNTRGKLWLGKD 814

Query: 825  ILANESKLLSWIKVQYKAFRNGTTHIFSKKVEPEEMSIIQGFLRFNQAELSTLRSKLHVM 884
                E +L   + V           I   K+EPEE++ IQ FL++N AE   LR+ L ++
Sbjct: 815  ----EEELKVLLDVPTPYLSESERFI---KLEPEEINGIQTFLKYNLAEFQKLRNCLIIL 867

Query: 885  KKLAIFLRLKSSDVEQSVELLLPLGSE----GMGDLYPLTDHKFSCTTVYGNDSMILLVE 940
            KKLAI  ++K  DV       L LG++    G+   +  T+  +S    Y          
Sbjct: 868  KKLAIVQQIKHRDVITMRNSFLSLGNQMSQKGVAKSFENTNCAWSYDLSYYE-----FTR 922

Query: 941  DIDLMLKCTIRLYDHINNLLQVKIPEWWKLYGELLNFRKQYAQNFPHLVKNGETSTDAXX 1000
            +++ +    + L ++  +LL  K   WWK +GEL+  +K++ +NFP+  K   +S +   
Sbjct: 923  NLEYLEHSVVTLLNNFESLL-AKTTLWWKHFGELMELKKEWKKNFPN-DKAPPSSANRNF 980

Query: 1001 XXXXXXXXXXXXXXXXSFSIAETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAY----I 1056
                            S  +  +  ++ + G  I   HES+A  ++ F+EFK  +    I
Sbjct: 981  IDTYIEGKRSKFRNKLSNQLKMSSLNLKKIGGEIKTTHESIAVGINLFIEFKEQFYHDHI 1040

Query: 1057 CRGVIKRWVRENIKELKERLI 1077
             + ++ + +REN K++ ++LI
Sbjct: 1041 VKSIVDQRIREN-KQIMQQLI 1060

>NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6.20
            YML002W
          Length = 1146

 Score =  559 bits (1440), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 362/1141 (31%), Positives = 606/1141 (53%), Gaps = 81/1141 (7%)

Query: 3    YHXXXXXXXXXXAVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSPLQ 62
            YH          ++FNCPNPS S LKKL+++LKD+ FILLVPP + LL+  D  +   L+
Sbjct: 4    YHLPTLLNPLLNSIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKIQLE 63

Query: 63   ELCY-SYEFVASHVLLIDEQNAEYMT-------TAPPSQVKFDTLNGKKVIVRSQNRIIL 114
            +LCY + +F+ +H+LL  + +    +       T   S  +FDTLNG  ++V+ +N  ++
Sbjct: 64   DLCYHNVDFIGAHILLPPKDSISSSSSTIDDGYTRLASIEQFDTLNGDNILVKWRNNFLV 123

Query: 115  TSDGFQVKKRCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAESVRTQ---RVQISQTL 171
               G   +++  I +  +  NFN+YL     F ++ ID+P+  + +R         + TL
Sbjct: 124  LLSGSPNRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFDTLTL 183

Query: 172  GSGKRETKDGSSPTL-DSSQGSKSSFDNILRIHPDWALKFNELFAEYRSTPEGDDPHIEL 230
                 ++   + P + D SQ  +S F+NI+  +  W  +F +   EY+ +   ++P+  L
Sbjct: 184  HDNDGDSSPDARPLIQDMSQHERSQFENIINTNDTWNKRFKDWMNEYKDSTTAEEPNETL 243

Query: 231  FHDIIRRAYSAMRSDALFASMPDLSDLIYDYVELNLYDDIWVRITHHFK-DSEVESNGLR 289
            F  I+  AY+ ++S+ +F     L  LI++Y+E+NLYD +W++IT     D E +   ++
Sbjct: 244  FKQIVAVAYNELKSNKIFKGFGHLRRLIHEYLEINLYDHLWLQITTLCALDDETKGTRIK 303

Query: 290  YLSLHQLETGLYPDKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTLRN 349
             +S+ +++   Y    E F L  +  +E N+  + NS ++L   ++  +K+  LI TL+ 
Sbjct: 304  NISIEEIDDKFY----EMFPLDFITKLEKNMVRSTNSINKLNGKNSFNEKSENLIATLQI 359

Query: 350  LSRVDKSIQEVSPVA-------IGADTLLSLFVLVICRTQLR--NLKGQLFYLQNFAKNE 400
            L+ +D  I E++          I ADTL++L +L+ICR+++   +LK  +FYL+ F  +E
Sbjct: 360  LTNMDNPIGELNQENEKGANNLIDADTLINLLILIICRSEINIVDLKRNIFYLKKFNYDE 419

Query: 401  TSITFGVLGYAISTLEAAVCYFDELKGSKKMSRLESECENARSLVDKLXXXXXXVNLIHY 460
              I FG+L Y IST E  +  F+ +    +  +L+S  E    L+ K+         I +
Sbjct: 420  NLINFGILSYTISTFEIVIYSFENIV---EYDKLKSYSEIIEKLI-KVDDLKKVPKTIKW 475

Query: 461  QKTLSYRTEQGESLLSICIANGKNDILQELLSD-ERSFPLEDILEDQTTEGCTLLMQSLK 519
            ++ L++R++ GES+L  CI N + +   +LL D E  F +++IL+D   EG TLLMQ+L 
Sbjct: 476  EQFLTFRSDTGESILFSCITNNQTEKFLDLLVDYEEIFSMDNILDDANVEGTTLLMQALI 535

Query: 520  CGNGDAASLIVDLIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDWDVK 579
              N   + ++++L+  +C+ +++  Y N+ DK  R   HYL +E+ IL+ IG + +W  +
Sbjct: 536  YRNFKISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYLINELEILKIIGKYVNWKQR 595

Query: 580  DSSGHTALFTIFRSYDQPNYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLLHILK 639
            D  G T LFTIFR YDQPNYD++I   F     WYA     F  + H D K+N++LHIL+
Sbjct: 596  DLVGRTPLFTIFRGYDQPNYDEVISTVFDITLNWYAENGLKFQMSDHYDLKDNSILHILR 655

Query: 640  RSISILLEYES-----VDVNARNRKGLTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPL 694
             +I IL  Y       +D+N RN KG TPLM+Y KY+RL N K IL D R++  + Q  L
Sbjct: 656  SNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLILGDDRLLFNRYQREL 715

Query: 695  LLCSIDYAKNPLILHEIAKQSAMD-TAFGKCFVHTLKYESSSWLVNITVQ-----ADRKG 748
                 DYA +  I +E+ K +  + T FG+ ++H+LK  SS+   N T        D++ 
Sbjct: 716  YTTCFDYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSST---NATFSLTFPLPDKEN 772

Query: 749  NFETVEFHLKTVQNFFRTVLRTCPMTFLPLDSTLNQLASL-----GKARLSSIGKLETVC 803
               TV   +K + +  + + +   ++ LPLD  +  L  L      K  +  I  L    
Sbjct: 773  ETGTVNIKVKAIISLLKVIRKKSQISLLPLDRIIKVLVKLTSKENNKIIVRKIEMLRNQS 832

Query: 804  YLRSLTNCFNVLINSQELPKDILA---NESKLLSWIKVQYKAFRNGT--THIFSKKVEPE 858
             LR LT+C + L+   ++  D L+   +E+KLL W+  +    ++    TH   K ++PE
Sbjct: 833  LLRRLTDCLDTLL-FFDIGIDYLSLITDETKLLGWVTNENTKLKHNVNKTHGEKKSLKPE 891

Query: 859  EMSIIQGFLRFNQAELSTLRSKLHVMKKLAIFLRLKSSDVEQS----VELLLPLGSEGMG 914
            +++IIQ FL+FN  EL  +   +  ++KL  F+ LKS DV++S    V L+  + ++ + 
Sbjct: 892  DINIIQSFLKFNVKELYNVLLNVKTLEKLLNFIHLKSIDVKESRLAFVHLVKSIKNDQIA 951

Query: 915  D-----LYPLTDHKFSCTTVYGNDSMILLVEDIDLMLKCTIRLYDHINNLLQVKIPEWWK 969
                  L P+ + + S    Y N+++I   +++D +  CT+ L  +I ++L+ +IP WWK
Sbjct: 952  QATNRSLEPIIEMQ-SLENQYYNNTLIR--DELDFLKACTLILTGNIEDILRTQIPNWWK 1008

Query: 970  LYGELLNFRKQYAQNFPHLVKNGETSTDAXXXXXXXX-------------XXXXXXXXXX 1016
            LYGELL   K Y + FP    N   +TD                                
Sbjct: 1009 LYGELLELNKHYNKLFPPNHYNNTLATDNQHSAEVSNDVNNGGVFGGLIENQRNKAVKKL 1068

Query: 1017 SFSIAETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAYICRGVIKRWVRENIKELKERL 1076
               I + + S+   G  I   HE LAE+L+K+MEFKG +  + +I+ W R +++ + + L
Sbjct: 1069 KTDIDQLKYSLEILGNEIFRKHEMLAEELNKYMEFKGVFFKKAIIRNWRRGDLEAVNDDL 1128

Query: 1077 I 1077
            I
Sbjct: 1129 I 1129

>TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.20
            YML002W
          Length = 1107

 Score =  541 bits (1393), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 357/1108 (32%), Positives = 587/1108 (52%), Gaps = 64/1108 (5%)

Query: 15   AVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSPLQELCYSYEFVASH 74
            AVFNCP+P  S  KKL++ L+D+ F+LLVP    LL   D  S    +ELCY+Y+FVA+H
Sbjct: 15   AVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNISFRELCYTYDFVAAH 74

Query: 75   VLLIDEQNAEYMTTAPPSQ---VKFDTLNGKKVIVRSQNRIILTSDGFQVKKRCHITKTD 131
            +L++D+ ++    ++   +   V   +LNGK+V++R    + +   G+  K++  +    
Sbjct: 75   ILILDKNSSTDKISSSNQKNGDVYLKSLNGKEVLLRQS--LCIPIKGYFSKRKSQMRDAT 132

Query: 132  LFVNFNEYLLQEYKFPILCIDEPICAESVRTQRVQISQTLG-SGKRE----TKDGSSPTL 186
            L  NFN+YL     F I+ ID P+      +    I +  G    RE    ++D   P L
Sbjct: 133  LLTNFNDYLHGSGHFGIMHIDYPLGV----SDWTLIDELKGFEESRELPFHSQDKDKPGL 188

Query: 187  ----DSSQGSKSSFDNILRIHPDWALKFNELFAEYRSTPEGDDPHIELFHDIIRRAYSAM 242
                + ++  +  F  + +   DW ++  +   +Y++     +   ELFHDI+   Y+ +
Sbjct: 189  LQRTEENKADRVKFIQLFQERKDWTIELEKYLKKYQAMEPLQNIGSELFHDIVNMIYNTL 248

Query: 243  RSDALFASMPDLSDLIYDYVELNLYDDIWVRITHHFKDSEVESNGLRYLSLHQLETGLYP 302
            + +  F    +L D+ Y+Y+E  LY DIW ++  H++D  ++   +  LSL  L+T  Y 
Sbjct: 249  KEEQRFQRFTNLYDIAYEYIESLLYQDIWNKLQEHYRDKILDFRLVSQLSLDMLDTTFYN 308

Query: 303  DKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTLRNLS--RVDKSIQEV 360
              F+ F L  +V+ME  +  A++ F  +  A++++ K   +  TL  ++    D +I++ 
Sbjct: 309  RTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKVDVIFKTLNIITGKNSDDTIRDN 368

Query: 361  S----PVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSITFGVLGYAISTLE 416
            +    P+ I ADTL+SLF L++CR  + ++   + YLQ+F K+E ++ FG LGY +ST+E
Sbjct: 369  TLPKLPL-IDADTLVSLFALLLCRAGVEDVFLHVQYLQSFYKDENTVKFGALGYTLSTIE 427

Query: 417  AAVCYFDELKGS-------KKMSRLESECENARSLVDKLXXXXXXVNLIHYQKTLSYRTE 469
            A + YF EL  S       +K+S LE      RS  D L      + +  ++    YRT+
Sbjct: 428  ATLSYFYELSNSDESRIQLQKLSLLEDFLIKIRSQHDDL------IPINQFKDYFRYRTQ 481

Query: 470  QGESLLSICIANGKNDILQE-LLSDERSFPLEDILEDQTTEGCTLLMQSLKCGNGDAASL 528
             GES+LS+ IAN KN+ L E LL+ E  FPL+D+L D    G TLL++ LK  N +AA +
Sbjct: 482  YGESILSLLIANKKNEALCEALLNFEDIFPLDDLLYDTDVSGSTLLIKCLKERNLEAAEI 541

Query: 529  IVDLIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDWDVKDSSGHTALF 588
            ++++ ++SCT  E+  Y+N++DK KRT AHY+T EI ILE+IG + +W +KD  G TALF
Sbjct: 542  LIEIFQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEILEKIGKYINWTLKDLKGRTALF 601

Query: 589  TIFRSYDQPNYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLLHILKRSISILLEY 648
            TIFRSYDQ  Y   I+ +   A  WY      F  + H D   ++LLHILK  +S+LL++
Sbjct: 602  TIFRSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDHTDLFGDSLLHILKSQVSLLLKF 661

Query: 649  ESVDVNARNRKGLTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPLLLCSIDYAKNPLIL 708
            E +D+N  N KG+TPLM Y KYNR+DN K+IL D R+I+ K+Q    L  +DY KN  + 
Sbjct: 662  EDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDGRLIIKKLQKDKYLNCLDYGKNFTVF 721

Query: 709  HEIAKQSAMDTAFGKCFVHTLKYESSSWLVNITVQADRKGNFETVEFHLKTVQNFFRTVL 768
            + +A + + D  F   ++   +YE S W + I+VQ D    + T    LK   N    + 
Sbjct: 722  NLLAAKLSKDVIFENAYISYARYEKSHWYLCISVQKD-DLEYTTNIIKLKKYYNLINAMQ 780

Query: 769  RTCPMTFLPLDSTLNQLASLGKAR-LSSIGKLETVCYLRSLTNCFNVLINSQELPKDILA 827
            +     F+P    L+ L  + +   +  I +L+   YL  L++  + L+  +++    L 
Sbjct: 781  KIYKSDFIPYSDMLDCLKKIIEGHNILPIRRLKIKNYLNFLSHGLSALLYFEKIDPLTLL 840

Query: 828  NESKLLSWI--KVQYKAFRNGTTHIFSKKVEPEEMSIIQGFLRFNQAELSTLRSKLHVMK 885
            +E+ ++ WI  K+Q +  ++   H   K +  E+++ I+ F  F+  E+    + +    
Sbjct: 841  DENLIIKWISSKLQQQE-KSIDDHSSFKPLSAEDINNIKAFCDFSFQEIGKTNNVIQSFL 899

Query: 886  KLAIFLRLKSSDVEQSVELLLPLG--------SEGMGDLYPLTDHKFSCTTVYGNDSMIL 937
            KL+IF  +K++D+  S ++L  LG        S  +GDL  ++ H  S    Y       
Sbjct: 900  KLSIFGEIKNTDLNTSYDILERLGSYFSNNEISRTLGDLQSISPHVHSSMVYYE------ 953

Query: 938  LVEDIDLMLKCTIRLYDHINNLLQVKIPEWWKLYGELLNFRKQYAQNFPHLVKNGETS-- 995
            L +DI  M KCT+ L   + + ++ K+  W K   +LL  RK+Y+  F  L  N ET   
Sbjct: 954  LSQDILFMKKCTLILTSKLASFIKDKLSIWLKKNTKLLEHRKEYSIKF--LQSNEETGNL 1011

Query: 996  --TDAXXXXXXXXXXXXXXXXXXSFSIAETRRSMNQAGAIIAHDHESLAEQLSKFMEFKG 1053
                +                   F++ E  R + + G  I   HE LAE+ S ++  K 
Sbjct: 1012 SENTSVFRYAWNVTYRKEEERRLKFAMLELERDLKKLGTEIRVKHEELAEEFSDYVRMKS 1071

Query: 1054 AYICRGVIKRWVRENIKELKERLIHIQR 1081
             +    +++++V  N+  LKE+   +QR
Sbjct: 1072 KFNSNLLVRKFVSLNLAHLKEQSNLVQR 1099

>KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6.20
            YML002W
          Length = 1131

 Score =  509 bits (1310), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 365/1131 (32%), Positives = 561/1131 (49%), Gaps = 98/1131 (8%)

Query: 15   AVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSPLQELCYSYEFVASH 74
            AVFNC +   S L+K++S+L D  FILLVPP   L   +D+ +  PL ELC+S EFV+SH
Sbjct: 11   AVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHELCHSPEFVSSH 70

Query: 75   VLL---------IDEQNAEYMTTAPPSQVKFDTLNGKKVIVRSQNRIILTSDGFQVKKRC 125
            +L          ID   +         + KF T NGK +      + + T+DGF  +   
Sbjct: 71   ILTRYSGKDNKPIDTDLSRLRAV---REAKFCTFNGKIINGLFSKQSLYTTDGFSFRSTR 127

Query: 126  HITKTDLFVNFNEYLLQEYKFPILCIDEPI-------------CAESVRTQRVQISQTLG 172
             I K +   +F  YL     F ++ ID+P+             C  ++       +++L 
Sbjct: 128  RILKYETLDHFQNYLQGSSTFILIYIDQPLIDTNRLLKCEDLDCFPNLTINTTPSTRSLA 187

Query: 173  S-GKRETKDGSSPTLDSSQGSKSSFDNILRIHPDWALKFNELFAEYRS-TPEGDDPHIEL 230
            +    E     +P L+S             IH  +  KF  +F  YR    + +   I  
Sbjct: 188  NLSSAEVPPQRNPLLNS------------MIHAQYNWKFRAVFQNYRKEITQSESMLIPG 235

Query: 231  FHDIIRRAYSAMRSDALFASMPDLSDLIYDYVELNLYDDIW-VRITHHFKDSEVE----- 284
            F   I + Y  +  D  F ++P +  LI +YVE N+YDD+W V I  +  + E E     
Sbjct: 236  FRKTIDKIYDGL--DNSFHTIPTIRQLIQEYVEQNVYDDVWQVLINRNNAEGEKEKQSES 293

Query: 285  SNGLRYLSLHQLETGLYPDKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLI 344
            S+  R++SL QL+T  Y  KF +F LK +V +E NI  A  SF  L + H + +K   L+
Sbjct: 294  SDIFRFISLDQLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEKCRVLV 353

Query: 345  DTLRNLSRVDKSIQEVSPVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSIT 404
            +TL+ LS+  K +     V I ADTL+SLF+L+I RT+++N++  L+YLQNF ++E SI 
Sbjct: 354  ETLQILSKPVKRVGGYQ-VPITADTLVSLFILLIKRTKMKNIRCHLYYLQNFHQDENSIK 412

Query: 405  FGVLGYAISTLEAAVCYFDELKGSK-KMSRLESECENARSLVDKLXXXXXXVN----LIH 459
            FG+LGYAISTLEA +CY + ++  K ++  +E    N    +  L       N    L  
Sbjct: 413  FGLLGYAISTLEAVICYLETIETDKERLDCIEKNDANLEEFLTLLTRSKCVSNEGLDLSK 472

Query: 460  YQKTLSYRTEQGESLLSICIANGKNDILQELLSD--ERSFPLEDILEDQTTEGCTLLMQS 517
            Y     YR   G S LS+CI N KNDI  ELLS+  E  F  ED+LEDQTTEG TLLMQS
Sbjct: 473  YSHNFRYRNGDGNSTLSLCIINFKNDIFFELLSENYESYFAFEDLLEDQTTEGTTLLMQS 532

Query: 518  LKCGNGDAASLIVDLIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDWD 577
            L+  N +    + D++  + T+EE++ Y  + DK KR   HY+  +  +L++IG +  WD
Sbjct: 533  LQHSNHEITEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQTLLQKIGKYIKWD 592

Query: 578  VKDSSGHTALFTIFRSYDQPNYDDMIRASFRCAAEWYA-CRMRPFCFTVHEDRKENTLLH 636
             KD +G T L  IFRSYDQ  YD M+  SF  A EWY+  +   FCF  H D K NTLLH
Sbjct: 593  SKDCTGQTPLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKFCFRDHTDSKGNTLLH 652

Query: 637  ILKRSISILLEYESVDVNARNRKGLTPLMVYAKYNRLDNTKSILTDKRVILGKI----QH 692
            I+K +IS LL+   VD+N  N +GL+PL   A Y+R +N +++L D R+I        Q+
Sbjct: 653  IIKCNISFLLQSPDVDINKVNSQGLSPLTNNAMYDRGENVEALLKDPRLIFSSFDFLKQY 712

Query: 693  PLLLCSIDYAKNPLILHE-IAKQSAMDTAFGKCFVHTLKYESSSWLVNITVQADRKGNFE 751
            P      +    P++ H  +  ++         F   +  + S  L + + + D +    
Sbjct: 713  P------NTKSAPILSHYCLDNEAPFRNIIASHFDFRISNKRSVVLTSRS-KEDAQELIG 765

Query: 752  TVEFHLKTVQNFFRTVLRTCPMTFLPLDSTLNQLASLGKARLSSIGKLETVC--YLRSLT 809
            +  F LK ++  FR +L+  P TF PL+  L++L+ + K   S      + C   L+ LT
Sbjct: 766  SEAFELKNLKALFRLLLKQHPFTFFPLEELLDELSVVEKTASSRSLMKSSFCSKVLKKLT 825

Query: 810  NCFNVLINSQELPKDILANESKLLSWIKVQYKAFRNGTTHIFS--KKVEPEEMSIIQGFL 867
             C + ++  + LP   L + + L   I  +            S  KK++PE +  I  FL
Sbjct: 826  YCLDSMVEMELLPTAALQSVALLERHIAKEKVTVDEEKLKRRSKDKKMQPESIGTITTFL 885

Query: 868  RFNQAELSTLRSKLHVMKKLAIFLRLKSSDVEQSVELLLPLGSE------GMGDL-YPLT 920
            ++    L  L+  +  ++K +I  +LKS D+ +S  ++  LG+E      G   + Y   
Sbjct: 886  KYILESLLKLKGTIIELRKFSILSKLKSKDISESKNIVCTLGAEVSSKKIGRAMVRYSTI 945

Query: 921  DHKFSCTTVYGNDSMILLVEDIDLMLKCTIRLYDHINNLLQVKIPEWWKLYGELLNFRKQ 980
            D+KF      G  S  LLV  I     C   + + I++LL +KIPEWWK YG+LL   K+
Sbjct: 946  DNKF-----LGEQSFDLLVFQIHFFESCLSSIINSIDHLLHLKIPEWWKCYGQLLELSKE 1000

Query: 981  YA---------QNFPHLVKN-GETSTDAXXXXXXXXX----XXXXXXXXXSFSIAETRRS 1026
                       +  P+   N G ++TD                         +I++ +R 
Sbjct: 1001 DPSVLARESDHKQTPNASNNVGTSTTDHTSGMGVLGTFIEGKRIKNQERTRAAISDLQRR 1060

Query: 1027 MNQAGAIIAHDHESLAEQLSKFMEFKGAYICRGVIKRWVRENIKELKERLI 1077
            +      I  ++  +  +   F+ F+  +I   ++++WV+ NI  LK+ L+
Sbjct: 1061 LKLLDNEIDTNNTLVVIEYCIFINFQSKFIHSAMLEKWVKLNINLLKKSLL 1111

>NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6.20
            YML002W
          Length = 1193

 Score =  474 bits (1221), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 368/1201 (30%), Positives = 606/1201 (50%), Gaps = 153/1201 (12%)

Query: 3    YHXXXXXXXXXXAVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSPLQ 62
            YH          AVFNCP+PS S  KKLF+ LK+++FILLVPP   LL+  D      L 
Sbjct: 4    YHLPTLLNPLLNAVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKLSLN 63

Query: 63   ELCY-SYEFVASHVLLID---EQNAEYMTTAPPSQVKFDTLNGKKVIVRSQNRIILTSDG 118
            ELCY + +F+ SH+L      + N +  TT    +  FD LNG K I++ ++ II T   
Sbjct: 64   ELCYHNSDFLGSHILTWSNAIDSNKDSTTTNDDEE--FDNLNGNKFIIKWKHNIIFTRGN 121

Query: 119  FQVKKRCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAESVRTQRVQISQTLGSGKRET 178
            F   +R  I K     NFN+Y     +F ++ ID+PI   S+            +   ++
Sbjct: 122  FSNDQRFKILKIHPLTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKCLLPNTRDLKS 181

Query: 179  KDGSSPTL-DSSQGSKSSFDNILRIHPDWALKFNELFAEYRSTPEGDDPHIELFHDIIRR 237
            ++  +P + D SQ SKSSF+N L  +  W LKF  L   Y+      +P+ +LF +++  
Sbjct: 182  QEKETPLVQDLSQQSKSSFENDLNKNEAWNLKFGILSNNYKIESSELEPNHKLFRELVNE 241

Query: 238  AYSAMRSDALFA-----SMPDLSDLIYDYVELNLYDDIWVRI-------THHFKDSEVES 285
            A+  + S   F      +   L  L +DY+E +LYD+IW RI         ++ D +   
Sbjct: 242  AFIEIDSKKFFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRIWKMMMNSVKNYADDQKAQ 301

Query: 286  NGLRYLSLHQLETGLYPDKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLID 345
            + +++ S+ +++    P+ ++ F LK V  +E N++ ++   ++L    ++ +K+  LI+
Sbjct: 302  HLIKHFSIVEID----PNFYDIFPLKFVPMLEKNLKHSVTCINKLKSTKSYTEKSTILIE 357

Query: 346  TLRNLSRVDKSIQEV-----SPVAIGADTLLSLFVLVICRTQ--LRNLKGQLFYLQNFAK 398
            +L+ ++  +   +E      S   I AD LL+L  LVI ++   L +LK  L+YL+ F+ 
Sbjct: 358  SLQIITDSNTGGEESKDKNKSGYLIDADNLLNLLTLVILQSNITLHDLKANLYYLKYFST 417

Query: 399  NETSITFGVLGYAIST-------LEAAVCY---------FDELKGSKKMSRLESECENAR 442
            +E+S +FG+L Y I+T       LE  + +          +EL  +  +S L S  EN +
Sbjct: 418  DESSSSFGILNYTIATFHMVSHVLENVIDWDRLKEKSDLIEELIMTDDLSTLSSTFENDK 477

Query: 443  SLVDKLXXXXXXVNLIHYQKTLSYRTEQGESLLSICIANGKND-ILQELLSDERSFPLED 501
              +                  L YR   GESLL++ I N +N    Q L+  E    ++ 
Sbjct: 478  KTL------------------LMYRNSNGESLLALSIINKQNKKFTQYLIEYEDILNMDI 519

Query: 502  ILEDQTTEGCTLLMQSLKCGNGDAASLIVDLIKSSC-TQEEMFAYFNRSDKDKRTAAHYL 560
            I  DQ+ +  TLL+Q+++  N +AA ++V L+  +C  Q+E+ +Y N+ D   R   HYL
Sbjct: 520  ISNDQSMDSSTLLLQAIRSNNFEAAIILVKLLFQNCRNQKELISYINQVDIHNRNIGHYL 579

Query: 561  THEINILEQIGNFFDWDVKDSSGHTALFTIFRSYDQPNYDDMIRASFRCAAEWYACRMRP 620
               + IL+ IG F +W  KD +G T LFTIFRSYDQ NYD+++   F+ A +WYA     
Sbjct: 580  VINLTILKIIGQFINWKQKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWYAANNLK 639

Query: 621  FCFTVHEDRKENTLLHILKRSISILLEYES-----VDVNARNRKGLTPLMVYAKYNRLDN 675
            F    H+D   N+LLHIL+ +ISILL+Y       +++N  N KG TPLM+Y KY R DN
Sbjct: 640  FQMNDHDDSNGNSLLHILQNNISILLDYAKDQNIPINLNKMNCKGFTPLMMYFKYKRYDN 699

Query: 676  TKSILTDKRVILGKIQHPLLLCSIDYAKNPLILHEIAK-QSAMDTAFGKCFVHTLKYESS 734
             + I+ ++++I  K Q P  +   DY+ +  I+++I +   +    FGK  V +LK + S
Sbjct: 700  IRMIIKEEKLIFNKFQSPNFIDCFDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLKKQMS 759

Query: 735  S-------WLVNITV---QADRKGNFETVEFHLKTVQNFFRTVLRTCPMTFLPLDSTLNQ 784
            +         +N T+   +AD+    +T++F   ++  F + + R   ++FLPLD+ LN+
Sbjct: 760  TVPSLPRGLYINYTILIDEADKSTLTKTMKF--TSLVKFLKIMKRKYAISFLPLDTLLNE 817

Query: 785  LAS-----------LGKARLSSIGKLETVCYLRSLTNCFNVLI--NSQELPKDILANESK 831
              S           L    L  I KL    +L+ L  C +VL+  +   +   +L +E++
Sbjct: 818  SQSFLDKKSKNNNNLRTIPLRYIEKLRIRRFLKRLNTCLDVLLHFDDSTIATPLLLSETE 877

Query: 832  LLSWIKVQYKAFRNGTTHIFSK-KVE------------PEEMSIIQGFLRFNQAELSTLR 878
            LL WI ++    R  +T   +K K+E            PE ++IIQ FL+FN  EL+T+ 
Sbjct: 878  LLEWISIEESKLRRSSTTPSAKSKLENAMGEKKKKELKPENINIIQNFLKFNLNELNTIS 937

Query: 879  SKLHVMKKLAIFLRLKSSDVEQSVELLLPLGSEGMG--DLYPLTDHKFSC--TTVYGNDS 934
              L V+ KL IF+ LK+ D+  + ++      +G+   ++  + +  F+   ++ Y +D 
Sbjct: 938  MNLKVLSKLVIFMNLKTLDIHDA-QIRFNGLVKGLNNKEVPSIIEKSFNVIDSSRYDDDK 996

Query: 935  MILLV---EDIDLMLKCTIRLYDHINNLLQVKIPEWWKLYGELLNFRKQYAQNFPHLVKN 991
             +LL    EDI    +CT++L   + N++++KIP WWKLYGELL   K Y +NFP+ V +
Sbjct: 997  GVLLESLHEDISFFNECTLKLIHDVENIIKIKIPNWWKLYGELLELNKYYHKNFPNCVVH 1056

Query: 992  G-----------------------------------ETSTDAXXXXXXXXXXXXXXXXXX 1016
                                                + +++                   
Sbjct: 1057 ARRTDLLSGNNANTNTNTNTNTNTNSPQRLHHHSEHQNNSNNGVFANLIENQKNKLERKT 1116

Query: 1017 SFSIAETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAYICRGVIKRWVRENIKELKERL 1076
            S  I ET   +   G+ + + HE LAE+L+++MEFK  +  R ++K +V E+IK L+E +
Sbjct: 1117 SHHIDETISLLESLGSGLLNKHEHLAEELNRYMEFKNRFFGRNIMKNFVGEDIKLLEEHV 1176

Query: 1077 I 1077
            +
Sbjct: 1177 L 1177

>TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_6.20
            YML002W
          Length = 1204

 Score =  451 bits (1160), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 352/1172 (30%), Positives = 560/1172 (47%), Gaps = 161/1172 (13%)

Query: 43   VPPCDRLLDCNDK--------LSGS---PLQELCY-SYEFVASHVLLIDEQNAEYMTTAP 90
             PP D LL+  D          +GS   PL++LC  SY+F+ASH+LL D +         
Sbjct: 42   APPTDILLNYLDSSNITPRNPYNGSNAKPLEDLCMNSYDFIASHILLYDSK------VIK 95

Query: 91   PSQVKFDTLNGKKVIVR----------SQNRIILTSDGFQV-KKRCHITKTDLFVNFNEY 139
              Q   +++NGK + ++           +  +I  S  +   KK   I K DL+ NFN Y
Sbjct: 96   NDQCVMESINGKTITIKRVTGNGALNNGEMLVITPSKNYNTPKKMLKIIKMDLWHNFNSY 155

Query: 140  LLQEYKFPILCIDEPICAESVRT--------------QRVQISQTLGSGKRETKDG---- 181
            L     +PI  ID P+    ++               Q   I+Q +   +  TKD     
Sbjct: 156  LQGMENYPIWYIDYPLYPNIIKNEFLTAFDRKLIETEQYSDIAQPVNDLENTTKDQNHKI 215

Query: 182  ---SSPTLDSSQGSKSSFDNILRIHPDWALKFNELFAEYRST------PEG--------- 223
               S    D SQ  +  F  +++   D  + +  L   YR+T       EG         
Sbjct: 216  RNISKLEPDISQSDRGGFTKLIK---DDRVIWQPLINSYRATTKHIEQAEGLPQAIDENQ 272

Query: 224  DDPHIELFHDIIRRAYSAMRSDAL--FASMPDLSDLIYDYVELNLYDDIWVRITHHFKDS 281
             D +IE+  DI    +  ++ +    F S  +L +LIY+++E+ L+DDIW RI+  F +S
Sbjct: 273  TDVNIEMVRDINCDLFEQLKDEKRYNFLSHDNLMELIYEFIEIKLHDDIWGRISFKFTES 332

Query: 282  EVESNGLRYLSLHQLETGLYP-DKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKA 340
            + + + L  +S+++L    Y  + F+ F L  +V ME  I  A+  F +        +K+
Sbjct: 333  DFDFSKLSNISVNKLLLNFYSTNNFKNFKLHDIVMMEKKISRAVTYFQKFINGITFQEKS 392

Query: 341  MYLIDTLRNLSRVDKSIQEVSPVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNE 400
              LI TL+ L+     I +++     ADTL+ L  +VICR ++RNLK  LFYLQNFA + 
Sbjct: 393  TALIKTLQILT-----INKLT----DADTLIGLLSIVICRLKVRNLKSHLFYLQNFAADP 443

Query: 401  TSITFGVLGYAISTLEAAVCYFDELKGSKKMSRLESECENARSLVDKLXXXXXXVNLIHY 460
             +I FG+LGY+ISTLEA   YFD +  S K + L + C+   +L D +      ++    
Sbjct: 444  NTIKFGILGYSISTLEAITYYFDHISHSHK-ADLIAFCDKLHNLYDTILNNIKSLD---- 498

Query: 461  QKTLSYRTEQGESLLSICIANGKNDILQELLSD-ERSFPLEDILEDQTTEGCTLLMQSLK 519
               LSYR++ GESLLS+CI N K DI  ELL+  E SFP+EDIL+D    G +LLMQ+ K
Sbjct: 499  NDILSYRSQNGESLLSLCIINNKMDIFLELLTTYEHSFPIEDILDDSDLNGSSLLMQACK 558

Query: 520  CGNGDAASLIVDLIKSSCTQEEMFAYFNRSDKDKRTAAHY--LTHEINILEQIGNFFDWD 577
              N  A+ ++V ++K+SC +EE+  + N++DK  R+ AHY  + + I IL + GN  DW+
Sbjct: 559  YNNYVASEILVTILKNSCNEEELRIFLNKTDKFNRSVAHYFNMKNSILILTEFGNLIDWE 618

Query: 578  VKDSSGHTALFTIFRSYDQPNYDD-MIRASFRCAAEWYACRMRPFCFTVHEDRKENTLLH 636
            +KD    T L TIF+ + + NY++  I+  FR    WY    +PF    H D+  N LLH
Sbjct: 619  LKDIKKLTPLLTIFKVH-KVNYNESFIKILFRVVLTWYKIHNKPFNLKAHVDQNGNNLLH 677

Query: 637  ILKRSISILLEY----ESVDVNARNRKGLTPLMVYAKYNRLDNTKSILTDKRVILGKIQH 692
            ++K  I+ L+E     E++++NA N KGL+P MVY K NR DN + IL +  +I  + Q 
Sbjct: 678  VMKDYINCLIENPELCETININANNNKGLSPFMVYFKTNRYDNIRIILKNPTLITSEGQL 737

Query: 693  PLLLCSIDYAKNPLILHEIAKQSAMDTAFGKCFVHTLKYESSS---------WLVNITVQ 743
            P L+ S +   N  + H +A        F    +H+L++   S         WLV+I++ 
Sbjct: 738  PFLITSTNLY-NSKVNHLLATHFLRTLDFAYICLHSLRFNDPSSSTSGTSLAWLVDISI- 795

Query: 744  ADRKGNFETVE--------FHLKTVQNFFRTVLRTCPMTFLPLDSTLNQLASLGKARLSS 795
             +++  F T            LKT+++     +R    + LPL S L     L K+  S 
Sbjct: 796  LEKESEFPTSHPSICRTKTLKLKTIKSLLHHFIRKYKYSSLPLKSALEFCNDLIKSNNSI 855

Query: 796  --------------IGKLETVCYLRSLTNCFNVLINSQELPKDILANESKLLSWIKVQYK 841
                          I KLE    L+ ++NC N L  + +    +L +E KL +++K+  K
Sbjct: 856  SWTSNRHFLPLSLLIDKLEIQYNLKLISNCLNFLFITTDFDFTLLFDELKLQAFLKINNK 915

Query: 842  AFRNGT-------------THIFSKKVEPEEMSIIQGFLRFNQAELSTLRSKLHVMKKLA 888
              +                T   SK  +PE+++ IQ F++FN  EL   ++ +  +K ++
Sbjct: 916  KLKESNSSNKFSHKNNSDQTTELSKAYQPEDINAIQTFIKFNLGELENFKNTITTIKDVS 975

Query: 889  IFLRLKSSDVEQSVELL----LPLGSEGMGDLY-------PLTDHKFSCTTVYGNDSMIL 937
            I ++ K  D+  S        L +G   + ++        PL  + ++    Y  +S   
Sbjct: 976  ILIKYKIMDLNSSQFFFQKNTLKIGINNLSEILKYYSTQKPLITNAYTSRKFYDYNSYDY 1035

Query: 938  LVEDIDLML-------KCTIRLYDHINNLLQVKIPEWWKLYGELLNFRKQYAQNFPHL-- 988
             VE ++ +L       K   +LY    +L    I  WW  YG LL++  QY +++P+   
Sbjct: 1036 KVEFLNKLLENLIFFEKLVCKLYYDFEDLSNGTIKTWWYHYGRLLDYEAQYNKHYPNRKI 1095

Query: 989  -VKNGETSTDAXXXXXXXXXXXXXXXXXXSFSIAETRRSMNQAGAIIAHDHESLAEQLSK 1047
             + N   S +                     +I  T   + +    I   HE+LA +L+ 
Sbjct: 1096 DINNNFESFNTMFDKRVNFDSITHFERNIILNIKNTSTLLRRFNNKIKFLHENLAIELNN 1155

Query: 1048 FMEFKGAYICRGVIKRWVRENIKELKERLIHI 1079
            FM FK  +I   +IK    E IK LK+ +I++
Sbjct: 1156 FMNFKNKFIREYIIKFSTIEVIKILKDNIIYM 1187

>KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20
            YML002W
          Length = 942

 Score =  296 bits (757), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 254/871 (29%), Positives = 422/871 (48%), Gaps = 102/871 (11%)

Query: 230  LFHDIIRRAYSAMRS--DALFA------SMPDLSDLIYDYVELNLYDDIWVRITHHFKDS 281
            L +D IR      +S  D +F       S+PD + +     E  LY  IW ++ H   + 
Sbjct: 140  LINDWIRFVSDPQKSITDVVFGINNVIKSLPDENSV--KIFEARLYSSIWNKLVHQTSEP 197

Query: 282  E-VESNGLRYLSLHQLETG-LYPDKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADK 339
            + ++     Y+S H+L     Y   F +F+L+ VV +EN ++LA   F +L  + +  +K
Sbjct: 198  QNIDKFYGCYISFHELNINDYYSLPFNKFSLRDVVFIENVVDLACKEFVKLRESLSFDEK 257

Query: 340  AMYLIDTLRNLSRVDKSIQEVSPVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKN 399
               L+ T   L+       ++  + I AD LL+  +++I R +L NL     YLQNF   
Sbjct: 258  IDILLSTFNILT------SKLPQLEIDADNLLNFMLIIINRVKLNNLNEHFHYLQNFNFK 311

Query: 400  ETSITFGVLGYAISTLEAAVCYFDELKGSKKMSRLESECENARSLVDKLXXXXXXVNLIH 459
            +    FG+L YAISTL A + Y D      K  R     ++++   +KL           
Sbjct: 312  QNK-DFGILNYAISTLGAVLYYIDN--NLDKFKRYTDAIQDSKISEEKL----------- 357

Query: 460  YQKTLSYRTEQGESLLSICIANGKNDILQELL-SDE--RSFPLEDILEDQTTEGCTLLMQ 516
                  YR E GES L  CI    ND L+ELL S E  ++FP+EDIL+DQT +G TLLM 
Sbjct: 358  -----KYRNENGESYLCHCIITKDNDTLRELLFSSEYIKNFPMEDILDDQTIDGSTLLMV 412

Query: 517  SLKCGNGDAASLIVDLIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDW 576
            ++KC N  AAS+++++I ++ T +E+  Y N  D++ R   H++T++  +L +IG + +W
Sbjct: 413  AVKCLNTTAASILINIIINNGTPDEIRTYVNSVDENNRNVGHFITNQYYLLCKIGPYLNW 472

Query: 577  DVKDS-SGHTALFTIFRSYDQP--NYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENT 633
            + KD  +G T LF IFRSYDQ   +Y  M R SFR     +A     F    H D   NT
Sbjct: 473  NCKDKRTGQTPLFNIFRSYDQSIKSYKKMSRRSFR-----FAMDSGDFQLKKHIDNSNNT 527

Query: 634  LLHILKRSISILLEYESVDVNARNRKGLTPLMVYAKYNRLDNTKSILTDK---RVILGKI 690
            LLHILK +I ++L + S+ +N+ N  G+TPLMV+ KY RL N + +L+ K   RV + + 
Sbjct: 528  LLHILKTNIQMILPHASLFINSPNSLGMTPLMVFCKYRRLYNIQILLSSKFKDRVSIFET 587

Query: 691  Q--HPLLLCSIDYAKNPLILHEIAKQSAMD-TAFGKCFVHTLKY--------ESSSWLVN 739
            Q  H           +  IL+ + K +  + + FG CF H+LK           + + V 
Sbjct: 588  QQVHNAWSNCFSLTNDDQILNLLGKFAIKNYSIFGNCFTHSLKQFLHKSKHGNKNQYSVK 647

Query: 740  ITVQADRKGNFETVEFHLKTVQNFFRTVLRTCPM--TFLPLDSTLNQLASLGKARLSSIG 797
            IT++ ++K  ++T+ F++KT++     VL +     +FLPL    N+L  +     S I 
Sbjct: 648  ITLKFEKK--YKTIRFNIKTIKALINMVLTSNSHVSSFLPLYKVFNELNGIA----SMIS 701

Query: 798  KLETVCYLRSLTNCFNVLINSQELPKDILANESKLLSWIKVQYKAFRNGTTHIFSKKVEP 857
                + ++ +L    + ++  + +P++    E++L  +++ Q K     T    SKK++ 
Sbjct: 702  TKSKILFINNLNVILDTILFLELVPREGFILEARLKDYLRNQRKI---KTVATKSKKLQI 758

Query: 858  EEMSIIQGFLRFNQAELSTLRSKLHVMKKLAIFLRLKSSDVEQSVELLLPLGSEGMGDLY 917
            E++++I  FL+FN  EL+  ++ +  + +    + LK  D  Q +  +         DL 
Sbjct: 759  EDINMISNFLKFNLNELNAFKNGVKKILRQMNSINLKLFD--QRISYM---------DLL 807

Query: 918  PLTDHKFSCTTVYGNDSMILLVEDIDLMLKCTIRLYDHINNLLQVKIPEWWKLYGELLNF 977
               D          N +  +L+ +  ++          +      KI +WWKL  EL+N 
Sbjct: 808  HCPDVVVHLNNPLWNLNYNILISNFQILENSIDNTLHFLKVFQNEKIRKWWKLNNELINL 867

Query: 978  RKQYAQNFPHLVKNGETSTDAXXXXXXXXXXXXXXXXXXSFSIAETRRSMNQAGAIIAHD 1037
             K  + +   L+++     +                   S  I +  RS+N+    I   
Sbjct: 868  TKLASNSDDDLLRSFFNRKEK-----------------LSIEIDDKIRSINELNCDIFVS 910

Query: 1038 HESLAEQLSKFMEFKGAYICRGVIKRWVREN 1068
            HE LA +++ FM+FK  +I R ++  W   N
Sbjct: 911  HELLAVEINNFMKFKPLFITRTLV-VWAHRN 940

>YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative
           protein of unknown function
          Length = 290

 Score =  225 bits (574), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 116/283 (40%), Positives = 171/283 (60%), Gaps = 3/283 (1%)

Query: 3   YHXXXXXXXXXXAVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSPLQ 62
           YH          A+FNCP P  S LKKLF+NLK R+FILL PP + LL+ +D  S  PL 
Sbjct: 4   YHLPTLLNPLVNAIFNCPEPERSPLKKLFANLKTRRFILLAPPSEYLLNYHDVKSKLPLH 63

Query: 63  ELCYSYEFVASHVLLIDEQNAEYMTTAPPSQVKFDTLNGKKVIVRSQNRIILTSDGFQVK 122
           +LCY+ EF+ S++LL+ E +  Y+ T       ++TL+GK V+++ +N +I   +GF ++
Sbjct: 64  DLCYNAEFINSYILLMTENS--YINTNS-RDSHYETLDGKTVVIQWKNNVIHALNGFHIR 120

Query: 123 KRCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAESVRTQRVQISQTLGSGKRETKDGS 182
           +R  I +T +  NFN+Y      F IL ID+P+  E V    +Q         +      
Sbjct: 121 RRLKILETKILPNFNDYFEGAADFIILFIDQPLNCEFVPNDYLQCFHNYEKIPKNAHAMP 180

Query: 183 SPTLDSSQGSKSSFDNILRIHPDWALKFNELFAEYRSTPEGDDPHIELFHDIIRRAYSAM 242
           + ++DS Q  +SSF+NIL IHP    +  +LF+ YR+   GDDP   +F  I+++A+  M
Sbjct: 181 NLSIDSFQQERSSFENILHIHPARLTQLGQLFSSYRTLAPGDDPSRSIFESIVQQAFDGM 240

Query: 243 RSDALFASMPDLSDLIYDYVELNLYDDIWVRITHHFKDSEVES 285
           +SD+LF +  +L DLI+DY ELNLYDDIW R+T HFK  EV++
Sbjct: 241 KSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLTTHFKGHEVDT 283

>TBLA0G01550 Chr7 complement(410811..411431) [621 bp, 206 aa] {ON}
           Anc_6.265 YPL239W
          Length = 206

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/88 (21%), Positives = 48/88 (54%), Gaps = 5/88 (5%)

Query: 506 QTTEGCTLLMQSLKC-GNGDAASLIVDLIKSSCTQEEMFAYFNRSDKDKRTAAHY--LTH 562
           Q +E  + ++  L   G+ D    I+ L++ + T EE   Y N ++K+  T  H+  L  
Sbjct: 45  QESENASTILHILAANGDNDIIKYIISLVRPNTTMEEFEKYINHANKEGNTPLHWASLNG 104

Query: 563 EINILEQIGNFFDWD--VKDSSGHTALF 588
           ++  ++ + + ++ D  +++++GH +++
Sbjct: 105 KLETVKLLCDEYEADPFIRNNAGHDSIY 132

>TDEL0B00450 Chr2 (79835..81169) [1335 bp, 444 aa] {ON} Anc_8.876
           YML097C
          Length = 444

 Score = 33.5 bits (75), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 366 GADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSITFGVLGYAISTLEAAVCY 421
           GAD+ + L +  I +  +R L   + Y++ F   E     G   Y +++LEAA+ Y
Sbjct: 236 GADSFIPLLIFTILKGDIRVLVSNVRYIERFRYEE--FIRGEASYYLNSLEAAINY 289

>TDEL0D03390 Chr4 complement(631409..632380) [972 bp, 323 aa] {ON}
           Anc_3.287 YDR051C
          Length = 323

 Score = 33.1 bits (74), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 40/78 (51%), Gaps = 6/78 (7%)

Query: 499 LEDILEDQTTEGCTLLMQSLKCGNGDAASLIVDLIKSSCTQEEMFAYFNRSDKDKRTAAH 558
           ++D+++ ++T G        +   G++A+ + D + S   QE ++ YF R++K  R A  
Sbjct: 214 MQDVMKKRSTYGHFFY----RFPEGESAADVYDRVAS--FQETLYRYFERTNKRPRDAVV 267

Query: 559 YLTHEINILEQIGNFFDW 576
            +TH I     +  +F W
Sbjct: 268 LVTHGIYCRVFLMKWFRW 285

>TBLA0C06290 Chr3 complement(1521582..1523093) [1512 bp, 503 aa]
           {ON} Anc_8.876 YML097C
          Length = 503

 Score = 33.5 bits (75), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 27/124 (21%), Positives = 64/124 (51%), Gaps = 6/124 (4%)

Query: 320 IELAMNSFSRLPLAHAHADKAMYLIDTLRNLSRVDKSIQEVSPVAIGADTLLSLFVLVIC 379
           +  +++  S++    A  DK + ++++ + L  +   +++      GADT + L +  + 
Sbjct: 214 VNFSVDELSKVNGYKAPRDKVVCILNSCKVLFGI---LKQSQLEGKGADTFIPLLIYTLL 270

Query: 380 RTQLRNLKGQLFYLQNFAKNETSITFGVLGYAISTLEAAVCYFDELKGSKKMSRLESECE 439
           ++ + NL   + Y++ F + E  I  G   Y +S+L+AA+ + + L+ +K    ++ E E
Sbjct: 271 KSDIENLVSNVRYIERF-RFENFIR-GEESYYLSSLQAAINFIN-LELNKDSLTIDDEIE 327

Query: 440 NARS 443
             R+
Sbjct: 328 YERA 331

>SAKL0D02882g Chr4 complement(238458..239399) [942 bp, 313 aa] {ON}
           highly similar to gnl|GLV|KLLA0F18810g Kluyveromyces
           lactis KLLA0F18810g and similar to YDR051C
           uniprot|Q7LHX4 Saccharomyces cerevisiae YDR051C
           Hypothetical ORF
          Length = 313

 Score = 32.3 bits (72), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 24/117 (20%), Positives = 50/117 (42%), Gaps = 10/117 (8%)

Query: 468 TEQGESLLSICIANGKNDILQELLSDERSFPLEDILEDQTTEGCTLLMQS--------LK 519
           +E   ++ S+ ++ G +  L   + +E     +D    Q     + +M +         +
Sbjct: 161 SESNTNIASMDLSGGDHTYLHYRVKEEPRIREQDFGNFQEVSAMSHVMSTRSSYGHFFFR 220

Query: 520 CGNGDAASLIVDLIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDW 576
              G++A+ + D  + +  QE +F +F R  K KR     +TH I +   +  +F W
Sbjct: 221 FPQGESAADVYD--RCASFQETLFRHFERGSKKKRDVVALVTHGIYLRVFLMKWFRW 275

>TPHA0C04960 Chr3 (1069045..1070661) [1617 bp, 538 aa] {ON}
           Anc_8.876 YML097C
          Length = 538

 Score = 32.3 bits (72), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 366 GADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSITFGVLGYAISTLEAAVCY 421
           GAD+ +   +  + + ++ NL   L Y++ F ++E  I  G   Y  S+L+AAV +
Sbjct: 323 GADSFIPFLIYSLLKNKIMNLPSNLNYIERF-RHEKFIK-GEASYYFSSLQAAVNF 376

>TDEL0A06780 Chr1 complement(1182697..1183299) [603 bp, 200 aa] {ON}
           Anc_6.265 YPL239W
          Length = 200

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 2/44 (4%)

Query: 518 LKCGNG--DAASLIVDLIKSSCTQEEMFAYFNRSDKDKRTAAHY 559
           + C NG  D    ++ L+K + T EE+  Y N+ ++   TA H+
Sbjct: 56  MACANGHTDVVKYLLTLVKENATSEELKDYVNKQNETGNTALHW 99

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.135    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 110,257,665
Number of extensions: 4782105
Number of successful extensions: 13427
Number of sequences better than 10.0: 45
Number of HSP's gapped: 13622
Number of HSP's successfully gapped: 48
Length of query: 1093
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 973
Effective length of database: 39,721,479
Effective search space: 38648999067
Effective search space used: 38648999067
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)