Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G044806.21ON34334313200.0
ZYRO0C07788g6.21ON3343188691e-115
SAKL0E01210g6.21ON3233288131e-107
YOR007C (SGT2)6.21ON3463427901e-103
CAGL0E02739g6.21ON3433237891e-103
Smik_15.1766.21ON3453407851e-102
Suva_15.1826.21ON3463407841e-102
Skud_15.1686.21ON3483527582e-98
Kwal_56.224336.21ON3223297501e-97
KAFR0L004106.21ON3313357269e-94
Ecym_30256.21ON3183286796e-87
TPHA0J003406.21ON3382286609e-84
Kpol_1037.266.21ON3422266539e-83
NCAS0H008306.21ON3383536512e-82
NDAI0D008106.21ON3493446452e-81
TBLA0G010506.21ON3502306348e-80
ACR005W6.21ON3273386232e-78
KNAG0M011706.21ON3392326139e-77
KLLA0D01155g6.21ON3352266139e-77
KLTH0C11220g6.21ON3272265963e-74
Kpol_1032.86.21ON3432254207e-48
NCAS0D026706.21ON3512233457e-37
NDAI0I022406.21ON3502293371e-35
TPHA0M002706.21ON3772622484e-23
NDAI0F009105.617ON583952332e-20
CAGL0H08195g5.617ON583942261e-19
Kwal_55.199355.617ON593942206e-19
ZYRO0A05676g5.617ON572942144e-18
TBLA0A072706.21ON3731192115e-18
AEL224W5.617ON5801162111e-17
TBLA0E033005.617ON582942092e-17
NCAS0G008105.617ON584952083e-17
SAKL0G07084g5.617ON5851162064e-17
Kpol_1018.695.617ON590942065e-17
YOR027W (STI1)5.617ON589942065e-17
TPHA0D028805.617ON5851132055e-17
Smik_15.2055.617ON589942031e-16
KNAG0B032005.617ON579951976e-16
TDEL0A048405.617ON576941959e-16
Suva_8.805.617ON586941941e-15
KLTH0E02178g5.617ON593931923e-15
KAFR0C058905.617ON575971913e-15
Ecym_55825.617ON584941913e-15
Skud_15.1925.617ON589951905e-15
KLLA0A07062g5.617ON581941862e-14
NCAS0A00490singletonON620921631e-11
KLLA0F24046g2.152ON604821452e-09
TBLA0C039503.481ON512891408e-09
KAFR0B066103.481ON5111141391e-08
SAKL0F03102g3.481ON5131201382e-08
Smik_6.2153.481ON513811372e-08
YGR123C (PPT1)3.481ON513751372e-08
Skud_7.4323.481ON513811353e-08
Ecym_44133.481ON510711353e-08
Suva_7.4083.481ON513751344e-08
TDEL0D055003.481ON5121071345e-08
NCAS0F034903.481ON512891345e-08
KNAG0A079003.481ON512751345e-08
CAGL0D05060g3.481ON510751337e-08
TPHA0D032203.481ON513691311e-07
Kwal_33.147672.152ON594821273e-07
KLTH0B05170g2.152ON593821274e-07
NDAI0B057903.481ON523751265e-07
Skud_8.1782.152ON638941212e-06
SAKL0E10956g2.152ON600821203e-06
YHR117W (TOM71)2.152ON639941194e-06
AAR083C3.481ON538751194e-06
NDAI0F028102.152ON609821177e-06
KAFR0E029808.506ON3801301141e-05
ZYRO0B04224g3.481ON5131071151e-05
NCAS0G024802.152ON596821151e-05
Kwal_27.118908.506ON334951131e-05
Kpol_505.413.481ON513751122e-05
CAGL0H07425g8.506ON3801241113e-05
Ecym_82042.152ON597821114e-05
Suva_15.3142.152ON644941105e-05
NCAS0B024008.506ON380881095e-05
Smik_8.1952.152ON635941096e-05
KLTH0F14542g3.481ON513971087e-05
TDEL0B013108.506ON380851078e-05
ABR131W2.152ON594821071e-04
TBLA0C055302.152ON610941052e-04
NCAS0B070102.152ON625941052e-04
Kwal_55.211753.481ON511971052e-04
Kpol_513.28.506ON374881024e-04
SAKL0H10934g8.506ON3801011015e-04
KNAG0A039508.506ON386881015e-04
YBR155W (CNS1)8.506ON385851015e-04
Suva_2.347.412ON763911016e-04
KLLA0B09966g8.506ON3701261006e-04
ZYRO0B03828g7.412ON727911016e-04
YBL084C (CDC27)7.412ON758911017e-04
AGL268C8.506ON37988997e-04
Smik_2.367.412ON751911007e-04
Smik_2.2958.506ON38585998e-04
ZYRO0G06512g2.152ON60494980.001
Kpol_1018.1067.412ON75391980.002
YNL121C (TOM70)2.152ON61794970.002
NDAI0B043402.152ON66494970.002
TBLA0H033808.506ON375124950.002
TDEL0B051402.152ON59994960.002
KLLA0B10912g3.481ON51267950.003
Smik_14.2072.152ON61794950.003
CAGL0L04048g2.152ON58782950.003
Skud_14.2112.152ON61794950.003
Suva_14.2192.152ON61794950.004
NDAI0C052908.506ON37954930.004
Skud_2.2828.506ON38585930.005
Kpol_1006.43.367ON732128930.006
KAFR0F007202.152ON60882920.007
Ecym_25598.506ON37085910.009
TPHA0E007407.412ON74691910.011
Skud_2.247.412ON76991910.011
Suva_4.4058.506ON38585900.011
KLTH0H14872g5.352ON623149900.012
TBLA0H015203.367ON689111900.013
TPHA0I015102.152ON60394890.016
CAGL0K09240g6.328ON14255850.016
TBLA0B086803.32ON91497880.021
Smik_14.183.32ON90499880.023
KLLA0E07239g3.32ON89696870.028
CAGL0E01573g3.32ON90499870.030
YNL313C (EMW1)3.32ON90499860.038
CAGL0L12936g2.152ON60094860.040
ADR230W5.689ON68599860.045
KNAG0H035302.152ON61467840.070
KLTH0E11748g8.506ON37881820.090
TBLA0D004607.412ON83587820.13
KAFR0J025706.328ON12186770.13
KNAG0A041208.470ON60299820.13
NDAI0C051308.470ON59099810.14
SAKL0F16236g7.546ON140880810.17
KNAG0I025206.328ON11786750.23
NCAS0A147707.458ON300109780.24
KLTH0F18150g5.689ON68988790.26
SAKL0F12936g7.412ON63291780.35
TPHA0D038606.328ON12097730.38
AFR453W8.470ON56987780.38
NCAS0D045006.328ON12189730.46
Kpol_1043.605.689ON70697770.47
Kpol_1048.212.152ON59767760.56
TDEL0A005103.32ON903102770.56
Ecym_40315.689ON688109760.57
NCAS0B025608.470ON578124760.64
CAGL0K11209g8.470ON59092760.68
TDEL0C027207.412ON70091750.82
KLLA0E20857g7.412ON71087750.84
AGL294W7.412ON65691741.0
Skud_4.5068.470ON61194741.1
NDAI0F004005.689ON76469731.4
TBLA0I023106.328ON11663681.7
ZYRO0C02970g3.32ON89690721.8
ZYRO0C16522g3.367ON974111731.8
NDAI0E040407.412ON78391721.9
Ecym_71427.412ON67591721.9
YDR244W (PEX5)8.470ON61273721.9
Smik_4.4918.470ON61273722.2
CAGL0H07095g5.352ON661137722.2
Suva_2.4108.470ON61173712.3
NDAI0J001307.546ON140347712.6
Kpol_1028.516.328ON11780663.0
Kpol_520.67.458ON292122703.0
TBLA0H019705.352ON84085703.2
Kwal_55.218395.689ON69099703.6
CAGL0G10087g7.546ON141156703.9
Smik_3.1596.328ON11569654.0
Ecym_13968.470ON57388694.1
SAKL0E14542g5.689ON69037694.2
Kwal_27.117378.470ON57588694.3
CAGL0J09570g8.470ON54983694.6
KLLA0B09262g3.367ON941104694.9
Kpol_1031.648.470ON60792694.9
Skud_3.1356.328ON11876654.9
KLLA0C15455g8.470ON56692685.5
TPHA0M016303.367ON104395685.8
Ecym_20906.328ON17248665.9
Kpol_1018.21.295ON121140686.1
CAGL0M08030g1.456ON38796676.7
TDEL0C050903.367ON759104677.1
KNAG0H006103.367ON973104687.1
KNAG0B022407.412ON73987677.4
NCAS0A112003.367ON907104677.7
Suva_4.1914.238ON178277678.1
KLTH0E10934g8.470ON56888669.9
SAKL0A01672g6.328ON12856639.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G04480
         (343 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...   513   0.0  
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...   339   e-115
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...   317   e-107
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...   308   e-103
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...   308   e-103
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...   306   e-102
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...   306   e-102
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...   296   2e-98
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...   293   1e-97
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...   284   9e-94
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...   266   6e-87
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...   258   9e-84
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...   256   9e-83
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...   255   2e-82
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...   253   2e-81
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...   248   8e-80
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...   244   2e-78
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...   240   9e-77
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...   240   9e-77
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...   234   3e-74
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...   166   7e-48
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...   137   7e-37
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...   134   1e-35
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...   100   4e-23
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     94   2e-20
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    92   1e-19
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    89   6e-19
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    87   4e-18
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...    86   5e-18
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    86   1e-17
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    85   2e-17
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    85   3e-17
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    84   4e-17
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    84   5e-17
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    84   5e-17
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    84   5e-17
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    83   1e-16
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    80   6e-16
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    80   9e-16
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    79   1e-15
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    79   3e-15
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    78   3e-15
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    78   3e-15
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    78   5e-15
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    76   2e-14
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       67   1e-11
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...    60   2e-09
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    59   8e-09
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    58   1e-08
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    58   2e-08
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    57   2e-08
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    57   2e-08
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    57   3e-08
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    57   3e-08
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    56   4e-08
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    56   5e-08
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    56   5e-08
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    56   5e-08
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    56   7e-08
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    55   1e-07
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...    54   3e-07
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...    54   4e-07
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    53   5e-07
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...    51   2e-06
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...    51   3e-06
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...    50   4e-06
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    50   4e-06
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...    50   7e-06
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    49   1e-05
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    49   1e-05
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...    49   1e-05
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    48   1e-05
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    48   2e-05
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    47   3e-05
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...    47   4e-05
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...    47   5e-05
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    47   5e-05
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...    47   6e-05
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    46   7e-05
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    46   8e-05
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...    46   1e-04
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...    45   2e-04
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    45   2e-04
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    45   2e-04
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    44   4e-04
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    44   5e-04
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    44   5e-04
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    44   5e-04
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    44   6e-04
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    43   6e-04
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    44   6e-04
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    44   7e-04
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    43   7e-04
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    43   7e-04
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    43   8e-04
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...    42   0.001
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    42   0.002
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...    42   0.002
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...    42   0.002
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    41   0.002
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    42   0.002
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    41   0.003
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...    41   0.003
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...    41   0.003
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...    41   0.003
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...    41   0.004
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    40   0.004
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    40   0.005
Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON...    40   0.006
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...    40   0.007
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    40   0.009
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    40   0.011
Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON} Y...    40   0.011
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    39   0.011
KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]...    39   0.012
TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.3...    39   0.013
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...    39   0.016
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    37   0.016
TBLA0B08680 Chr2 (2070444..2073188) [2745 bp, 914 aa] {ON} Anc_3...    39   0.021
Smik_14.18 Chr14 complement(29815..32529) [2715 bp, 904 aa] {ON}...    39   0.023
KLLA0E07239g Chr5 complement(655635..658325) [2691 bp, 896 aa] {...    38   0.028
CAGL0E01573g Chr5 complement(149084..151798) [2715 bp, 904 aa] {...    38   0.030
YNL313C Chr14 complement(45308..48022) [2715 bp, 904 aa] {ON}  E...    38   0.038
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...    38   0.040
ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic ...    38   0.045
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...    37   0.070
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    36   0.090
TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {O...    36   0.13 
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    34   0.13 
KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {O...    36   0.13 
NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON} Anc_8...    36   0.14 
SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON} sim...    36   0.17 
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    33   0.23 
NCAS0A14770 Chr1 complement(2911657..2912559) [903 bp, 300 aa] {...    35   0.24 
KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weak...    35   0.26 
SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} simi...    35   0.35 
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    33   0.38 
AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic ...    35   0.38 
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    33   0.46 
Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON} (1235...    34   0.47 
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...    34   0.56 
TDEL0A00510 Chr1 complement(86493..89204) [2712 bp, 903 aa] {ON}...    34   0.56 
Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON} s...    34   0.57 
NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {O...    34   0.64 
CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON} sim...    34   0.68 
TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.4...    33   0.82 
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    33   0.84 
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    33   1.0  
Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W ...    33   1.1  
NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}...    33   1.4  
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    31   1.7  
ZYRO0C02970g Chr3 (230414..233104) [2691 bp, 896 aa] {ON} simila...    32   1.8  
ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]...    33   1.8  
NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.4...    32   1.9  
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    32   1.9  
YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}  PEX5Peroxi...    32   1.9  
Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W ...    32   2.2  
CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} simila...    32   2.2  
Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W ...    32   2.3  
NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {O...    32   2.6  
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    30   3.0  
Kpol_520.6 s520 (15903..16781) [879 bp, 292 aa] {ON} (15903..167...    32   3.0  
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...    32   3.2  
Kwal_55.21839 s55 (998426..1000498) [2073 bp, 690 aa] {ON} YOR08...    32   3.6  
CAGL0G10087g Chr7 (962823..967058) [4236 bp, 1411 aa] {ON} simil...    32   3.9  
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    30   4.0  
Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar t...    31   4.1  
SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weak...    31   4.2  
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    31   4.3  
CAGL0J09570g Chr10 complement(941571..943220) [1650 bp, 549 aa] ...    31   4.6  
KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly...    31   4.9  
Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON} (1611...    31   4.9  
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    30   4.9  
KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} simi...    31   5.5  
TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa] ...    31   5.8  
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    30   5.9  
Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}...    31   6.1  
CAGL0M08030g Chr13 complement(800149..801312) [1164 bp, 387 aa] ...    30   6.7  
TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {O...    30   7.1  
KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.36...    31   7.1  
KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {O...    30   7.4  
NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa] ...    30   7.7  
Suva_4.191 Chr4 (335199..340547) [5349 bp, 1782 aa] {ON} YDL058W...    30   8.1  
KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} simila...    30   9.9  
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    29   9.9  

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score =  513 bits (1320), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/343 (76%), Positives = 264/343 (76%)

Query: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAVFGGKGL 60
           MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAVFGGKGL
Sbjct: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAVFGGKGL 60

Query: 61  VELLQNXXXXXXXXXXXXXXXIKVNIPAEDXXXXXXXXXXXXXGNKAMACKDFDLAIKKY 120
           VELLQN               IKVNIPAED             GNKAMACKDFDLAIKKY
Sbjct: 61  VELLQNESGSSSETATTQAESIKVNIPAEDAETKAKAETLKLEGNKAMACKDFDLAIKKY 120

Query: 121 SDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQ 180
           SDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQ
Sbjct: 121 SDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQ 180

Query: 181 AEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQARXXXXXXXXXXX 240
           AEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQAR           
Sbjct: 181 AEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQARGADAGAGGAGG 240

Query: 241 XXXXXXXXXMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESMMQNPGVRQMAENFAQG 300
                    M                               ESMMQNPGVRQMAENFAQG
Sbjct: 241 SGGFGDFASMLGGGLGGLLNNPQLMQAAQQMMQNPQAMSQMESMMQNPGVRQMAENFAQG 300

Query: 301 NGMPNMGDLMNNPALRDMAGSLFGGANGNAPNDVPKNSDNGSN 343
           NGMPNMGDLMNNPALRDMAGSLFGGANGNAPNDVPKNSDNGSN
Sbjct: 301 NGMPNMGDLMNNPALRDMAGSLFGGANGNAPNDVPKNSDNGSN 343

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score =  339 bits (869), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 178/318 (55%), Positives = 212/318 (66%), Gaps = 4/318 (1%)

Query: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAVFGGKGL 60
           M+PSNK+++SLIVDYL+ +V+KK+VSE++IDSLNVAI+CI E+F ++KG S A FGGK L
Sbjct: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSSAAFGGKNL 60

Query: 61  VELLQNXXXXXXXXXXXXXXXIKVNIPAEDXXXXXXXXXXXXXGNKAMACKDFDLAIKKY 120
            ELL                 +KVNIPAED             GNKAMA KD++LAIKKY
Sbjct: 61  AELL----SAGAGAPSSQGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKY 116

Query: 121 SDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQ 180
           S+AI V+PTNAVYYANRAAAHSS+K Y+EAIKDAESA+K D +YSKGYSRLGYAKFA G+
Sbjct: 117 SEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGK 176

Query: 181 AEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQARXXXXXXXXXXX 240
           +E+ALEAYKKVLDIEGD A+DVMKRDYETAK+KVEQ+L+L K  ET+             
Sbjct: 177 SEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGEPAGAN 236

Query: 241 XXXXXXXXXMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESMMQNPGVRQMAENFAQG 300
                    M                               E+MMQNP VRQMAE FA G
Sbjct: 237 PGGGFDLSSMLGGGLGGLLNNPQVMQAAQQMMQNPQAMSQMETMMQNPNVRQMAEKFAGG 296

Query: 301 NGMPNMGDLMNNPALRDM 318
           NG PN+ D+MNNPALRDM
Sbjct: 297 NGTPNLNDIMNNPALRDM 314

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score =  317 bits (813), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 172/328 (52%), Positives = 211/328 (64%), Gaps = 11/328 (3%)

Query: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAV----FG 56
           M+ SNKE+A+LIVD+LS  VEK AVSE+  DSLNVAIDCI E+FE ++     +    F 
Sbjct: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60

Query: 57  GKGLVELLQNXXXXXXXXXXXXXXXIKVNIPAEDXXXXXXXXXXXXXGNKAMACKDFDLA 116
            + L ELL++               +KVNIPAED             GNKAMA KDF+ A
Sbjct: 61  NRKLDELLKSAATALPTQSEP----VKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETA 116

Query: 117 IKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKF 176
           IKKY++AIEVLP+NAVYYANRAAA+SS+K YEE+++DAESAIK +P+YSKGYSRLG+AK+
Sbjct: 117 IKKYTEAIEVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKY 176

Query: 177 ALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQARXXXXXXX 236
           ALG+ E+ALEAYK VLDIEGDKA+DVMKRDYETAK+KVEQSL+LEK   TQ         
Sbjct: 177 ALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQT---DEQES 233

Query: 237 XXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESMMQNPGVRQMAEN 296
                        M                               + MM+NP VRQMAEN
Sbjct: 234 STDAGAGASGFPDMASLLGGGLGGLLNNPQVMSAAQKLMQNPGAMDEMMKNPAVRQMAEN 293

Query: 297 FAQGNGMPNMGDLMNNPALRDMAGSLFG 324
           F+ G G PN+GDLM+NPA++DMA +LFG
Sbjct: 294 FSSGGGTPNLGDLMSNPAIKDMAKNLFG 321

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 4/46 (8%)

Query: 287 NPGVRQMAENFAQGNGMPNMGDLMNNPALRDMAGSLFGGANGNAPN 332
           NP V   A+   Q  G   M ++M NPA+R MA +   G  G  PN
Sbjct: 261 NPQVMSAAQKLMQNPGA--MDEMMKNPAVRQMAENFSSG--GGTPN 302

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score =  308 bits (790), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 160/342 (46%), Positives = 211/342 (61%), Gaps = 5/342 (1%)

Query: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAVFG---- 56
           MS S +E+A+LIV+Y S +VEKK +SE+  DSLNVA+DCI E+F  ++     + G    
Sbjct: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60

Query: 57  -GKGLVELLQNXXXXXXXXXXXXXXXIKVNIPAEDXXXXXXXXXXXXXGNKAMACKDFDL 115
            G+ L ++L +               +++NIP +D             GNKAMA KD++L
Sbjct: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120

Query: 116 AIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAK 175
           AI KY++AI+VLPTNA+YYANRAAAHSS+K Y++A+KDAESAI  DP+Y +GYSRLG+AK
Sbjct: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK 180

Query: 176 FALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQARXXXXXX 235
           +A G+ E+ALEAYKKVLDIEGD A++ MKRDYE+AKKKVEQSL+LEK    Q+R      
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADVDA 240

Query: 236 XXXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESMMQNPGVRQMAE 295
                         +                               + MMQ+P +RQMAE
Sbjct: 241 SQGASAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300

Query: 296 NFAQGNGMPNMGDLMNNPALRDMAGSLFGGANGNAPNDVPKN 337
            FA G G PN+ DLMNNPALR+MAG+LFGGA   + ++ P N
Sbjct: 301 GFASGGGTPNLSDLMNNPALRNMAGNLFGGAGAQSTDETPDN 342

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score =  308 bits (789), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 166/323 (51%), Positives = 204/323 (63%), Gaps = 9/323 (2%)

Query: 5   NKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAVFG----GKGL 60
           +KEVA++I+ YL  +V +KAV E+ +DS+NVAIDCI ESFEV++GD  +V       KGL
Sbjct: 2   SKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGL 61

Query: 61  VELLQNXXXXXXXXXXXXXXXIKVNIPAEDXXXXXXXXXXXXXGNKAMACKDFDLAIKKY 120
            E L+                +KVNIPAED             GNKAMA KDF+LAI KY
Sbjct: 62  EECLE-----CMKGGAVKSEDVKVNIPAEDAETKAKAEALKLEGNKAMAGKDFELAIAKY 116

Query: 121 SDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQ 180
           S+AIEVLPTNA+YYANRAAAHSS+K Y+EA+ DAE AI+ DP YSKGYSRLG+AK+A  +
Sbjct: 117 SEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNK 176

Query: 181 AEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQARXXXXXXXXXXX 240
            E+ALEAYKKV+D+EGDKA+D+MKRDYETAKKKVEQSL+LEK P+ +             
Sbjct: 177 PEEALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDARGADSGAGAGAGAG 236

Query: 241 XXXXXXXXXMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESMMQNPGVRQMAENFAQG 300
                    M                               +SMMQ+P +RQMAE F  G
Sbjct: 237 GAGGFDFSSMLSGGLSGLMNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAEQFTSG 296

Query: 301 NGMPNMGDLMNNPALRDMAGSLF 323
           NG PNM DLM+NPALR+MA S+F
Sbjct: 297 NGTPNMDDLMSNPALRNMASSMF 319

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score =  306 bits (785), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 159/340 (46%), Positives = 208/340 (61%), Gaps = 5/340 (1%)

Query: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAVFG---- 56
           M  S +E+A+LIV+Y S +VEKK +SE+  DSLNVA+DCI E+F  ++  +  + G    
Sbjct: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60

Query: 57  -GKGLVELLQNXXXXXXXXXXXXXXXIKVNIPAEDXXXXXXXXXXXXXGNKAMACKDFDL 115
            GK L ++L +               ++VNIP ED             GNKAMA KD++L
Sbjct: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIPEEDAETKAKAEDLKMQGNKAMANKDYEL 120

Query: 116 AIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAK 175
           AI KY++AI+VLPTNA+YYANRAAAHSS++ Y+EA+KDAES+I  DP+Y +GYSRLG+AK
Sbjct: 121 AINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK 180

Query: 176 FALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQARXXXXXX 235
           +A G+ E+ALEAYKKVLDIEGD A++ MKRDYE+AKKKVEQSL+LEK    Q+R      
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDADANA 240

Query: 236 XXXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESMMQNPGVRQMAE 295
                         +                               + MMQ+P +RQMAE
Sbjct: 241 SQGAGSSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300

Query: 296 NFAQGNGMPNMGDLMNNPALRDMAGSLFGGANGNAPNDVP 335
            F  G G PN+ DLMNNPALR+MAG+LFGGA+  +    P
Sbjct: 301 GFTSGGGAPNLSDLMNNPALRNMAGNLFGGADAPSSEGTP 340

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score =  306 bits (784), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 167/340 (49%), Positives = 210/340 (61%), Gaps = 5/340 (1%)

Query: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGD-----SKAVF 55
           MS S +E+ASLIV+Y S +VEKK VSE++ DSLNVA+DCI E+F  ++        K+ F
Sbjct: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60

Query: 56  GGKGLVELLQNXXXXXXXXXXXXXXXIKVNIPAEDXXXXXXXXXXXXXGNKAMACKDFDL 115
            G+ L  LL +               ++VNIP ED             GNKAMA K+++L
Sbjct: 61  KGQSLNNLLSSSSKLPESGKKDDAQNVEVNIPEEDAETKAKAEELKIQGNKAMANKEYEL 120

Query: 116 AIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAK 175
           AIKKY++AI+VLPTNA+YYANRAAAHSS+K Y+EAIKDAESAI  DP+Y +GYSRLG+AK
Sbjct: 121 AIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK 180

Query: 176 FALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQARXXXXXX 235
           +A G+ E+ALEAYKKVLDIEGD A+D MKRDYE+AKK+VEQSL+LEK    Q R      
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPEQPRDAGANA 240

Query: 236 XXXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESMMQNPGVRQMAE 295
                         +                               ++MMQ+P +RQMAE
Sbjct: 241 GQGAGAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQNMMQDPSIRQMAE 300

Query: 296 NFAQGNGMPNMGDLMNNPALRDMAGSLFGGANGNAPNDVP 335
            F  G G PN+ DLM NPALR+MAGSLFGGA+  +  D P
Sbjct: 301 GFTSGGGTPNLSDLMKNPALRNMAGSLFGGADAPSTEDTP 340

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score =  296 bits (758), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 163/352 (46%), Positives = 206/352 (58%), Gaps = 29/352 (8%)

Query: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAV-----F 55
           MS S  E+ASLIV+Y S +VEKK +SE++ DSLNVA+DCI E+F  ++    ++     F
Sbjct: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60

Query: 56  GGKGLVELLQNXXXXXXXXXXXXXXXIKVNIPAEDXXXXXXXXXXXXXGNKAMACKDFDL 115
            G+ L +LL +               ++VNIP ED             GNKAMA KD++L
Sbjct: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPEEDAEIKAKAEDLKMQGNKAMANKDYEL 120

Query: 116 AIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAK 175
           AI KY++AI+VLPTNA+YYANRAAAHSS+K Y+EA++DAESAI  DPTY +GYSRLG+AK
Sbjct: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAK 180

Query: 176 FALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQARXXXXXX 235
           +A G+ E+ALEAYKKVLDIEGD A++ MKRDYE+AKKKVEQSL+LEK    Q+R      
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSR------ 234

Query: 236 XXXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESMMQNPG------ 289
                                                         + MM NPG      
Sbjct: 235 -----DADANADASQGAGTSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQ 289

Query: 290 -------VRQMAENFAQGNGMPNMGDLMNNPALRDMAGSLFGGANGNAPNDV 334
                  ++QMAE F  G G PN+ DLMNNPALR MAG+LFGGA   +  D 
Sbjct: 290 KMMQDPNIKQMAEGFTSGGGAPNLSDLMNNPALRSMAGNLFGGAGAPSTEDT 341

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score =  293 bits (750), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 159/329 (48%), Positives = 200/329 (60%), Gaps = 14/329 (4%)

Query: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQK----GDSKAVFG 56
           MSPSNK++A+LIVD+LS  VE K VSE+ +DSLNVAIDCI E+FE  +       +  F 
Sbjct: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60

Query: 57  GKGLVELLQNXXXXXXXXXXXXXXXIKVNIPAEDXXXXXXXXXXXXXGNKAMACKDFDLA 116
           G+ L ++++                +KVNIP ED             GNKAMA KDF+ A
Sbjct: 61  GRSLKQVVE----AASVGSSSPQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQA 116

Query: 117 IKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKF 176
           + KYS+AI+VLPTNAVYYANRAAAHSS+K YEEA+KDAE AIK +P+YSKGYSRLG+A++
Sbjct: 117 VLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQY 176

Query: 177 ALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQARXXXXXXX 236
           ALG+ E+AL+AYKKVLDIEG+ A+D MKRDY+TA KKV QSL++EK      R       
Sbjct: 177 ALGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATR------D 230

Query: 237 XXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESMMQNPGVRQMAEN 296
                        +                               + +M NP V+QMAE 
Sbjct: 231 GAGSATGSGGLPDISSMLGGGLGGLLNNPQLMQAAQQMMQNPNAMQEVMNNPAVKQMAEK 290

Query: 297 FAQGNGMPNMGDLMNNPALRDMAGSLFGG 325
           F  G G P+M DLMNNPAL DMA ++FGG
Sbjct: 291 FQSGGGTPSMADLMNNPALMDMAKNMFGG 319

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score =  284 bits (726), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 159/335 (47%), Positives = 199/335 (59%), Gaps = 15/335 (4%)

Query: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQK----GDSKAVFG 56
           M  SNKE+++LIVDYL ++ EK  VSE+  DSLNVAIDCI +SFE ++    G  K+ F 
Sbjct: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60

Query: 57  GKGLVELLQNXXXXXXXXXXXXXXXIKVNIPAE----DXXXXXXXXXXXXXGNKAMACKD 112
              L ELL+                + VN+P +    D             GNKAMA KD
Sbjct: 61  NLSLPELLE------VAMENSAKENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKD 114

Query: 113 FDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLG 172
           FDLAI KYS+AI + P NA+YYANRAAA+SS+K +E+A +DAESAI+ DP YSKGYSRLG
Sbjct: 115 FDLAIAKYSEAISISPNNAIYYANRAAAYSSLKDFEKATEDAESAIRVDPNYSKGYSRLG 174

Query: 173 YAKFALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQARXXX 232
           +AK+AL + E+ALEAYKKVLD+EGDKA+++MKRDYETAKK+VEQSL+LEKK  T      
Sbjct: 175 FAKYALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEESV 234

Query: 233 XXXXXXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESMMQNPGVRQ 292
                            M                               +SMMQNP +RQ
Sbjct: 235 TESAANAAAGGFPDMSSMLGGGLNGLLNNPQLMQAAQQMMSDPNAMSKIQSMMQNPSIRQ 294

Query: 293 MAENFAQGNGMPNMGDLMNNPALRDMAGSLFGGAN 327
           MAENF  GN  P+   LMN+P ++DMA + FGG N
Sbjct: 295 MAENFQNGNT-PDFSQLMNDPNIKDMAKNFFGGNN 328

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score =  266 bits (679), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 143/328 (43%), Positives = 196/328 (59%), Gaps = 16/328 (4%)

Query: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAV----FG 56
           M  SNKE+A+LIV +LS     K V EE +DSLNVAIDCI E+FE+++ DS  +    + 
Sbjct: 1   MPGSNKEIAALIVQFLS--TSTKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYN 58

Query: 57  GKGLVELLQNXXXXXXXXXXXXXXXIKVNIPAEDXXXXXXXXXXXXXGNKAMACKDFDLA 116
           G+GLV+L+++                  N  A               GNKA A KDF+ A
Sbjct: 59  GRGLVDLVKSGASEPTLSSSEPTGN---NTDAHAPEVAERAENLKLEGNKAFAAKDFEGA 115

Query: 117 IKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKF 176
           +KKY++AIE++P NAV+Y NRAAA+SS K +EEA++DAESA++ +P+YS+GYSRLG AK+
Sbjct: 116 VKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKY 175

Query: 177 ALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQARXXXXXXX 236
           ALG+ E+A+EAYKKVLDIEGD A++ MKRDYE+AKKKVE+SL+LE  P+ + +       
Sbjct: 176 ALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLEALPKGEEQ------- 228

Query: 237 XXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESMMQNPGVRQMAEN 296
                        +                               + MM NP ++QMA+N
Sbjct: 229 QTSEGSSAGGFPDLSSMLGGGLGGLLNNPQVMQAAQKMMQNPSAMQEMMNNPAIKQMAQN 288

Query: 297 FAQGNGMPNMGDLMNNPALRDMAGSLFG 324
           FA G G PN+GD+M +P ++DMAG  FG
Sbjct: 289 FASGGGTPNLGDMMKDPNIKDMAGKFFG 316

 Score = 30.0 bits (66), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 4/46 (8%)

Query: 287 NPGVRQMAENFAQGNGMPNMGDLMNNPALRDMAGSLFGGANGNAPN 332
           NP V Q A+   Q      M ++MNNPA++ MA +   G  G  PN
Sbjct: 256 NPQVMQAAQKMMQNPSA--MQEMMNNPAIKQMAQNFASG--GGTPN 297

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  258 bits (660), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 139/228 (60%), Positives = 166/228 (72%), Gaps = 16/228 (7%)

Query: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQ----KGDSKAVFG 56
           M+ SNKE+A+LIVDYL+ +V+KK VS +  DSLNVA+DCI E+FE +    K   K+ F 
Sbjct: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60

Query: 57  GKGLVELLQNXXXXXXXXXXXXXXXIKVNIP--AEDXXXXXXXXXXXXXGNKAMACKDFD 114
           G GL   L                 I+VNI   A D             GNKAMA KD++
Sbjct: 61  GNGLTSFLSGSATND----------IQVNIADDAADEEQKATAEGLKLEGNKAMATKDYE 110

Query: 115 LAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYA 174
            AIKKYS+AIEVLPTNAVYYANRAAA+SS+K Y++A+ DAESAIK +PTYSKGYSRLG+A
Sbjct: 111 SAIKKYSEAIEVLPTNAVYYANRAAAYSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFA 170

Query: 175 KFALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEK 222
           KFA G+ EDAL+AYKKVLDIEGDKA+D+MKRDYETAKKKVEQSL+LEK
Sbjct: 171 KFAQGKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEK 218

 Score = 70.5 bits (171), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 2/50 (4%)

Query: 282 ESMMQNPGVRQMAENFAQGNGMPNMGDLMNNPALRDMAGSLFGGANGNAP 331
           ESMMQNP VRQMAENFA G G P++  +MNNP L+DMA ++FG  NG  P
Sbjct: 287 ESMMQNPAVRQMAENFASGEGTPDLSAMMNNPDLKDMAKNMFG--NGGFP 334

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%)

Query: 286 QNPGVRQMAENFAQG-NGMPNMGDLMNNPALRDMAGSLFGG 325
           +NP + Q A+   Q  N M  M  +M NPA+R MA +   G
Sbjct: 265 KNPQIMQAAQQMMQNPNAMQQMESMMQNPAVRQMAENFASG 305

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score =  256 bits (653), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 134/226 (59%), Positives = 167/226 (73%), Gaps = 5/226 (2%)

Query: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQK----GDSKAVFG 56
           MS SNK++A+LI+D+LS +V+K  VSE+  DSLNVA+DCI E+FE ++    G  K+ F 
Sbjct: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60

Query: 57  GKGLVELLQNXXXXXXXXXXXXXXXIKVNIPAEDXXXXXXXXXXXXXGNKAMACKDFDLA 116
           G  L   L N               +KVN+  +D             GNKAMA KD++LA
Sbjct: 61  GNSLSSYL-NGSTSASAATTTADETVKVNVTEDDTEASEAAEALKLEGNKAMAGKDYELA 119

Query: 117 IKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKF 176
           IKKY++AI  LPTNAVY+ANRAAA+SS+K Y+EA++DA SAIK +PTYSKGYSRLG+AKF
Sbjct: 120 IKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKF 179

Query: 177 ALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEK 222
           A G+AEDALEAYKKVLDIEGDKA+++MKRDYETAKKKVEQSL+LEK
Sbjct: 180 AQGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEK 225

 Score = 65.5 bits (158), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 29/53 (54%), Positives = 39/53 (73%), Gaps = 2/53 (3%)

Query: 282 ESMMQNPGVRQMAENFAQGNGMPNMGDLMNNPALRDMAGSLF--GGANGNAPN 332
           ESMMQNP V+QMA+ F+ GNG P+   LMN+P++RDMA ++F  GG  G  P+
Sbjct: 290 ESMMQNPSVKQMADQFSSGNGTPDFSALMNDPSIRDMAKNMFGNGGFQGAPPS 342

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  255 bits (651), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 154/353 (43%), Positives = 193/353 (54%), Gaps = 32/353 (9%)

Query: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAV----FG 56
           MS SNKEV SLIVD+LS +++ K +SE++ DSLNVAIDCI ESFE ++          F 
Sbjct: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60

Query: 57  GKGLVELLQNXXXXXXXXXXXXXXXIKVNIPAEDXXXXXXXXXXXXXGNKAMACKDFDLA 116
           GK L E+L                 +KVNIP ED             GNKAMA KD+ LA
Sbjct: 61  GKTLKEILS--SASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLA 118

Query: 117 IKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKF 176
           I+KYS+AI+ LPTN +YYANRAAA+SS+K Y+ AIKDAE AI+ DP YSKGYSRL +AK+
Sbjct: 119 IEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKY 178

Query: 177 ALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQARXXXXXXX 236
           AL + E+ALE YKKVLD+EGDKA+  MKRD+E AK +VE S++LEK   T          
Sbjct: 179 ALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSAGQ 238

Query: 237 XXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESMMQNPGVRQ---- 292
                        M                               + MM +P   Q    
Sbjct: 239 QPANPFAGSGMPDM-----SSLFGNGGGMGGLSSFLNNPQVMQAAQQMMSDPNSMQKMQE 293

Query: 293 ---------MAENFAQGNGMPNMGDLMNNPALRDMAGSLFGGANGNAPNDVPK 336
                    MA+N A G+   N+ DLMNNP+++DMA +LFG      PN  PK
Sbjct: 294 MMQNPNLREMAQNLASGDA--NLDDLMNNPSVKDMANNLFG------PNGAPK 338

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score =  253 bits (645), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 148/344 (43%), Positives = 194/344 (56%), Gaps = 24/344 (6%)

Query: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKG----DSKAVFG 56
           MS +NK++ +LIVD+LS ++EK  VSE+  DSLNVA+DCI E+ E  +       K  F 
Sbjct: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60

Query: 57  GKGLVELLQNXXXXXXXXXXXXXXXIKVNIPAEDXXXXXXXXXXXXXGNKAMACKDFDLA 116
           GK LV++L                 ++VNIP ED             GNKAMA KDF LA
Sbjct: 61  GKTLVDILNTTSTATANTTIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLA 120

Query: 117 IKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKF 176
           ++KY++AI++LPTNA+YYANRAAAHSS+K +EEAIKDAESAIK DP+YSKGYSRL +AK+
Sbjct: 121 VEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKY 180

Query: 177 ALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEK-KPETQARXXXXXX 235
            LG+ E+ALE+YKKVLDIEGD A+  MKRDYETAKK+VE+S+++EK K   Q +      
Sbjct: 181 GLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQTN 240

Query: 236 XXXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESMMQNPGVRQMAE 295
                         M                               + +M +P   Q  +
Sbjct: 241 ESAQGNAPNPFAGGM--PDMSSLFGGAGMGGGLGSLLSNPDFMSTAQKLMSDPNAMQQVQ 298

Query: 296 NFAQGNGMPNMGDL--------------MNNPALRDMAGSLFGG 325
           +       P+M DL              MNNPA+R+MA +LF G
Sbjct: 299 SMMSD---PSMRDLANNFKNGNTDMNDIMNNPAIRNMASNLFKG 339

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score =  248 bits (634), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 132/230 (57%), Positives = 168/230 (73%), Gaps = 10/230 (4%)

Query: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAV----FG 56
           MS SNK++A+L+VD+LS  +EKKAVS +  DSLNVAIDCI E+FE +K D K+     FG
Sbjct: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60

Query: 57  GKGLVELLQNXXXXXXXXXXXXXXXIKVNIP----AEDXXXXXXXXXXXXXGNKAMACKD 112
           GK L ELL                 IKV+I      ED             GNKAMA KD
Sbjct: 61  GKSLTELLD--AATNAKGRSSSPEDIKVSISDKDEEEDKELAAKAEALKLEGNKAMAAKD 118

Query: 113 FDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLG 172
           ++LA++KY+ AI+++PT AVYYANRAAA+SS + Y+EAIKDAESAIK +P +SKGYSRLG
Sbjct: 119 YNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLG 178

Query: 173 YAKFALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEK 222
           +AKFA G++++ALEAYKK L+++GDKA+D+MKRDYETAKKKVEQSL++EK
Sbjct: 179 FAKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEK 228

 Score = 61.6 bits (148), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (78%), Gaps = 1/42 (2%)

Query: 282 ESMMQNPGVRQMAENFAQGNGMPNMGDLMNNPALRDMAGSLF 323
           ESMMQNP +RQMAEN + G+    MGD MNNPA+R+MA +LF
Sbjct: 283 ESMMQNPSIRQMAENLSSGSS-EGMGDFMNNPAIREMASNLF 323

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score =  244 bits (623), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 141/338 (41%), Positives = 193/338 (57%), Gaps = 27/338 (7%)

Query: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAVF----G 56
           MSPSNK++A+LIVD+L+     K V E+  DSL VAIDCI E+FE+  G++  +     G
Sbjct: 1   MSPSNKDIAALIVDFLT--TSAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCG 58

Query: 57  GKGLVELLQNXXXXXXXXXXXXXXXIKVNIPAEDXXXXXXXXXXXXXGNKAMACKDFDLA 116
           G+ L +LL                  ++   AE              GN+AMA KD++ A
Sbjct: 59  GRSLSQLLTTGMAHTSDAGEPKVAAEELKKEAE---------ALKLEGNRAMAAKDYETA 109

Query: 117 IKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKF 176
           I+KY+ AIEVLPT+AVYYANRAAA+SS++ YE+A++DAE A K D +YSKG+SRLGYAK+
Sbjct: 110 IQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKY 169

Query: 177 ALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQARXXXXXXX 236
           ALG+ E+ALEAYK+VLDIEGD A++ M+RDYE+AK+KVE+S+++++  E           
Sbjct: 170 ALGRHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVT--ESGDSAA 227

Query: 237 XXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESMMQN--------- 287
                        M                               + MMQN         
Sbjct: 228 GSAGGSGLPDLASMFGGGGLGGGLGGGLGGGLGGLLNNPQVMQAAQKMMQNPSAIQEMMS 287

Query: 288 -PGVRQMAENFAQGNGMPNMGDLMNNPALRDMAGSLFG 324
            P +++MAENFA GNG   +GDLM +PA+R+MA   FG
Sbjct: 288 NPAIKKMAENFASGNGSSGLGDLMADPAVRNMASKFFG 325

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score =  240 bits (613), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 125/232 (53%), Positives = 162/232 (69%), Gaps = 4/232 (1%)

Query: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAV----FG 56
           M+ SNKEV+SLI+DYL+++V K  VS + IDSLNVAIDC+ E F V+K    A     F 
Sbjct: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60

Query: 57  GKGLVELLQNXXXXXXXXXXXXXXXIKVNIPAEDXXXXXXXXXXXXXGNKAMACKDFDLA 116
           GK L ELL                 +K+NIP ED             GNKA+A KD+DLA
Sbjct: 61  GKSLTELLDAASQNAGNTDECKTETVKINIPQEDAETKAKAEALKLEGNKAVASKDYDLA 120

Query: 117 IKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKF 176
           ++KY++AI++LPTNAVY+ANRAAA+++ + Y+EA+KDAE AIK DP YSKGYSRL YAK+
Sbjct: 121 VEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKY 180

Query: 177 ALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQA 228
                E++LEAYKKVL+IEGD A++V KR YETAKK+VE+SL+LEK   T++
Sbjct: 181 VQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTES 232

 Score = 62.0 bits (149), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 35/45 (77%), Gaps = 1/45 (2%)

Query: 282 ESMMQNPGVRQMAENFAQGNGMPNMGDLMNNPALRDMAGSLFGGA 326
           +SMMQNP ++QMAE F  GN  P+  ++MNNPA+R+MA SLF GA
Sbjct: 283 QSMMQNPAIQQMAEQFKGGN-TPDFSEMMNNPAVRNMASSLFSGA 326

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 1/45 (2%)

Query: 282 ESMMQNPGVRQMAENFAQGNG-MPNMGDLMNNPALRDMAGSLFGG 325
           E +M NP + Q A++     G M  +  +M NPA++ MA    GG
Sbjct: 257 EGLMNNPQMMQAAQSMMSNPGAMEKIQSMMQNPAIQQMAEQFKGG 301

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score =  240 bits (613), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 165/226 (73%), Gaps = 10/226 (4%)

Query: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAV----FG 56
           MS SNKE+A+LIVD+LS      +V+E+ +DSLNVAIDCI E+F+ ++ ++ ++    F 
Sbjct: 1   MSLSNKEIAALIVDFLSS--SSSSVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFN 58

Query: 57  GKGLVELLQNXXXXXXXXXXXXXXXIKVNIPAEDXXXXXXXXXXXXXGNKAMACKDFDLA 116
           GK L ELL                 +KV+IP ED             GNKAMA K FD A
Sbjct: 59  GKKLPELL----ASAPSSGGVSGEPVKVHIPVEDAAAKAKAEELKLQGNKAMAAKKFDEA 114

Query: 117 IKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKF 176
           I+KY+ AIEV P+NAVYY+NRAAA+SS+K YE+A+KDAE AI+ DPTYSKG+SRLG+AK+
Sbjct: 115 IEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKY 174

Query: 177 ALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEK 222
           AL + E+AL+AYKKVLDIEG+KA+DVMKRDYETAKKKVE S++LEK
Sbjct: 175 ALNKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLEK 220

 Score = 64.7 bits (156), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 37/48 (77%)

Query: 282 ESMMQNPGVRQMAENFAQGNGMPNMGDLMNNPALRDMAGSLFGGANGN 329
           + MM NP ++QMA  F+ G GMP++  +MN+P++RDMA ++FGG NG+
Sbjct: 286 QDMMSNPAMKQMANQFSSGGGMPDLSQMMNDPSIRDMAKNMFGGGNGS 333

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score =  234 bits (596), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 164/226 (72%), Gaps = 7/226 (3%)

Query: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAV----FG 56
           M+P+ KE+ASLI+DYL +  E K + E+ IDSLNVAIDC+ E+FEV+K  + +V    FG
Sbjct: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60

Query: 57  GKGLVELLQNXXXXXXXXXXXXXXXIKVNIPAEDXXXXXXXXXXXXXGNKAMACKDFDLA 116
           G+ L +++                 +KVNIP ED             GNKAMA KDF+ A
Sbjct: 61  GQSLEQIV---GASSKGPTATQQEPVKVNIPVEDAEIKAKAEALKLEGNKAMATKDFEHA 117

Query: 117 IKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKF 176
           I KYS+AI  LP+NAVY+ANRAAA+SS+K Y EA++DAE+AIK +P+YSKGYSRLG+A++
Sbjct: 118 ISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQY 177

Query: 177 ALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEK 222
           ALG+ E+AL+AYKKVLDIEG  A+D MKRDY+TA KKVEQSL++E+
Sbjct: 178 ALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVER 223

 Score = 63.9 bits (154), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 33/44 (75%)

Query: 282 ESMMQNPGVRQMAENFAQGNGMPNMGDLMNNPALRDMAGSLFGG 325
           + MM NP ++QMA+ F  G G P+M DLMNNPAL DMA ++FGG
Sbjct: 281 QEMMSNPAIKQMADKFQSGGGTPSMADLMNNPALMDMAKNMFGG 324

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score =  166 bits (420), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 95/225 (42%), Positives = 135/225 (60%), Gaps = 5/225 (2%)

Query: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAVFG---G 57
           MS +NK+  +LIV+YL ++++ K VSE+  +SLNVAIDCI + FE+     + +      
Sbjct: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60

Query: 58  KGLVELLQNXXXXXXXXXXXXXXXIKVNIPAEDXXXXXXXXXXXXXGNKAMACKDFDLAI 117
           K  ++ +                 +K    +ED             GNK M+ K++  AI
Sbjct: 61  KSDLKTITLKGLGLQNVSDVVELEVKNEEISEDKKKEAEALKLE--GNKQMSLKNYKSAI 118

Query: 118 KKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFA 177
            KYS AIE+ P+N  YY+NRAAA+  ++ +  A+ DA +AIK DPTYSK YSRLG AK A
Sbjct: 119 DKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLA 178

Query: 178 LGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEK 222
            G  EDA+ A+KKVL++EGDK+++VMK DYE AKK V+  + L K
Sbjct: 179 EGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNK 223

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 32/46 (69%)

Query: 282 ESMMQNPGVRQMAENFAQGNGMPNMGDLMNNPALRDMAGSLFGGAN 327
           E +MQNP VRQ AEN A GNG   + D++NNP+++++A  L  G N
Sbjct: 280 EGLMQNPVVRQFAENVANGNGPGGLSDVLNNPSVKEVANGLMNGYN 325

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score =  137 bits (345), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 87/223 (39%), Positives = 124/223 (55%), Gaps = 24/223 (10%)

Query: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQK---GDSKAVFGG 57
           MS SNKE+AS IV YLS L+    V+E+  +S++VAI+CI +SF++Q+    DS      
Sbjct: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSADSDLATVL 60

Query: 58  KGLVELLQNXXXXXXXXXXXXXXXIKVNIPAEDXXXXXXXXXXXXXGNKAMACKDFDLAI 117
              + L                  IK+ +                 GNKA+  +++  AI
Sbjct: 61  LANLNLEPEPKLSEKERELVNEQAIKLKL----------------EGNKAVERENYKDAI 104

Query: 118 KKYSDAIEVLPTNAV-----YYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLG 172
            KY+ AI++L  N +     Y +N++ A +    YEEA  DA + IK DPT+SKGYSRL 
Sbjct: 105 DKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLA 164

Query: 173 YAKFALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVE 215
            AK    + EDA+ AYK+VLD+EG+KA+D MKRD+E  K+K E
Sbjct: 165 EAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFE 207

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score =  134 bits (337), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 119/229 (51%), Gaps = 19/229 (8%)

Query: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAVFGGKGL 60
           MS + ++ ASLI+ YLS L     + E+  +SL VAI CIGESF +           + L
Sbjct: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTSLKERTL 60

Query: 61  VELLQNXXXXXXXXXXXXXXXIKVNIPAEDXXXXXXXXXXXXXGNKAMACKDFDLAIKKY 120
             +LQ                    + A               GN+AM    ++ AIKKY
Sbjct: 61  KTILQENLNT---------------LEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKY 105

Query: 121 SDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQ 180
           ++AI+    N  YY+NR+ A+S +  YE+A+ DA  AI  DP++SK YSRLGYAK    +
Sbjct: 106 TEAIQ-FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDK 164

Query: 181 AEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQAR 229
            ED + AYK+ +D+EG  AS  +  DYE A+ K EQ   L+K  +++ R
Sbjct: 165 LEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQ---LKKNDDSEER 210

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score =  100 bits (248), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 79/262 (30%), Positives = 124/262 (47%), Gaps = 46/262 (17%)

Query: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQK----GDSKAVFG 56
           M+ +++E+AS+IVDY ++ +    ++++ +DSLNVAIDCI + F+V K       K  + 
Sbjct: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60

Query: 57  GKGLVELLQN---------XXXXXXXXXXXXXXXIK-----------VNIPA---EDXXX 93
              L+  L N                        I            +N+P    ED   
Sbjct: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120

Query: 94  XXXXXXXXXXGNKAMACKDF---DLAIKKYS-------DAIEVLPTNAVYYANRAAAHSS 143
                       KA   K+    ++  K+YS       DAI++ PTN  YY NRA A+  
Sbjct: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180

Query: 144 MKAYEEAIKDAESAIKTD----PTYSKGYSRLGYAKFALGQAEDALEAYKKVLDI----- 194
              ++ AI DA  +I+ D    PT  K Y RLG AK+ +G  E +L A+K++++I     
Sbjct: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240

Query: 195 EGDKASDVMKRDYETAKKKVEQ 216
           +GD+ +  M  DYE AK+KV++
Sbjct: 241 KGDEITKQMDADYEKAKEKVQE 262

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 94.4 bits (233), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 68/95 (71%), Gaps = 1/95 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPT-NAVYYANRAAAHSSMKAYEEAIKDAESAIKTDP 162
           GN A   KDF+ AI+ ++ AIEV PT N V Y+NR+AA++S K ++EA+ DA   +K +P
Sbjct: 12  GNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDATECVKINP 71

Query: 163 TYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGD 197
           T+SKGY+RLG A+F LG  E+A + YK+ L ++ +
Sbjct: 72  TWSKGYNRLGAAEFGLGNLEEAEKNYKEALKLDNN 106

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 49/75 (65%)

Query: 112 DFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRL 171
           D+  A+K YS+ I+  P +A  Y+NRAAA S + ++ EAIKD ++AIK DP + + Y R 
Sbjct: 404 DWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCDNAIKKDPNFVRAYIRK 463

Query: 172 GYAKFALGQAEDALE 186
             A+ A+ +  +AL+
Sbjct: 464 ATAQIAIKEYANALD 478

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 64/135 (47%), Gaps = 14/135 (10%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAI----- 158
           GNK      FD AI++Y+ A   L  +  Y  NR+AA      +E AI     A+     
Sbjct: 262 GNKLYKAHKFDEAIEQYNKAW-ALNKDITYLNNRSAAEFEKGDFETAIATLNEAVDQGRE 320

Query: 159 -KTD-PTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGDKASDVMKR----DYETAKK 212
            + D    +K ++R+G A    G  + +++ Y+K L     + +D++ +    + E  K+
Sbjct: 321 LRADYKIIAKSFARIGNAYHKKGDLKKSIDYYQKSLT--EHRTADILTKLRNCEKELKKQ 378

Query: 213 KVEQSLDLEKKPETQ 227
           + EQ +D EK  E +
Sbjct: 379 EAEQYIDPEKAEEAR 393

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 91.7 bits (226), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 45/94 (47%), Positives = 66/94 (70%), Gaps = 1/94 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPT-NAVYYANRAAAHSSMKAYEEAIKDAESAIKTDP 162
           GN A   KD++ AI  +S AIEV  T N V+Y+NR+A ++S+K + EA+ DAE  +K +P
Sbjct: 11  GNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDAEECVKINP 70

Query: 163 TYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEG 196
           T+SKGY+RLG A   LG  ++A  +YKK L+++G
Sbjct: 71  TWSKGYNRLGAAHLGLGDLDEAEGSYKKALELDG 104

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 46/75 (61%)

Query: 112 DFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRL 171
           D+  A+K Y++ I+  P +A  Y+NRAAA S + ++ EAI+D   AI+ DP + + Y R 
Sbjct: 405 DWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCNKAIEKDPNFIRAYIRK 464

Query: 172 GYAKFALGQAEDALE 186
             A+ A+ +   A+E
Sbjct: 465 ATAQIAVKEFAAAIE 479

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 48/97 (49%), Gaps = 10/97 (10%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAA-------AHSSMKAYEEAIKDAES 156
           GNKA   + FD AI  Y DA   L  +  Y  NR+A       A +++K  +EA++    
Sbjct: 263 GNKAYKARQFDEAIAHY-DAAWNLHQDITYLNNRSAAEFEKGDAETALKTLDEAVEKGRE 321

Query: 157 AIKTD-PTYSKGYSRLGYAKFALGQAEDALEAYKKVL 192
            ++TD    +K ++R+G         + A+E Y+K L
Sbjct: 322 -MRTDYKLIAKSFARMGNVHHKTNNLKKAIEFYQKSL 357

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 89.4 bits (220), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 44/94 (46%), Positives = 67/94 (71%), Gaps = 1/94 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPT-NAVYYANRAAAHSSMKAYEEAIKDAESAIKTDP 162
           GN A   KDF+ A + +S AIE   T N V Y+NR+A ++S+K ++EA++DAE  +K +P
Sbjct: 10  GNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAEECVKINP 69

Query: 163 TYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEG 196
           T+SKGY+R+G A++ LG  +DA + YKK L+I+ 
Sbjct: 70  TWSKGYNRVGAAQYGLGNLDDAEKEYKKALEIDS 103

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 44/75 (58%)

Query: 112 DFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRL 171
           D+  A+  Y++ I+  P +A  Y+NRAA  + + ++ +AIKD + AI  DP + + Y R 
Sbjct: 416 DWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCDVAISKDPNFVRAYIRK 475

Query: 172 GYAKFALGQAEDALE 186
             A+ A+ +   A+E
Sbjct: 476 ASAQIAVREFAPAME 490

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 48/96 (50%), Gaps = 8/96 (8%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAI----- 158
           GNK    + FD AI+ Y+ A + L  +  Y  NR+AA      YE+AIK    A+     
Sbjct: 274 GNKYYKARKFDEAIEHYNKAWD-LHRDVTYLNNRSAAEYEKGDYEQAIKTLTEAVDQGRE 332

Query: 159 -KTD-PTYSKGYSRLGYAKFALGQAEDALEAYKKVL 192
            + D    SK ++R+G A   +   + A+E Y++ L
Sbjct: 333 MRADYKLISKSFARIGNAYLKMDDLKKAIEFYQRSL 368

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 87.0 bits (214), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 43/94 (45%), Positives = 66/94 (70%), Gaps = 1/94 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPT-NAVYYANRAAAHSSMKAYEEAIKDAESAIKTDP 162
           GN A   KD+  AI  ++ AIEV  T N V Y+NR+A ++S K +EEA+KDAE  +K  P
Sbjct: 10  GNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAEECVKISP 69

Query: 163 TYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEG 196
           ++SKGY+R+G A+F L Q ++A ++YK+ L+++ 
Sbjct: 70  SWSKGYNRVGAAQFGLSQLDEAEKSYKRALELDS 103

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 53/93 (56%), Gaps = 4/93 (4%)

Query: 112 DFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRL 171
           D+  A+K Y++ ++  P +A  ++NRAAA + + ++ EAI+D   A+  DP + + Y R 
Sbjct: 395 DWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCNKAVSIDPNFVRAYIRK 454

Query: 172 GYAKFALGQAEDALEAYKKVLDIEGDKASDVMK 204
             A+ A+ +   A+E     L+I  +K + V K
Sbjct: 455 ATAQIAVKEFAAAIE----TLNIAREKDAQVNK 483

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 46/96 (47%), Gaps = 8/96 (8%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTD-- 161
           GNK    + F+ AI+ Y+ A E L  +  Y  NR+AA      Y+ AIK    A++    
Sbjct: 253 GNKLYKARQFEEAIEHYNKAWE-LHKDITYLNNRSAAEFEKGDYDTAIKTLNDAVEQGRE 311

Query: 162 -----PTYSKGYSRLGYAKFALGQAEDALEAYKKVL 192
                 T +K ++R+G A + L     A+E Y + L
Sbjct: 312 LRADYKTIAKSFARIGNAYYKLKDLRKAIEHYNRSL 347

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score = 85.9 bits (211), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 67/119 (56%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN+ M  +D+  AI+ Y++AI   P + +YY+NR+ A+  +  YE AI DA   I  D  
Sbjct: 144 GNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCISIDAN 203

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEK 222
           +SK Y RL   K    Q  DAL+ YKK +++  D   + + R++E  K KV+  + L +
Sbjct: 204 FSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITREFEDLKLKVQTDISLRE 262

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 85.9 bits (211), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/116 (39%), Positives = 75/116 (64%), Gaps = 3/116 (2%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPT-NAVYYANRAAAHSSMKAYEEAIKDAESAIKTDP 162
           GN A A KDF+ AI+ +  AIEV    N V Y+NR+A ++SM+ + EA+ DA+  ++  P
Sbjct: 11  GNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADAQECVRIKP 70

Query: 163 TYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGDK--ASDVMKRDYETAKKKVEQ 216
            +SKG++RLG A + LG  ++A E+YKK L+++     A D + +   T ++++EQ
Sbjct: 71  DWSKGHNRLGAAHYGLGDLDEAEESYKKALELDSSNKAAQDGLAQVQATQQQRMEQ 126

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 56/99 (56%), Gaps = 4/99 (4%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           G +     D+  A+K Y++ I+  P +A  Y+NRAAA + + ++ +AIKD + AI+ DP 
Sbjct: 395 GKEYFTNADWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCDMAIQKDPN 454

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGDKASDV 202
           + + Y R   A+ A+ +   A+E     LD   +K ++V
Sbjct: 455 FVRAYIRKATAQIAVQEYAAAIE----TLDTAREKDAEV 489

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 64/135 (47%), Gaps = 14/135 (10%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAI----- 158
           GN+    + FD AI  Y  A + L  +  Y  NRAAA      YE AIK  E A+     
Sbjct: 261 GNELYKKRQFDEAIANYEKAWD-LHKDITYLNNRAAAEYEKGDYESAIKTLEKAVEEGRE 319

Query: 159 -KTD-PTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGDKASDVMKR----DYETAKK 212
            + D    +K ++RLG A + L   + A+E Y+K L     +  +V+ +    + E  K+
Sbjct: 320 LRADYKVIAKSFARLGNAHYKLADLKKAIEYYEKSLT--EHRTPEVLNKLRSLEKEQKKR 377

Query: 213 KVEQSLDLEKKPETQ 227
           + E  +D EK  E +
Sbjct: 378 EAEAYIDPEKAEEAR 392

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 66/94 (70%), Gaps = 1/94 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPT-NAVYYANRAAAHSSMKAYEEAIKDAESAIKTDP 162
           GN A   K++D AI+K++ AIEV  T N V Y+NR+A ++S K + + ++DA   +K +P
Sbjct: 12  GNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDANECVKINP 71

Query: 163 TYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEG 196
           T+SKGY+R+G A F +G  ++A +AYKK L+++ 
Sbjct: 72  TWSKGYNRVGAAHFGMGDLDEAEKAYKKALELDS 105

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 45/75 (60%)

Query: 112 DFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRL 171
           D+  A+K Y++ I   P++A  Y+NRAAA S + ++ EAI D  +AI+ DP + + Y R 
Sbjct: 404 DWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDCNTAIEKDPNFIRAYIRK 463

Query: 172 GYAKFALGQAEDALE 186
             A+ A+     A+E
Sbjct: 464 ATAQIAIKDFVPAIE 478

 Score = 33.9 bits (76), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 43/96 (44%), Gaps = 8/96 (8%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTD-- 161
           GNK      FD AI+ Y+ A E L  +  Y  NR+AA      Y+ AI+    A++    
Sbjct: 262 GNKLYKAHKFDEAIEHYNKAWE-LHNDITYLNNRSAAEFEKGDYQTAIETLHEAVEKGRE 320

Query: 162 -----PTYSKGYSRLGYAKFALGQAEDALEAYKKVL 192
                   +K ++R+  +   L   + A+  Y+K L
Sbjct: 321 MRADYKLVAKSFTRIANSYMKLNDIKSAINYYQKSL 356

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 84.7 bits (208), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 64/95 (67%), Gaps = 1/95 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPT-NAVYYANRAAAHSSMKAYEEAIKDAESAIKTDP 162
           GN A A KDF  AI+ +++AI    T N V Y+NR+A ++S+K ++EA+ DA+  +K +P
Sbjct: 11  GNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALNDAQQCVKINP 70

Query: 163 TYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGD 197
            +SKGY+R+G A   LG  +DA   YKK L+++ +
Sbjct: 71  DWSKGYNRMGAAHLGLGDLDDAESNYKKALELDSN 105

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 48/84 (57%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           G +     D+  A+K Y++ I+  P +A  Y+NRAAA + + ++ EAIKD E AI+ DP 
Sbjct: 397 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDCEKAIEKDPN 456

Query: 164 YSKGYSRLGYAKFALGQAEDALEA 187
           + + Y R   A+ A+     ALE 
Sbjct: 457 FVRAYLRKATAQIAIKDFVKALET 480

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 63/135 (46%), Gaps = 14/135 (10%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAH-------SSMKAYEEAIKDAES 156
           GNK      FD AI +Y+ A + L  +  Y  NR+AA        ++M    EA++    
Sbjct: 263 GNKLYKSHKFDEAIAEYNKAWD-LHKDITYLNNRSAAEFEKGDFETAMNTLNEAVEQGRE 321

Query: 157 AIKTDPTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGDKASDVMKR----DYETAKK 212
                   +K ++R+G A       + A+E Y+K L     + +D++ +    + E  K+
Sbjct: 322 LRADYKLIAKSFARMGNAYSKQKNLKKAIEYYQKSLT--EHRTADILTKLRTCEKELKKQ 379

Query: 213 KVEQSLDLEKKPETQ 227
           ++E+ ++ EK  E +
Sbjct: 380 EIEEYINPEKAEEAR 394

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 84.0 bits (206), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 44/116 (37%), Positives = 76/116 (65%), Gaps = 3/116 (2%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVL-PTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDP 162
           GN A A KDF+ AI+ ++ AIEV    N V Y+NR+A ++S K + +A++DA+  +  +P
Sbjct: 10  GNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAKQCVNINP 69

Query: 163 TYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEG--DKASDVMKRDYETAKKKVEQ 216
            +SKGY+R+G A F LG  ++A + YKK L+++     A D +++ ++T + + +Q
Sbjct: 70  AWSKGYNRVGAAHFGLGDLDEAEQGYKKALELDSANKAAQDGLEQVHKTQQSRQQQ 125

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 44/75 (58%)

Query: 112 DFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRL 171
           D+  A+K Y++ I+  P +A  Y+NRAAA S + ++ EAIKD   AI  DP + + Y R 
Sbjct: 408 DWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCNVAISKDPNFIRAYIRK 467

Query: 172 GYAKFALGQAEDALE 186
             A+ A+ +    +E
Sbjct: 468 ATAQIAVREFVSVIE 482

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 64/135 (47%), Gaps = 14/135 (10%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTD-- 161
           GNK    + FD AI+ YS A E L  +  Y  NRAAA      YE AIK    A++    
Sbjct: 266 GNKFYKARKFDEAIEHYSKAWE-LHKDITYLNNRAAAEYEKGEYETAIKTLTEAVEQGRE 324

Query: 162 -----PTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGDKASDVMKR----DYETAKK 212
                   SK ++R+G +   L + + A+E Y+K L     +  +++ +    + E  K+
Sbjct: 325 LRADYKVISKSFARIGNSYHKLNELKKAIEFYQKSLT--EHRTPEILTKLRNCEKELKKQ 382

Query: 213 KVEQSLDLEKKPETQ 227
           + E  +D EK  E +
Sbjct: 383 ETEAYIDPEKAEEAR 397

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 84.0 bits (206), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 63/94 (67%), Gaps = 1/94 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPT-NAVYYANRAAAHSSMKAYEEAIKDAESAIKTDP 162
           GN A   KD+D AI  +S AI+V    N V Y+NR+A ++S+K +  A+KDAE  +K +P
Sbjct: 12  GNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAEECVKINP 71

Query: 163 TYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEG 196
           ++SKGY+R+G A F +G  ++A   YKK L+++ 
Sbjct: 72  SWSKGYNRVGAAHFGMGDLDEAEAGYKKALELDA 105

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 51/93 (54%), Gaps = 4/93 (4%)

Query: 112 DFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRL 171
           D+  A+K Y++ I+  P +A  Y+NRAA  S + ++ EAI D   AI+ DP + + Y R 
Sbjct: 412 DWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSFPEAIDDCNKAIEKDPNFVRAYIRK 471

Query: 172 GYAKFALGQAEDALEAYKKVLDIEGDKASDVMK 204
             A+ A+ +   ALE     LD    K ++V K
Sbjct: 472 ATAQIAVREFSSALE----TLDAARSKDAEVNK 500

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 46/96 (47%), Gaps = 8/96 (8%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTD-- 161
           GNK    + FD A+ KY++A E    +  Y  NR+AA      YE +IK  E A++    
Sbjct: 270 GNKLYKARQFDEAVAKYNEAWEAH-NDITYLNNRSAAEFEKGDYETSIKTLEEAVEKGRE 328

Query: 162 -----PTYSKGYSRLGYAKFALGQAEDALEAYKKVL 192
                   +K ++R+G     L   + A++ YKK L
Sbjct: 329 MRADYKVIAKSFARMGNCYTKLNDLKKAIDFYKKSL 364

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 84.0 bits (206), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 63/94 (67%), Gaps = 1/94 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPT-NAVYYANRAAAHSSMKAYEEAIKDAESAIKTDP 162
           GN A   KD+D AI+ ++ AIEV  T N V Y+NR+A ++S+K + +A+ DA   +K +P
Sbjct: 12  GNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDANECVKINP 71

Query: 163 TYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEG 196
           ++SKGY+RLG A   LG  ++A   YKK L+++ 
Sbjct: 72  SWSKGYNRLGAAHLGLGDLDEAESNYKKALELDA 105

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 47/83 (56%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           G +     D+  A+K Y++ I+  P +A  Y+NRAAA + + ++ EAI D   AI+ DP 
Sbjct: 403 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 164 YSKGYSRLGYAKFALGQAEDALE 186
           + + Y R   A+ A+ +   ALE
Sbjct: 463 FVRAYIRKATAQIAVKEYASALE 485

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 56/121 (46%), Gaps = 12/121 (9%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTD-- 161
           GNK    + FD AI+ Y+ A E L  +  Y  NRAAA      YE AI     A++    
Sbjct: 269 GNKFYKARQFDEAIEHYNKAWE-LHKDITYLNNRAAAEYEKGEYETAISTLNDAVEQGRE 327

Query: 162 -----PTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGDKASDVMK--RDYETAKKKV 214
                   SK ++R+G A   LG  +  +E Y+K L     + +D++   R+ E   KK 
Sbjct: 328 MRADYKVISKSFARIGNAYHKLGDLKKTIEYYQKSLT--EHRTADILTKLRNAEKELKKA 385

Query: 215 E 215
           E
Sbjct: 386 E 386

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 83.6 bits (205), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 44/113 (38%), Positives = 73/113 (64%), Gaps = 3/113 (2%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLP-TNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDP 162
           GN A + K+++ A+  +S AIEV P  N V Y+NR+A ++S+K + +A+ DA    K +P
Sbjct: 12  GNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDANECTKINP 71

Query: 163 TYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVE 215
           T+SKGY+R+G A + LG  ++A ++YKK L++  D ++ V +   E  K+  E
Sbjct: 72  TWSKGYNRVGAAHYGLGDLDEAEKSYKKALEL--DASNKVAQEGLEQVKRTQE 122

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/87 (37%), Positives = 50/87 (57%), Gaps = 4/87 (4%)

Query: 116 AIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAK 175
           A+K Y++ I   P +A  Y+NRAAA S + ++ EAI D E A++ DP + K Y R   A+
Sbjct: 411 AVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCEKALEKDPNFVKAYIRKATAQ 470

Query: 176 FALGQAEDALEAYKKVLDIEGDKASDV 202
            A+ +   ALE     LDI   K +++
Sbjct: 471 IAIKEYSSALE----TLDIARSKDTEL 493

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 42/96 (43%), Gaps = 8/96 (8%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTD-- 161
           GNK      FD AI+ Y  A E L  +  Y  N+AAA      YE  IK  E AI+    
Sbjct: 265 GNKLYKAHKFDEAIEHYDKAWE-LHNDITYLNNKAAAQYEKGDYETTIKTLEDAIEKGRE 323

Query: 162 -----PTYSKGYSRLGYAKFALGQAEDALEAYKKVL 192
                   +K ++R+G A   L   + A E + K L
Sbjct: 324 LRADYKIIAKAFTRMGNAYEKLNDLKKAAEFFNKSL 359

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 63/94 (67%), Gaps = 1/94 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPT-NAVYYANRAAAHSSMKAYEEAIKDAESAIKTDP 162
           GN A   KD+D AI+ ++ AIEV  T N V Y+NR+A ++S+K + +A+ DA+  I  +P
Sbjct: 12  GNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAKECININP 71

Query: 163 TYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEG 196
           ++SKGY+RLG A   LG  ++A   YKK L+++ 
Sbjct: 72  SWSKGYNRLGAAHLGLGDLDEAENNYKKALELDA 105

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 51/91 (56%), Gaps = 4/91 (4%)

Query: 112 DFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRL 171
           D+  A+K Y++ I+  P +A  Y+NRAAA + + ++ EAI D   AI+ DP + + Y R 
Sbjct: 411 DWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRK 470

Query: 172 GYAKFALGQAEDALEAYKKVLDIEGDKASDV 202
             A+ A+ +   ALE     LD    K +DV
Sbjct: 471 ATAQIAVQEYAAALE----TLDAARTKDADV 497

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 56/121 (46%), Gaps = 12/121 (9%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTD-- 161
           GNK    + FD AI+ Y+ A E L  +  Y  NRAAA      Y+ AI     A++    
Sbjct: 269 GNKFYKARQFDEAIEHYNKAWE-LHRDITYLNNRAAAEYEKGEYKTAIATLNDAVEQGRE 327

Query: 162 -----PTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGDKASDVMK--RDYETAKKKV 214
                   S+ ++R+G A   LG  +  +E Y+K L     + +D++   R+ E   KK 
Sbjct: 328 MRADYKVISRSFARIGNAYHKLGDLKKTIEYYQKSL--TEHRTADILTKLRNAEKELKKA 385

Query: 215 E 215
           E
Sbjct: 386 E 386

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 80.5 bits (197), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 64/95 (67%), Gaps = 1/95 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPT-NAVYYANRAAAHSSMKAYEEAIKDAESAIKTDP 162
           GN A A K +D A+  ++ AIEV  T N V Y+NR+A+++S + + EA+KDA    K +P
Sbjct: 12  GNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDALECTKINP 71

Query: 163 TYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGD 197
           +++KGY+R G A F +G  +DA  +YKK L+++ +
Sbjct: 72  SWAKGYTREGAAHFGMGNLDDAEASYKKALELDAN 106

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 44/75 (58%)

Query: 112 DFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRL 171
           D+  A+K Y++ I+  P +A  Y+NRAAA S + ++ +AI D   AI+ DP + + Y R 
Sbjct: 400 DWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCNKAIEKDPNFVRAYIRK 459

Query: 172 GYAKFALGQAEDALE 186
             A+ A+     A+E
Sbjct: 460 ATAQIAVKDFSYAIE 474

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 47/96 (48%), Gaps = 8/96 (8%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTD-- 161
           GNKA   ++FD AI  Y+ A E L  N  Y  NR+AA      Y+ AI     AI+    
Sbjct: 258 GNKAYKARNFDEAIACYNKAWE-LDNNITYLNNRSAAEFEKGEYDTAINTLNEAIEKGRE 316

Query: 162 -----PTYSKGYSRLGYAKFALGQAEDALEAYKKVL 192
                   +K ++R+G A   +G  ++A+  Y+K L
Sbjct: 317 MRADYKIIAKSFARIGNAYVKMGNLKEAINHYQKSL 352

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 79.7 bits (195), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 63/94 (67%), Gaps = 1/94 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPT-NAVYYANRAAAHSSMKAYEEAIKDAESAIKTDP 162
           GN A   KD++ A + +  AI+V    N V Y+NR+A ++S+K + E +KDAE  +K +P
Sbjct: 11  GNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKDAEECVKINP 70

Query: 163 TYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEG 196
            +SKGY+R+G A+F L   EDA ++Y+K L+++ 
Sbjct: 71  GWSKGYNRVGAAQFGLNNLEDAEKSYQKALELDS 104

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 50/88 (56%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           G +  +  D+  A+K Y++ I+  P +A  Y+NRAAA + + ++ EAI D + AI+ DP 
Sbjct: 389 GKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCDRAIEKDPN 448

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKV 191
           + + Y R   A+ A+ +   A+E    V
Sbjct: 449 FIRAYIRKASAQIAVKEFAAAVETLDTV 476

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 67/135 (49%), Gaps = 14/135 (10%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAI----- 158
           GNK    + FD AI+ Y+ A E L  +  Y  NRAAA      YE AI    +A+     
Sbjct: 255 GNKFYKARKFDEAIEHYNKAWE-LHKDITYLNNRAAAEYEKGDYETAIATLTNAVDEGRE 313

Query: 159 -KTD-PTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGDKASDVMKR----DYETAKK 212
            + D    +K ++R+G A   LG  + ++  Y+K L     +++DV+ +    + E  K+
Sbjct: 314 MRADYKVIAKSFARIGNAYHKLGDLKKSINFYQKSLT--EHRSADVLNKLRNAEKELKKQ 371

Query: 213 KVEQSLDLEKKPETQ 227
           + E+ +D EK  E +
Sbjct: 372 EAEEYVDPEKAEEAR 386

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 60/94 (63%), Gaps = 1/94 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPT-NAVYYANRAAAHSSMKAYEEAIKDAESAIKTDP 162
           GN A   KD+  AI  ++ AIEV    N V Y+NR+A ++S+K + +A+ DA   +K +P
Sbjct: 12  GNAAFTAKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALNDATECVKINP 71

Query: 163 TYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEG 196
           ++SKGY+RLG A   LG  +DA   YKK L+++ 
Sbjct: 72  SWSKGYNRLGAAHLGLGDLDDAESNYKKALELDA 105

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 47/83 (56%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           G +     D+  A+K Y++ I+  P +A  Y+NRAAA + + ++ EAI D   AI+ DP 
Sbjct: 400 GKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 459

Query: 164 YSKGYSRLGYAKFALGQAEDALE 186
           + + Y R   A+ A+ +   ALE
Sbjct: 460 FVRAYIRKATAQIAVQEFAGALE 482

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 56/121 (46%), Gaps = 12/121 (9%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTD-- 161
           GNK    + F+ AI+ Y+ A E L  +  Y  NRAAA      YE AI     A++    
Sbjct: 266 GNKFYKARQFEEAIEHYNKAWE-LHRDITYLNNRAAAEYEKGDYETAIATLTDAVEQGRE 324

Query: 162 -----PTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGDKASDVMK--RDYETAKKKV 214
                   SK ++R+G A   LG  +  ++ Y+K L     + +D++   R+ E   KK 
Sbjct: 325 MRADYKVISKSFARIGNAYHKLGDLKKTIDNYQKSLT--EHRTADILTKLRNAEKELKKA 382

Query: 215 E 215
           E
Sbjct: 383 E 383

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 78.6 bits (192), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 39/93 (41%), Positives = 61/93 (65%), Gaps = 1/93 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPT-NAVYYANRAAAHSSMKAYEEAIKDAESAIKTDP 162
           GN A   KD++ A + ++ AIE     N V Y+NR+A  +S+K + EA+ DA   +K +P
Sbjct: 10  GNAAFVAKDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDANECVKINP 69

Query: 163 TYSKGYSRLGYAKFALGQAEDALEAYKKVLDIE 195
            +SKGY+R+G A F LG+ ++A + YKK L+I+
Sbjct: 70  AWSKGYNRVGAAYFGLGKLDEAEQGYKKALEID 102

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 63/118 (53%), Gaps = 4/118 (3%)

Query: 112 DFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRL 171
           D+  A+K Y++  +  P +A  Y+NRAAA + + ++ EAIKD + AI  DP + + Y R 
Sbjct: 416 DWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDCDMAISKDPNFIRAYIRK 475

Query: 172 GYAKFALGQAEDALEAY--KKVLDIEGDKASDVMKRD--YETAKKKVEQSLDLEKKPE 225
             A+ A+ +   A+E     +  D E +  ++V + D  Y  A ++  Q  D  + PE
Sbjct: 476 ATAQIAVREFASAIETLDAARAKDTELNNGANVREIDQLYIKASQQRFQPQDPNETPE 533

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 47/96 (48%), Gaps = 8/96 (8%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTD-- 161
           GNK    + FD AI+ Y+ A + L  +  Y  NR+AA      YE+AIK    A++    
Sbjct: 274 GNKFYKARKFDEAIEHYNKAWD-LHKDVTYLNNRSAAEYEKGDYEQAIKTLTEAVEQGRE 332

Query: 162 -----PTYSKGYSRLGYAKFALGQAEDALEAYKKVL 192
                   SK ++R+G A   L   + A+E Y+K L
Sbjct: 333 MRADYKLISKSFARIGNAYLKLEDFKKAIEFYQKSL 368

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 78.2 bits (191), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 63/97 (64%), Gaps = 1/97 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPT-NAVYYANRAAAHSSMKAYEEAIKDAESAIKTDP 162
           GN A   KD+  AI  ++ AIEV  T N V Y+NR+AA++S K YE+A+ DA+  IK +P
Sbjct: 12  GNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSDADECIKINP 71

Query: 163 TYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGDKA 199
           +++KGY+R G A   L + E+A + Y + L I+ + A
Sbjct: 72  SWAKGYTRKGAALQGLHKYEEAEQCYNETLKIDPNNA 108

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 45/75 (60%)

Query: 112 DFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRL 171
           D+  A+K Y++ I+  P +A  Y+NRAAA + + ++ +AI D   AI+ DP++ + Y R 
Sbjct: 400 DWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDCNKAIEKDPSFIRAYLRK 459

Query: 172 GYAKFALGQAEDALE 186
              + A+ +   A+E
Sbjct: 460 ATCQIAVKEFAGAIE 474

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 46/96 (47%), Gaps = 8/96 (8%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAI----- 158
           GNKA   + FD AI  Y+ A E    +  Y  NR+AA      YE  IK    A+     
Sbjct: 258 GNKAYKARQFDEAISHYNQAWETF-KDITYLNNRSAAEYEKGDYETCIKTLTEAVENARE 316

Query: 159 -KTD-PTYSKGYSRLGYAKFALGQAEDALEAYKKVL 192
            +TD    +K ++R+G A   L   + A+E Y+K L
Sbjct: 317 LRTDYKIVAKSFARMGNAYAKLDDLKKAIEYYQKSL 352

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 78.2 bits (191), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 62/94 (65%), Gaps = 1/94 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAI-EVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDP 162
           GN A   KDF  A++ +++AI E    N V Y+NR+ A++S+K ++EA+ DA   +K   
Sbjct: 11  GNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDATECVKIKA 70

Query: 163 TYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEG 196
            +SKG++RLG A F LG  ++A E+YKK L+++ 
Sbjct: 71  DWSKGHNRLGAAHFGLGNLDEAEESYKKALELDA 104

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 54/91 (59%), Gaps = 4/91 (4%)

Query: 112 DFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRL 171
           D+  A+K YS+ I   P +A  Y+NRAAA S + ++ +AIKD + AI+ DP++ + Y R 
Sbjct: 407 DWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCDKAIEIDPSFVRAYIRK 466

Query: 172 GYAKFALGQAEDALEAYKKVLDIEGDKASDV 202
             A+ A+ +   A+E     LD+   K ++V
Sbjct: 467 ATAQIAVQEYSAAIE----TLDVARTKDAEV 493

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 61/130 (46%), Gaps = 14/130 (10%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTD-- 161
           GN+    + FD AI KY +A   L  +  Y  NRAAA      Y  AIK    A++    
Sbjct: 265 GNQLYKQRKFDEAIAKYEEAWN-LQKDITYLNNRAAAEYEKGDYNSAIKTLNEAVEQGRE 323

Query: 162 -----PTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGDKASDVMKR----DYETAKK 212
                   +K ++RLG A + L + + A+E Y+K L     +  DV+ +    + E  K+
Sbjct: 324 LRADYKVIAKSFARLGNAYYKLDEVKKAVEYYEKSLT--EHRTPDVLNKLRNLEREIKKR 381

Query: 213 KVEQSLDLEK 222
           + E  +D EK
Sbjct: 382 EAEAYIDPEK 391

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 77.8 bits (190), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 64/95 (67%), Gaps = 1/95 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPT-NAVYYANRAAAHSSMKAYEEAIKDAESAIKTDP 162
           GN A   K++D AI+ ++ AIEV  T + V ++NR+A ++S+K + +A+ DA   +K +P
Sbjct: 12  GNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDANECVKINP 71

Query: 163 TYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGD 197
           ++SKGY+RLG A   LG  ++A   YKK L+++ +
Sbjct: 72  SWSKGYNRLGAAHLGLGDLDEAESDYKKALELDAN 106

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 56/101 (55%), Gaps = 4/101 (3%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           G +     D+  A+K Y++ I+  P +A  Y+NRAAA + + ++ EAI D   AI+ DP 
Sbjct: 403 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGDKASDVMK 204
           + + Y R+  A+ A+ +   ALE     LD+   K ++V K
Sbjct: 463 FVRAYIRMAAAQIAVKEFAAALE----TLDVARTKDAEVNK 499

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 55/121 (45%), Gaps = 12/121 (9%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTD-- 161
           GNK      FD AI+ Y+ A E L  +  Y  NRAAA      YE  I     A++    
Sbjct: 269 GNKFYKAHQFDEAIEHYNRAWE-LHKDITYLNNRAAAEYEKGDYETVIATLNDAVEKGRD 327

Query: 162 -----PTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGDKASDVMK--RDYETAKKKV 214
                   SK ++R+G A   LG  +  +E Y+K L     + +D++   R+ E  +KK 
Sbjct: 328 MRADYKVISKSFARIGNAYHKLGDLKKTIEYYQKSLT--EHRTADILAKLRNVEKEQKKA 385

Query: 215 E 215
           E
Sbjct: 386 E 386

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPT-NAVYYANRAAAHSSMKAYEEAIKDAESAIKTDP 162
           GN+A A KD+  AI+ ++ AIEV    N V ++NR+A ++S K + +A+ DA   +K +P
Sbjct: 10  GNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDANECVKINP 69

Query: 163 TYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEG 196
           +++KGY+RLG A + LG  ++A ++YKK L+++ 
Sbjct: 70  SWAKGYNRLGAAHYGLGDLDEAEQSYKKALELDS 103

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 47/83 (56%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           G +     D+  A++ Y++ I+  P +A  Y+NRAAA S + ++ +AI+D + AI+ DP 
Sbjct: 396 GKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCDKAIEKDPN 455

Query: 164 YSKGYSRLGYAKFALGQAEDALE 186
           + + Y R    + A+     A+E
Sbjct: 456 FVRAYIRKATGQIAIKDYAGAIE 478

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 65/135 (48%), Gaps = 14/135 (10%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTD-- 161
           GNK    + FD AI+KY++A E    +  Y  NRAAA      YE AI+    A++    
Sbjct: 262 GNKLYKQRKFDEAIEKYNEAWETH-NDITYLNNRAAAEYEKGDYEAAIETLTKAVEQGRE 320

Query: 162 -----PTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGDKASDVMKR----DYETAKK 212
                   SK ++R+G +   LG  + A++ Y+K L     +  D++ +    + E  +K
Sbjct: 321 LRADYKVISKSFARMGNSYHKLGDLKKAIDYYEKSLT--EHRTPDILTKLRNTEKELKQK 378

Query: 213 KVEQSLDLEKKPETQ 227
           + E  +D EK  E +
Sbjct: 379 EAESYMDPEKAEEAR 393

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 56/92 (60%), Gaps = 1/92 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTN-AVYYANRAAAHSSMKAYEEAIKDAESAIKTDP 162
           GNK    K ++ A+  ++ A+    TN  + Y+NRAAAH  +K Y EA++D ++ ++  P
Sbjct: 15  GNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGKNCVELAP 74

Query: 163 TYSKGYSRLGYAKFALGQAEDALEAYKKVLDI 194
            + KGYSR+G A   L + ++A E +KK L +
Sbjct: 75  NWDKGYSRVGVAYLGLQKLDEAEENFKKALQL 106

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 46/85 (54%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           G +    +++  A+K Y++ I+  PT+ V + NRAA    +    + I D + AI  DP+
Sbjct: 436 GKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKAISVDPS 495

Query: 164 YSKGYSRLGYAKFALGQAEDALEAY 188
           Y K Y R G+A+      ++ALE +
Sbjct: 496 YIKAYVRKGFAQITERDLDEALETW 520

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 1/82 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN+    KDF+ AI+ Y+ AI  L  + V+Y+NR+AA+ S+  +E+ ++D  +A+K  P 
Sbjct: 111 GNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPD 169

Query: 164 YSKGYSRLGYAKFALGQAEDAL 185
           YSK + R   A   LGQ  DA+
Sbjct: 170 YSKCWLRRASAYENLGQFSDAM 191

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 52/89 (58%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN A+  +D+  AI+ Y++AI++  T ++Y++NRA  H  M  ++  I D + A++ DP 
Sbjct: 19  GNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDKALEIDPK 78

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVL 192
             K Y R G +   L + ++A +  K VL
Sbjct: 79  NIKAYHRRGMSYIGLLEFKNAQKDLKIVL 107

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 61/114 (53%), Gaps = 4/114 (3%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GNK +  +DF  A + Y+ AIE  PT +++Y+NRA A+  +  +  A+ D  +AI+ + +
Sbjct: 16  GNKFLKQQDFQRANELYTKAIETDPTQSIFYSNRALANLKLDNFMNALNDCTNAIELNSS 75

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGDKASDVM-KRDYETAKKKVEQ 216
             K Y R G A   L   + A   +  VL     K +D++ K  ++T +K + +
Sbjct: 76  NLKAYHRRGLANIGLLNFKSARNDFNIVLKY---KPNDIIAKNGFDTCEKVIRE 126

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 62/120 (51%), Gaps = 7/120 (5%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN  +  K+F  A + YS AIE+  T ++Y++NRA AH  +  ++ A+ D   AI+ DP 
Sbjct: 19  GNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDCNKAIELDPK 78

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDIE-----GDKASDVMKRDYETAKKKVEQSL 218
             K Y R G +   L +   A +  K VL  +       +A DV +R     K+K E+++
Sbjct: 79  NVKAYHRRGLSYIGLLEFNKARKDLKIVLRAKPNEPVATRALDVCER--VIRKEKFEKAI 136

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 48/81 (59%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN  +  K F  AI+KY++AI++  T ++Y++NRA AH  +  ++ A+ D + AIK DP 
Sbjct: 19  GNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPK 78

Query: 164 YSKGYSRLGYAKFALGQAEDA 184
             K Y R   +  AL + + A
Sbjct: 79  NIKAYHRRALSCMALLEFKKA 99

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 45/75 (60%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN  +  K F  AI+KY++AI++  T ++Y++NRA AH  +  ++ A+ D + AIK DP 
Sbjct: 19  GNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPK 78

Query: 164 YSKGYSRLGYAKFAL 178
             K Y R   +  AL
Sbjct: 79  NIKAYHRRALSCMAL 93

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 47/81 (58%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN  +  K F  AI+KY++AI++  T  +Y++NRA +H  +  ++ A+ D + AIK DP 
Sbjct: 19  GNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCDEAIKLDPK 78

Query: 164 YSKGYSRLGYAKFALGQAEDA 184
             K Y R   +  AL + + A
Sbjct: 79  NIKAYHRRALSCMALLEFKKA 99

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 46/71 (64%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GNK +A KD+  AI+ Y+ AIE+    +++++NRA A+  +  ++ A++D+  AI+ D +
Sbjct: 16  GNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSKAIELDSS 75

Query: 164 YSKGYSRLGYA 174
             KGY R G A
Sbjct: 76  NVKGYHRRGMA 86

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 44/75 (58%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN  +  K F  AI+KY+ AI++  T ++Y++NRA AH  +  ++ A+ D + A+K DP 
Sbjct: 19  GNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEALKLDPK 78

Query: 164 YSKGYSRLGYAKFAL 178
             K Y R   +  AL
Sbjct: 79  NIKAYHRRALSCMAL 93

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 56/107 (52%), Gaps = 5/107 (4%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN  +  +DF  AI  Y+ AI +  T ++Y++NRA AH  +  ++ ++ D + A+K DP 
Sbjct: 19  GNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSSLNDCDEALKLDPK 78

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVL-----DIEGDKASDVMKR 205
            +K Y R G +   L + + A    + VL     D    +A DV ++
Sbjct: 79  NAKAYHRRGLSYIGLLEFKKAKNDLQIVLKAKPGDATASRALDVCEK 125

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 49/89 (55%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN  +  +++  AI+ YS AIE+ PT +++++NRA A   +  ++  + D + A++ DP 
Sbjct: 19  GNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQSCMNDCDVALRLDPK 78

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVL 192
             K Y R G +   L Q + A    + VL
Sbjct: 79  NIKAYHRRGLSHLGLLQCKKARNDLQVVL 107

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 43/75 (57%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN  +  +D+  AI+ Y+ AIE+  T++++Y+NRA AH  +  ++ A+ D   AIK D  
Sbjct: 19  GNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDCNDAIKLDNN 78

Query: 164 YSKGYSRLGYAKFAL 178
             K Y R G A   L
Sbjct: 79  NIKAYHRRGLAYVGL 93

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 42/75 (56%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN  +  +D+  AI+KY  AIE+  T +VY++NRA  H  +  ++ A +D + A+  DP 
Sbjct: 16  GNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDKALALDPK 75

Query: 164 YSKGYSRLGYAKFAL 178
             K Y R G A   L
Sbjct: 76  NVKAYHRRGLACVGL 90

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 41/69 (59%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN+ +   D+D AI+ YS AI +  T ++Y++NRA AH     +  A+ D ++A+K DP 
Sbjct: 19  GNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYSAVVDCDNALKLDPK 78

Query: 164 YSKGYSRLG 172
             K Y R G
Sbjct: 79  NIKAYHRRG 87

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN+    K F+ A+K YS AIEV   + V+Y+NR+A + S+   E+ ++D  +A+K  P 
Sbjct: 103 GNEFFKNKQFEDALKYYSLAIEV-KEDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPD 161

Query: 164 YSKGYSRLGYAKFALGQAEDAL 185
           YSK   R   A  +LG+  DA+
Sbjct: 162 YSKCLLRRASANESLGKFADAM 183

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN+    K +D AI+ YS AIEV   + V+Y+NR+A + S+   E+ ++D  +A+K  P 
Sbjct: 102 GNEFFKNKKYDEAIQYYSWAIEV-KEDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPD 160

Query: 164 YSKGYSRLGYAKFALGQAEDAL 185
           YSK   R   A  +LG   DA+
Sbjct: 161 YSKCLLRRASANESLGNFADAM 182

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 43/75 (57%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GNK +  K +  A++ Y+ AIE+  T +++++NRA A   +  ++  + D  SA++ DP 
Sbjct: 20  GNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNSALELDPK 79

Query: 164 YSKGYSRLGYAKFAL 178
             K Y R G ++  L
Sbjct: 80  NIKAYHRRGLSQLGL 94

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 48/94 (51%), Gaps = 1/94 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN     K+FD AIK Y  AIE+ P + V+Y+N +A + S     + ++    A++  P 
Sbjct: 132 GNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPD 191

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGD 197
           +SK   R   A  +LG   DA+     VL + GD
Sbjct: 192 HSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 224

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 31/61 (50%)

Query: 145 KAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGDKASDVMK 204
           K +++AIK  + AI+ DP     YS +     + G     +E   K L+I+ D +  +++
Sbjct: 139 KNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLR 198

Query: 205 R 205
           R
Sbjct: 199 R 199

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN+    K FD AIK Y+ A+E L  + V+Y+NR+A + SM   E+ ++D  +A+K    
Sbjct: 109 GNEFFKEKKFDDAIKYYNLALE-LKKDPVFYSNRSACYVSMGQLEKVVEDTTAALKLKSD 167

Query: 164 YSKGYSRLGYAKFALGQAEDAL 185
           YSK   R   A  +LG   DA+
Sbjct: 168 YSKCLLRRASANESLGNYADAM 189

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 48/94 (51%), Gaps = 1/94 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN     K+F+ AIK Y  AIE+ P   V+Y+N +A + S    E+ I+    A++  P 
Sbjct: 134 GNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPD 193

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGD 197
           +SK   R   A  +LG   DA+     VL + GD
Sbjct: 194 HSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 226

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 36/75 (48%)

Query: 131 AVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQAEDALEAYKK 190
           AV   NR     + K + EAIK  + AI+ DP     YS +     + G  E  +E   K
Sbjct: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTK 186

Query: 191 VLDIEGDKASDVMKR 205
            L+I+ D +  +++R
Sbjct: 187 ALEIKPDHSKALLRR 201

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 44/75 (58%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN+ +  KD+  A++ Y+ AIE   T +++++NRA A+  +  ++ A++D+  AI+ D  
Sbjct: 45  GNEWVKAKDYARAVEAYTRAIEADGTQSIFFSNRALANLKLDRFQSALEDSARAIELDAG 104

Query: 164 YSKGYSRLGYAKFAL 178
             K Y R G A   L
Sbjct: 105 NVKAYHRRGLAHCGL 119

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN+      F+ AIK Y  A++ L  + +YY+N +A ++S+  YE+ I+ A  A+K  PT
Sbjct: 117 GNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPT 175

Query: 164 YSKGYSRLGYAKFALGQAEDAL 185
           +SK   R   A  A+G   DA+
Sbjct: 176 FSKVLMRRALAYEAMGNFGDAM 197

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 59/130 (45%), Gaps = 19/130 (14%)

Query: 104 GNKAMACKDFDLAIKKYSDAIE----VLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIK 159
           GN     K F  A + Y+  IE    V   N   YANRAA    +K +   I D ++A+ 
Sbjct: 85  GNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRSCISDCKTALT 144

Query: 160 TDPTYSKGYSRLGYAKFALGQAEDALE-------------AYKKVLDIEGDKASDVMKRD 206
            +P   K Y R+G A  A+ + E A E             +++ +L+I  +K  ++  R 
Sbjct: 145 YNPKNIKCYFRMGKAFTAINKFESARESIEFGQKIDNDNKSFENLLNIIKNKEEEI--RK 202

Query: 207 YETAKKKVEQ 216
           YE  K K +Q
Sbjct: 203 YEEKKLKAQQ 212

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 55/107 (51%), Gaps = 5/107 (4%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN  +  +DF  A + Y+ AIE+  T +++++NRA AH     ++ ++ D + A++ D  
Sbjct: 19  GNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCDKALELDSK 78

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVL-----DIEGDKASDVMKR 205
             K Y R G +   L + + A    K VL     D+  D+A  + ++
Sbjct: 79  NIKAYHRRGLSYVGLLEFKKARTDLKTVLKSKPGDVAADRALQICEK 125

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN     KDF+ AIK Y+ A+  L  + VYY+N +A +SS+  YE+ I+ A  A+   P 
Sbjct: 102 GNALFKKKDFENAIKYYTFALS-LKEDPVYYSNISACYSSLLNYEKVIEMATKALALRPD 160

Query: 164 YSKGYSRLGYAKFALGQAEDAL 185
           YSK   R   A   LG   DA+
Sbjct: 161 YSKVLVRRANAYEKLGNFGDAM 182

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 46/95 (48%), Gaps = 11/95 (11%)

Query: 117 IKKYSDAIEVL-----------PTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYS 165
           +K+Y DA E+              N   ++NRAA    +K Y   + D   A++ +PT  
Sbjct: 91  VKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELELKNYRRCVNDCRQALQFNPTNI 150

Query: 166 KGYSRLGYAKFALGQAEDALEAYKKVLDIEGDKAS 200
           K + R+  A F L + EDA EA +  L ++ + A+
Sbjct: 151 KCFYRIARAFFLLDKCEDAKEAIEFGLKLDSESAA 185

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 39/75 (52%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN  +  +++  AI+ Y+ AIE+ P  +++Y+NRA A   +  ++ A  D   A+  D  
Sbjct: 19  GNVFIKEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLDNFQSAYNDCNEALTLDSK 78

Query: 164 YSKGYSRLGYAKFAL 178
             K Y R G A   L
Sbjct: 79  NVKAYHRRGLANVGL 93

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 61/124 (49%), Gaps = 6/124 (4%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVL----PTNAVYYANRAAAHSSMKAYEEAIKDAESAIK 159
           GN     K F  A + YS  I+V       N   YANRAA    +K Y   I D + A++
Sbjct: 88  GNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCINDCKQALQ 147

Query: 160 TDPTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEG-DKASDVMKRDYETAKKKVE-QS 217
            +P   K Y R+  A  AL + ++ALE+ +    I+  +K+   +K   ET + ++E + 
Sbjct: 148 LNPKNIKCYYRIAKAFTALERLDEALESIEFGEKIDNTNKSLKTLKLHIETKQLEIEARR 207

Query: 218 LDLE 221
           L LE
Sbjct: 208 LKLE 211

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN+    K ++ AIK YS A+  L  + V+Y+NR+A    +   E+ ++D  +A++  P 
Sbjct: 105 GNECFKEKKYEEAIKYYSCALR-LKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPD 163

Query: 164 YSKGYSRLGYAKFALGQAEDAL 185
           YSK   R   A  +LG   DA+
Sbjct: 164 YSKCLLRRATANESLGNFADAM 185

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 47/94 (50%), Gaps = 1/94 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN     K F  AIK Y  AIE+ P + V+Y+N +A + S    ++ ++    A++  P 
Sbjct: 138 GNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPD 197

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGD 197
           +SK   R   A  +LG   DA+     VL + GD
Sbjct: 198 HSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 230

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 37/75 (49%)

Query: 131 AVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQAEDALEAYKK 190
           AV   ++     + K++ +AIK  + AI+ DP     YS +     + G  +  +E   K
Sbjct: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTK 190

Query: 191 VLDIEGDKASDVMKR 205
            L+I+ D +  +++R
Sbjct: 191 ALEIKPDHSKALLRR 205

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 40/88 (45%), Gaps = 4/88 (4%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVL----PTNAVYYANRAAAHSSMKAYEEAIKDAESAIK 159
           GN     K F  A   Y+  IE+       N   +ANRAA    +K Y   I D + A+ 
Sbjct: 87  GNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLELKNYRSCINDCKHALT 146

Query: 160 TDPTYSKGYSRLGYAKFALGQAEDALEA 187
            +P   K Y R+G A + L   E+A E+
Sbjct: 147 LNPKNIKCYYRMGKAFYLLNNIEEAKES 174

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 47/94 (50%), Gaps = 1/94 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN     K+F  AIK Y  AIE+ P + V+Y+N +A + S     + ++    A++  P 
Sbjct: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPD 190

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGD 197
           +SK   R   A  +LG   DA+     VL + GD
Sbjct: 191 HSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 223

 Score = 36.6 bits (83), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 36/77 (46%)

Query: 129 TNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQAEDALEAY 188
           T AV   N+     + K + EAIK  + AI+ DP     YS +     + G     LE  
Sbjct: 122 TYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYT 181

Query: 189 KKVLDIEGDKASDVMKR 205
            K L+I+ D +  +++R
Sbjct: 182 TKALEIKPDHSKALLRR 198

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 51/97 (52%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN  +  K +  A++ YS AIE+  T +++++NRA +   +  +  A++D   +I+ DP 
Sbjct: 19  GNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCNKSIELDPK 78

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGDKAS 200
             K   R G +   L +   A +  K +L ++ ++ S
Sbjct: 79  NIKAIHRRGLSYVGLLEFSKARKDLKTILQVKPNEQS 115

 Score = 30.8 bits (68), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 46/104 (44%), Gaps = 6/104 (5%)

Query: 131 AVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQAEDALEAYKK 190
           A+ + N+  A    K Y EA++    AI+ D T S  +S   +++  L     ALE   K
Sbjct: 12  ALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCNK 71

Query: 191 VLDIEGDKASDVMKRD------YETAKKKVEQSLDLEKKPETQA 228
            ++++      + +R        E +K + +    L+ KP  Q+
Sbjct: 72  SIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTILQVKPNEQS 115

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 41/85 (48%), Gaps = 4/85 (4%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEV----LPTNAVYYANRAAAHSSMKAYEEAIKDAESAIK 159
           GN     K F  A + Y+  IE+       N   YANRAA    +K Y   + D ++A++
Sbjct: 85  GNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNYRRCLNDCKTALQ 144

Query: 160 TDPTYSKGYSRLGYAKFALGQAEDA 184
            +P   K Y R+G A  AL   E+A
Sbjct: 145 YNPKNLKCYYRMGKAFLALELLEEA 169

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN+    + ++ AIK Y  A++ L  + V+Y+NR+A +  +   E+ ++D  +A+K  P 
Sbjct: 102 GNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPD 160

Query: 164 YSKGYSRLGYAKFALGQAEDAL 185
           YSK   R   A  +LG   DA+
Sbjct: 161 YSKCLLRRATANESLGNYADAM 182

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 46/94 (48%), Gaps = 2/94 (2%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN       F+ AIK Y+ AIE L  N ++Y+N +A + S+   EE IK    A++  P 
Sbjct: 118 GNSLFKADKFEEAIKYYNWAIE-LKENPIFYSNLSACYVSLNKLEEIIKYCNKALELKPD 176

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGD 197
           YSK   R   A   L    DA+     VL + GD
Sbjct: 177 YSKVLLRRANANEKLENYADAMFDL-SVLSLNGD 209

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 2/94 (2%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GNK    KD+  AIK Y+ A++ L  + ++Y+N +A + S+   ++ I+ +  A++ +P 
Sbjct: 129 GNKYFKAKDYTNAIKYYNLALD-LNKDPIFYSNISACYVSLGQLDKVIESSTKALELNPN 187

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGD 197
           YSK   R   A  +L    DAL     VL + GD
Sbjct: 188 YSKALLRRASANESLENYSDALFDL-SVLSLNGD 220

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 50/97 (51%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN  +  K +  A++ YS AIE+  T ++Y++NRA +   +  +  A +D + AI  DP 
Sbjct: 17  GNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCDKAIALDPK 76

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGDKAS 200
             K   R G +   L +   A +  + VL ++ ++ S
Sbjct: 77  NIKAIHRRGLSYVGLLEFFKARKDLRVVLQVKPNEQS 113

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 41/88 (46%), Gaps = 4/88 (4%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVL----PTNAVYYANRAAAHSSMKAYEEAIKDAESAIK 159
           GN     K F  A + Y+ AI+V       N   YANRAA    +K Y   I D + A+ 
Sbjct: 81  GNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELELKNYRRCINDCKMALS 140

Query: 160 TDPTYSKGYSRLGYAKFALGQAEDALEA 187
            +P   K Y R+  A  A+ + +D  EA
Sbjct: 141 LNPKNIKCYFRMAKAFLAIEKFDDCKEA 168

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 49/101 (48%), Gaps = 4/101 (3%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVL----PTNAVYYANRAAAHSSMKAYEEAIKDAESAIK 159
           GN     + +  A + Y+  +EV       N   + NRAA    +K +   I D + A++
Sbjct: 87  GNDLYRARRYKDARELYNKGVEVHCDDDAINESLFLNRAACELELKNHRRCINDCKEALR 146

Query: 160 TDPTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGDKAS 200
            +P   K + R+G A F+L + E+A EA +  L  + + A+
Sbjct: 147 YNPKNVKCFYRMGRAFFSLNKLEEAKEAIEFGLRFDSNNAA 187

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 43/88 (48%), Gaps = 4/88 (4%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVL----PTNAVYYANRAAAHSSMKAYEEAIKDAESAIK 159
            N     K F  A + Y+  I+V       N   +ANRAA    +K Y   + D + A++
Sbjct: 92  ANDLYKVKRFRDARELYTKGIKVFCEDKSINESLFANRAACELELKNYRSCVADCQKAME 151

Query: 160 TDPTYSKGYSRLGYAKFALGQAEDALEA 187
            +P   K + R+G A  ALG+ ++A +A
Sbjct: 152 INPMNLKCFYRMGKAFLALGKFKEAHDA 179

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 38/85 (44%), Gaps = 4/85 (4%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEV----LPTNAVYYANRAAAHSSMKAYEEAIKDAESAIK 159
           GN+    K F  A + YS  + V       N   YANRAA    +K Y   I+D   A+ 
Sbjct: 90  GNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRRCIEDCSKALT 149

Query: 160 TDPTYSKGYSRLGYAKFALGQAEDA 184
            +P   K Y R   A F L + E+A
Sbjct: 150 INPKNVKCYYRTSKAFFQLNKLEEA 174

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 42/91 (46%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN     KD D AIK +  A ++ P  A  Y  +   HSS  + + A      A+  DP 
Sbjct: 552 GNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQ 611

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDI 194
           +   Y  LG +   LGQ E+AL  ++K   I
Sbjct: 612 HYNAYYGLGTSSMKLGQYEEALLYFEKARSI 642

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 55/126 (43%), Gaps = 13/126 (10%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEV----LPTNAVYYANRAAAHSSMKAYEEAIKDAESAIK 159
           GN     K F  A   Y  A++V    L  N   Y N AA    +K Y   I     A+K
Sbjct: 77  GNDLYKGKRFKDARAMYLKALDVKCDVLSINESLYLNLAACELEIKNYRSCINYCREALK 136

Query: 160 TDPTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGD---------KASDVMKRDYETA 210
            +    K + R+G A   LG+ ED+LEA +  L ++ +         KA++ +KR  E  
Sbjct: 137 LNAKNVKAFFRIGKAYLELGRFEDSLEAVQVGLAVDPENGALKSIQSKATEKLKRKKELE 196

Query: 211 KKKVEQ 216
            + + Q
Sbjct: 197 NRTLAQ 202

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 42/91 (46%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN     +D D AI+ +  A EV P  A  Y  +   HSS  + + A      AI +DP 
Sbjct: 516 GNLYSLQRDHDEAIRYFEKATEVDPHFAYGYTLQGHEHSSNDSIDMAKTCYRKAIASDPQ 575

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDI 194
           +   Y  LG     LGQ E+AL  ++K   I
Sbjct: 576 HYNAYYGLGMCCMKLGQYEEALLYFEKARSI 606

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 42/91 (46%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN     KD D AIK +  A ++ P  A  Y  +   HSS  + + A      A+  DP 
Sbjct: 547 GNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQ 606

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDI 194
           +   Y  LG +   LGQ E+AL  ++K   I
Sbjct: 607 HYNAYYGLGTSAMKLGQYEEALLYFEKARSI 637

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 40/88 (45%), Gaps = 4/88 (4%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNA----VYYANRAAAHSSMKAYEEAIKDAESAIK 159
           GN     K F  A   Y+  IEV   +A    +   NRAA    +K Y   I D   A+K
Sbjct: 84  GNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELELKNYRRCINDCREALK 143

Query: 160 TDPTYSKGYSRLGYAKFALGQAEDALEA 187
            +P   K + R+G A   L + E+A EA
Sbjct: 144 LNPKNPKAFFRIGKAFLQLDKLEEAAEA 171

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 42/91 (46%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN     KD D AIK +  A ++ P  A  Y  +   HSS  + + A      A+  DP 
Sbjct: 540 GNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQ 599

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDI 194
           +   Y  LG +   LGQ E+AL  ++K   I
Sbjct: 600 HYNAYYGLGTSSMKLGQYEEALLYFEKARSI 630

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 39/85 (45%), Gaps = 4/85 (4%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEV----LPTNAVYYANRAAAHSSMKAYEEAIKDAESAIK 159
           GN+    K F  A + Y+  I V       N   +ANRAA    +K Y   I+D   A+ 
Sbjct: 90  GNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNYRRCIEDCSKALT 149

Query: 160 TDPTYSKGYSRLGYAKFALGQAEDA 184
            +P   K Y R   A F+L + E+A
Sbjct: 150 INPKNIKCYYRTSKAFFSLSKLEEA 174

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 50/94 (53%), Gaps = 2/94 (2%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN+    KD+D A+K Y  A+  L  + V+Y+N +A + SM   ++ ++++  A++  P 
Sbjct: 113 GNEFFKQKDYDNALKYYDYAL-TLKKDPVFYSNISACYVSMNQLDKVVENSTKALELKPD 171

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGD 197
           YSK   R   A  +L    DA+     VL + GD
Sbjct: 172 YSKALLRRASANESLENYPDAMFDL-SVLSLNGD 204

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 43/91 (47%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN     KD + AIK +  A +V P  A  Y  +   HSS  +++ A      A+  DP 
Sbjct: 542 GNFLSLQKDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKALACDPQ 601

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDI 194
           +   Y  LG +   LGQ ++AL  ++K   I
Sbjct: 602 HYNAYYGLGMSCMKLGQYDEALLHFEKARSI 632

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 2/94 (2%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN+    K +D AIK Y+ A+E L  + V+Y+N +A + S+   ++ ++ +  A++  P 
Sbjct: 106 GNQFFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGD 197
           YSK   R   A   LG+  DA+     VL + GD
Sbjct: 165 YSKVLLRRASANEGLGKFADAMFDL-SVLSLNGD 197

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 51/94 (54%), Gaps = 2/94 (2%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN+    KD + AIK Y  A+  L  + V+Y+N +A + +M   ++ I+ +  A++  P 
Sbjct: 165 GNQYFKSKDNENAIKYYEYALR-LDQDPVFYSNISACYFAMNQLDKVIESSNKALELKPD 223

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGD 197
           YSK   R   A  ALG  ++AL  +  +L + G+
Sbjct: 224 YSKALLRRANAYEALGNNKEALYDF-SILSLFGE 256

 Score = 30.4 bits (67), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 37/72 (51%), Gaps = 5/72 (6%)

Query: 136 NRAAAHSSMKAYEEAIKDAESAIKTD--PTYSKGYSRLGYAKFALGQAEDALEAYKKVLD 193
           N+   +   K  E AIK  E A++ D  P +   YS +    FA+ Q +  +E+  K L+
Sbjct: 163 NKGNQYFKSKDNENAIKYYEYALRLDQDPVF---YSNISACYFAMNQLDKVIESSNKALE 219

Query: 194 IEGDKASDVMKR 205
           ++ D +  +++R
Sbjct: 220 LKPDYSKALLRR 231

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 59/124 (47%), Gaps = 18/124 (14%)

Query: 117 IKKYSDAIEVLP-----------TNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYS 165
           +K+Y DA EV              N   YANRAA    +K + + I+D + A+  +    
Sbjct: 87  LKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNFRKCIEDCKKALSFNVKNI 146

Query: 166 KGYSRLGYAKFALGQAEDALEAYKKVLDIEGDKAS------DVMKRDYETAKKK-VEQSL 218
           K Y R+G A  ++ + +++ E+ +  L I+ +  S       + KR  E  ++K +E  +
Sbjct: 147 KCYYRMGKAFLSVDRFDESKESIEFGLKIDSENKSLKNLLQAIEKRQLEIQRRKDMEMKI 206

Query: 219 DLEK 222
            LEK
Sbjct: 207 KLEK 210

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 52/94 (55%), Gaps = 2/94 (2%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN+    KD+D A+K Y+ A+ V+  + V+Y+N +A + S+   ++ ++++  A++  P 
Sbjct: 108 GNEFFKKKDYDNALKYYNYAL-VVKKDPVFYSNISACYVSLGQLDKVVENSTKALELKPD 166

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGD 197
           YSK   R   A  +L    DA+     VL + GD
Sbjct: 167 YSKALLRRASANESLENYADAMFDL-SVLSLNGD 199

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 37/67 (55%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GNK +  K +  A + Y+ AIE  P N + Y+NRA  +  +  ++ ++ DA+ AI+ D  
Sbjct: 20  GNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLKLDNFQSSLDDAKRAIELDNN 79

Query: 164 YSKGYSR 170
             K Y R
Sbjct: 80  NLKAYHR 86

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 50/94 (53%), Gaps = 2/94 (2%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN+    K +D AIK Y+ A+E L  + V+Y+N +A + S+   ++ ++ +  A++  P 
Sbjct: 106 GNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGD 197
           YSK   R   A   LG   DA+     VL + GD
Sbjct: 165 YSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN     KD++ AI  Y  A++ L  + V+Y+N AA + S++  +EAI+    A++ +P 
Sbjct: 93  GNAYFKVKDYENAINYYKFALQ-LKNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151

Query: 164 YSKGYSRLGYAKFALGQAEDAL 185
           YSK   +       +G+  DAL
Sbjct: 152 YSKVLLKRAAVYENIGKFADAL 173

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 44/88 (50%), Gaps = 7/88 (7%)

Query: 137 RAAAHSSMKAYEEAIKDAESAI--KTDPTYSKGYSRLGYAKFALGQAEDALEAYKKVLDI 194
           R  A+  +K YE AI   + A+  K DP +   YS +     +L   ++A+EA  K L++
Sbjct: 92  RGNAYFKVKDYENAINYYKFALQLKNDPVF---YSNMAACYISLEHNKEAIEACSKALEL 148

Query: 195 EGDKASDVMKRD--YETAKKKVEQSLDL 220
             D +  ++KR   YE   K  +  LDL
Sbjct: 149 NPDYSKVLLKRAAVYENIGKFADALLDL 176

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 50/94 (53%), Gaps = 2/94 (2%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN+    K +D AIK Y+ A+E L  + V+Y+N +A + S+   ++ ++ +  A++  P 
Sbjct: 106 GNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPD 164

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGD 197
           YSK   R   A   LG   DA+     VL + GD
Sbjct: 165 YSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 50/94 (53%), Gaps = 2/94 (2%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN+    K +D AIK Y+ A+E L  + V+Y+N +A + S+   ++ ++ +  A++  P 
Sbjct: 106 GNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGD 197
           YSK   R   A   LG   DA+     VL + GD
Sbjct: 165 YSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 32/54 (59%)

Query: 134 YANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQAEDALEA 187
           +AN+AA    +K +   I D ++A++ +P   K Y R+  A FAL + E+A E+
Sbjct: 118 FANKAACELELKNFRRCINDCKNALQLNPKNVKCYFRMTRAFFALDKLEEAKES 171

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 39/85 (45%), Gaps = 4/85 (4%)

Query: 104 GNKAMACKDF----DLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIK 159
           GN+    K F    +L IK  +   E    N   +AN+AA    +K Y   I+D   A+ 
Sbjct: 90  GNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNYRRCIEDCSKALS 149

Query: 160 TDPTYSKGYSRLGYAKFALGQAEDA 184
            +P  +K Y R   A F L + E+A
Sbjct: 150 INPKNTKCYYRTSKAFFQLNKLEEA 174

>Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON}
           complement(17836..20034) [2199 nt, 733 aa]
          Length = 732

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 56/128 (43%), Gaps = 6/128 (4%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           G   M   D++ A + +  A+     N +++ +    +  +  Y +A+     AI+ +P 
Sbjct: 293 GRIHMIRSDYNAAYEAFQQAVNRDARNPIFWCSIGVLYYQIYQYRDALDAYTRAIRLNPY 352

Query: 164 YSKGYSRLG-YAKFALGQAEDALEAYKKVLDIEGDKAS-----DVMKRDYETAKKKVEQS 217
            S+ +  LG   +    Q  DAL+AYK+   +E D        D +     T +  + Q 
Sbjct: 353 ISEVWYDLGTLYETCNNQLTDALDAYKQAARLEPDNTHIRERLDALTNQLSTQQGNINQK 412

Query: 218 LDLEKKPE 225
           ++ +KK E
Sbjct: 413 IEYQKKNE 420

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 40/86 (46%)

Query: 107 AMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSK 166
           A    D    I+ Y   +   P +     + A  + S  A+++A+   E A+  D T ++
Sbjct: 45  AETLNDTTTLIRAYHSVLAHDPLSVTALVSLANFYRSTDAFDKAVHYYEKAVALDSTLAE 104

Query: 167 GYSRLGYAKFALGQAEDALEAYKKVL 192
            +S LG++   L + + A  AY++ L
Sbjct: 105 VWSLLGHSYLMLDELQKAYNAYQQAL 130

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN+    KD++ A+K Y  A+ +L  + V+Y+N +A + S+   ++ I+ +  A++  P 
Sbjct: 115 GNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTKALELKPD 173

Query: 164 YSKGYSRLGYAKFALGQAEDAL 185
           YSK   R   A   L    DA+
Sbjct: 174 YSKALLRRATANEQLENYSDAM 195

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 37/85 (43%), Gaps = 4/85 (4%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVL----PTNAVYYANRAAAHSSMKAYEEAIKDAESAIK 159
           GN     K +  A   YS  IEV       N   Y NRAA    ++ +   I D + A+ 
Sbjct: 86  GNDLYKVKRYKDARTMYSKGIEVKCEDDSINGSLYLNRAACELELRNFRSCINDCKKALN 145

Query: 160 TDPTYSKGYSRLGYAKFALGQAEDA 184
            +    K + R+G A F L + E+A
Sbjct: 146 FNAKCVKAFYRMGQAYFKLKKLEEA 170

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 42/91 (46%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN     K+   AIK +  A +V P  A  Y  +   ++S  +++ A +    AI  DP 
Sbjct: 535 GNFLSLQKNHHEAIKAFEKATQVDPKFAYAYTLQGHEYTSSDSFDVAKRCYRKAIACDPG 594

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDI 194
           +   Y  LG     LGQ E+AL  ++K   I
Sbjct: 595 HYNAYYGLGMVSMKLGQYEEALLFFEKARSI 625

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 39/80 (48%)

Query: 116 AIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAK 175
           A++ Y  A E+ P++++    RA    SM  Y  A+K  E      P  +  +  LG   
Sbjct: 649 ALQYYELACELQPSSSLATFKRAHLLYSMGRYTLALKFFEELKHVAPDEATVHFLLGQIY 708

Query: 176 FALGQAEDALEAYKKVLDIE 195
             LG+ +DA++ Y   L+++
Sbjct: 709 SILGRKKDAIKEYTIALNLD 728

>Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON}
           YBL084C (REAL)
          Length = 769

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 41/91 (45%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN     KD D AIK +  A ++ P  A  Y  +   HSS  + + A      A+  D  
Sbjct: 558 GNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDSQ 617

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDI 194
           +   Y  LG +   LGQ E+AL  ++K   I
Sbjct: 618 HYNAYYGLGTSSMKLGQYEEALLYFEKARSI 648

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 40/85 (47%), Gaps = 4/85 (4%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEV----LPTNAVYYANRAAAHSSMKAYEEAIKDAESAIK 159
           GN+    K F  A + Y+  + V       N   +ANRAA    +K Y + ++D   A+ 
Sbjct: 90  GNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELELKNYRKCVEDCGKALT 149

Query: 160 TDPTYSKGYSRLGYAKFALGQAEDA 184
            +P   K Y R+  + F L + E+A
Sbjct: 150 INPKNIKCYYRISKSFFQLRKLEEA 174

>KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]
           {ON} weakly similar to uniprot|Q06677 Saccharomyces
           cerevisiae YDR320C SWA2 auxilin-like protein
          Length = 623

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 68/149 (45%), Gaps = 29/149 (19%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTN----AVYYANRAAAHSSMKAYEEAIKDAESAIK 159
           G  +    D+  A + Y  ++  LP       V ++N       +  Y EA+ DA SA+K
Sbjct: 332 GANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSDASSALK 391

Query: 160 TDP---------------TYSKGYSRL----GYAKFALGQAEDALEAYKKVLDIEGDKAS 200
             P               TY + +S++      A   +   E ALE Y+++++  G  +S
Sbjct: 392 LIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKALETYQQLIEA-GVTSS 450

Query: 201 DVMKRDYETAKKKVEQSLDLEKKPETQAR 229
            V++     A+++ ++++ LEKKP + AR
Sbjct: 451 KVLE-----ARRQCQKAIALEKKPVSVAR 474

>TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.367
           YBR112C
          Length = 689

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 52/111 (46%), Gaps = 4/111 (3%)

Query: 112 DFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRL 171
           + D+A+     ++E+ PT++  +      H + K +  A +  + A+  D      +  +
Sbjct: 395 NLDIAMGHLVKSLELDPTDSTTWYYLGRIHMAKKDFTAAYESLQQAVNRDSRNPIFWCSI 454

Query: 172 GYAKFALGQAEDALEAYKKVLDIEGDKASDV---MKRDYETAKKKVEQSLD 219
           G   + +GQ  DAL+AY + + +     S+V   +   YET   ++  +LD
Sbjct: 455 GVLYYQIGQNHDALDAYTRAIRL-NPYISEVWYNLGTLYETCNDQITDALD 504

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 48/94 (51%), Gaps = 2/94 (2%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN     +DF+ A+K Y+ A+  L  + V+Y+N +A + S+   E+ ++ +  A+K    
Sbjct: 112 GNDYFKKQDFENALKYYNYAL-TLKQDPVFYSNISACYVSLGQLEKVVESSTEALKLKHD 170

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGD 197
           YSK   R   A  +L    DA+     VL + GD
Sbjct: 171 YSKALLRRASAYESLANYVDAMVDL-SVLSLNGD 203

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 37.4 bits (85), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 31/55 (56%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAI 158
           GN+     ++DLAI++Y   I + PTNAV Y+N A A+   +  +EA    E  +
Sbjct: 42  GNEHFKKGEYDLAIEQYRKCISLEPTNAVGYSNLAMAYLKNRCPDEAKTACEMGL 96

>TBLA0B08680 Chr2 (2070444..2073188) [2745 bp, 914 aa] {ON} Anc_3.32
           YNL313C
          Length = 914

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 48/97 (49%), Gaps = 1/97 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           G   + C    LA + +S  + +  TNA+ ++N +AA+ +    +EA      A +TD  
Sbjct: 653 GCIGLECGKMQLAAEAFSRCVSLDDTNAMAWSNLSAAYVNQGKLKEAFSCLNRATRTDSQ 712

Query: 164 YS-KGYSRLGYAKFALGQAEDALEAYKKVLDIEGDKA 199
            + + +       F L + ++ L + KK++DI  D+A
Sbjct: 713 KNWRIWENYMIVAFKLREWDEVLLSCKKLIDINKDRA 749

>Smik_14.18 Chr14 complement(29815..32529) [2715 bp, 904 aa] {ON}
           YNL313C (REAL)
          Length = 904

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 48/99 (48%), Gaps = 1/99 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           G   + C    +A + +S  + + P +A+ ++N +AA+  M   +EA    + AI +D  
Sbjct: 644 GCVGLQCGKMQIAAEAFSRCVSLDPYHALSWSNLSAAYMKMDKLKEAYSCLKRAIASDAQ 703

Query: 164 YS-KGYSRLGYAKFALGQAEDALEAYKKVLDIEGDKASD 201
            + K +         L + ED L A K++++I  DK  +
Sbjct: 704 KNWKIWENFMLVAVKLNEWEDVLMACKQLVNIRRDKCGE 742

>KLLA0E07239g Chr5 complement(655635..658325) [2691 bp, 896 aa] {ON}
           similar to uniprot|P42842 Saccharomyces cerevisiae
           YNL313C Protein required for cell viability
          Length = 896

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 49/96 (51%), Gaps = 1/96 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           G   + C   +LA + +S  + +  T+++ ++N +AA+  +   +EA    + AI +D  
Sbjct: 635 GCIGLECGKMNLAAEAFSRCVALDETHSLSWSNLSAAYVQLDKLKEAHSCLKRAISSDAR 694

Query: 164 YS-KGYSRLGYAKFALGQAEDALEAYKKVLDIEGDK 198
            + + +         LG+ ED L A++ ++D+  DK
Sbjct: 695 KNWRIWDNYMIVSMKLGEWEDVLLAFRNLVDLRKDK 730

>CAGL0E01573g Chr5 complement(149084..151798) [2715 bp, 904 aa] {ON}
           similar to uniprot|P42842 Saccharomyces cerevisiae
           YNL313c
          Length = 904

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 51/99 (51%), Gaps = 1/99 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           G  A+ C   ++A + ++    + PT+A+ ++N +AA+      +EA    + AI +D  
Sbjct: 640 GCIALECNKMEIAAEAFTRCTALDPTHAMSWSNLSAAYVQQGKLKEAHSCLKQAISSDSQ 699

Query: 164 YS-KGYSRLGYAKFALGQAEDALEAYKKVLDIEGDKASD 201
            + + +         L + ED L A K++++I+ DK+ +
Sbjct: 700 KNWRIWENFLLVSVKLDEWEDVLAACKQLIEIKKDKSGE 738

>YNL313C Chr14 complement(45308..48022) [2715 bp, 904 aa] {ON}
           EMW1Essential conserved protein with a role in
           maintaining cell wall integrity; contains six TPR
           (tetratricopeptide repeat) domains clustered in the
           C-terminal region; conditional mutant is suppressed by
           overexpression of GFA1
          Length = 904

 Score = 37.7 bits (86), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 48/99 (48%), Gaps = 1/99 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           G   + C    +A + ++  + + P +A+ ++N +AA++ M   +EA    + AI  D  
Sbjct: 644 GCVGLQCGKMQIAAEAFTRCVSLDPYHALSWSNLSAAYTKMDKLKEAYSCLKRAISCDAQ 703

Query: 164 YS-KGYSRLGYAKFALGQAEDALEAYKKVLDIEGDKASD 201
            + K +         L + ED L A K+++ I  DK+ +
Sbjct: 704 KNWKIWENYMLVAVKLNEWEDVLTACKQLVSIRRDKSGE 742

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score = 37.7 bits (86), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 51/94 (54%), Gaps = 2/94 (2%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN     K F+ AI+ Y+ AI+ L  + V+++N +A + S+   ++ ++ +  A++  P 
Sbjct: 100 GNALFKEKRFEDAIEFYNHAIK-LHEDPVFHSNISACYVSLGDLDKVVESSTRALELKPD 158

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGD 197
           YSK   R   A   +G+ +DA+     VL + GD
Sbjct: 159 YSKALLRRASAYENMGRYQDAMFDI-SVLSLNGD 191

>ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR080W (DIA2)
          Length = 685

 Score = 37.7 bits (86), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 42/99 (42%), Gaps = 11/99 (11%)

Query: 128 PTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQAEDALEA 187
           P   V   NRAA    +   + A+ DA   I  D    KGY R G     LG+ E+AL+ 
Sbjct: 67  PRFFVLLDNRAATFEKLNKLDRALADAAYMITVDAYNLKGYIRRGKVLQKLGRYEEALQV 126

Query: 188 YKKVLDIEGD-----------KASDVMKRDYETAKKKVE 215
           Y+  L   G+           K  D++ R   T K+ ++
Sbjct: 127 YENGLKQAGEAEKTHAIHAPQKFLDIVYRQRSTIKELLQ 165

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score = 37.0 bits (84), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN+    K  + AIK Y  A+E    + V+YAN +A + S+  +E+ +++   A++  P 
Sbjct: 113 GNELFKEKAVEEAIKYYQWALE-FKKDPVFYANISACYVSLNDFEKVLENCNKALELKPD 171

Query: 164 YSKGYSR 170
           YSK   R
Sbjct: 172 YSKVLLR 178

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 36.2 bits (82), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 11/81 (13%)

Query: 118 KKYSDAIEVL-----------PTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSK 166
           K+Y DA E+              N   ++NRAA    +K Y   + D + A++ +    K
Sbjct: 92  KRYKDAREIYNRGIDIKCDDSKVNESLFSNRAACELELKNYRRCVNDCKRALQYNVKNIK 151

Query: 167 GYSRLGYAKFALGQAEDALEA 187
            Y R+  A   L + EDA +A
Sbjct: 152 CYYRIAKAFLLLNKLEDAKQA 172

>TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {ON}
           Anc_7.412 YBL084C
          Length = 835

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 35/87 (40%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN      D D AIK    A  + P     Y       +S+ A++ A      AI  DP 
Sbjct: 625 GNYFSLINDHDKAIKYLKKATTINPRFTYAYTLEGHEQASIDAFDTAKNCYRKAIACDPN 684

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKK 190
           +   Y  LG     LGQ + AL  ++K
Sbjct: 685 HYNAYYGLGTCCMRLGQYDQALLYFEK 711

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 34.3 bits (77), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 40/86 (46%), Gaps = 7/86 (8%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAI----K 159
           GN+     ++  AIK Y   IE+ P N + Y+N+A A       +EA++  +  +    K
Sbjct: 10  GNQYFKEGNYASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAVRTCQDGLKRVSK 69

Query: 160 TDPTYSKGYSRLGYAKFALGQAEDAL 185
            D T+     +L Y    L  AE AL
Sbjct: 70  NDATHETIQKKLEY---RLELAEKAL 92

>KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {ON}
           Anc_8.470 YDR244W
          Length = 602

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 46/99 (46%), Gaps = 3/99 (3%)

Query: 112 DFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRL 171
           DF+  I  +  A++V P + + +    AA ++    EE+IK    A++  P++ +    L
Sbjct: 461 DFNKTIDCFKTALQVNPNDELMWNRLGAALANSNRSEESIKAYHRALQLKPSFVRARYNL 520

Query: 172 GYAKFALGQAEDALEAYKKVL---DIEGDKASDVMKRDY 207
             +   +G  ++A+E     L   ++EG +  D     Y
Sbjct: 521 AVSSMNIGCYKEAVEHLLTALSMHEVEGLRQKDKDSHHY 559

>NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON}
           Anc_8.470
          Length = 590

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 44/99 (44%)

Query: 112 DFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRL 171
           DFD  ++ + +A+++ P + + +    A+ ++    EEAIK    AI   P++ +    L
Sbjct: 456 DFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLKPSFVRARYNL 515

Query: 172 GYAKFALGQAEDALEAYKKVLDIEGDKASDVMKRDYETA 210
             A   +G  ++A      VL +      D      +TA
Sbjct: 516 AVASMNIGCYQEAAGHLLTVLKMHQVHGQDNTSVKTDTA 554

 Score = 30.4 bits (67), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 13/55 (23%), Positives = 34/55 (61%)

Query: 141 HSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIE 195
           H S   +++ ++  ++A+K +P     ++RLG +     ++E+A++AY K ++++
Sbjct: 451 HYSNDDFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLK 505

>SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1408

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 40/80 (50%), Gaps = 6/80 (7%)

Query: 134 YANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLG--YAKFALGQAEDALEAYKKV 191
           Y N A A  S +  + A K    +IKT  T++ GYS LG  YAK+    A  A + Y K 
Sbjct: 572 YKNEAEASQSQELIKIAFKQLIQSIKTSETFAPGYSSLGDIYAKY-YKDATRAFKCYFKA 630

Query: 192 LDIEGDKASDVMKRDYETAK 211
            +++   A D++   Y T K
Sbjct: 631 FELD---AGDLVAARYMTEK 647

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 38/86 (44%), Gaps = 7/86 (8%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAI----- 158
           GN A    +F  A + Y   I + P N + Y+NRA A   ++ + E I   +  +     
Sbjct: 11  GNVAFRNSNFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDTCQRGLGKLED 70

Query: 159 --KTDPTYSKGYSRLGYAKFALGQAE 182
             K +P   K   RL  A+ +L + +
Sbjct: 71  NEKDEPIRKKLLYRLHLAQESLNKFQ 96

>NCAS0A14770 Chr1 complement(2911657..2912559) [903 bp, 300 aa] {ON}
           Anc_7.458 YJR088C
          Length = 300

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 50/109 (45%), Gaps = 18/109 (16%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAV---------YYANRAAAHSSMKAYE------ 148
           G   M  KDFD AI  + + + ++P N V         YY  ++ +HSS    E      
Sbjct: 171 GEIYMNLKDFDRAIYCFEEILCIMPFNYVAFAQLAESLYYKAKSMSHSSKAKVELRKEIV 230

Query: 149 -EAIKDAESAIKTDPTYSKGYSRLGYAKFALG--QAEDALEAYKKVLDI 194
            +++ +A  +I+    Y KG+S +      LG    + AL A +K+ +I
Sbjct: 231 QKSMNNALRSIELSGLYLKGWSMVAITSQELGPKHVKIALLAKRKLQEI 279

>KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 689

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 42/88 (47%), Gaps = 6/88 (6%)

Query: 136 NRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIE 195
           NRAA    +   ++A+KDA  A + +P   K Y R G     L     ALE Y+     E
Sbjct: 76  NRAATWEKIGDLKKALKDANRATRFEPYNLKCYLRRGKILQKLRMDGQALENYE-----E 130

Query: 196 GDKASDVMKRDYET-AKKKVEQSLDLEK 222
           G KA   M R Y     KK+ ++L+ +K
Sbjct: 131 GVKAIRDMTRKYHLDPPKKLYEALEYQK 158

>SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 632

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 40/91 (43%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN     KD D AIK +  A ++ P     Y  +   +SS  A++ A      A+ T+  
Sbjct: 421 GNMFSLNKDHDEAIKSFQKATQLDPRFTYAYTLQGHEYSSNDAFDTAKTCYRKALATNSQ 480

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDI 194
           +      LG     LGQ E++L  ++K   I
Sbjct: 481 HYNASYGLGMCCLKLGQYEESLLHFQKAHSI 511

 Score = 30.4 bits (67), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 18/80 (22%), Positives = 41/80 (51%)

Query: 116 AIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAK 175
           A+K Y  A E+ PT+++    ++    SM +Y  A+ + E  +   P  +  +  LG   
Sbjct: 535 ALKYYELACELQPTSSLALFKKSQLLLSMGSYNSALVNFEKLVIMAPDEATVHFLLGQLY 594

Query: 176 FALGQAEDALEAYKKVLDIE 195
             +G+ +DA++ +   ++++
Sbjct: 595 HIVGRKKDAIKEFTVAMNLD 614

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 32.7 bits (73), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 43/97 (44%), Gaps = 5/97 (5%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAI----- 158
           GN+      + +A + Y   +++ P N + Y+N+A A   +  Y E ++     +     
Sbjct: 10  GNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKGLTFTPN 69

Query: 159 KTDPTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIE 195
            TD  Y K   RL  A   +    D  ++ + +++IE
Sbjct: 70  TTDTVYKKLNYRLEMALKNMKHVNDQEQSNEHLINIE 106

>AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR244W (PEX5)
          Length = 569

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 38/87 (43%)

Query: 109 ACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGY 168
           A +DFD  I  +  A+ V P +   +    A+ ++    EEAI+    AI+  PT+ +  
Sbjct: 429 ANEDFDKTIDCFRAALAVRPDDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPTFVRAR 488

Query: 169 SRLGYAKFALGQAEDALEAYKKVLDIE 195
             L  +   +G   +A E     L + 
Sbjct: 489 YNLAVSSMNIGCYREAAEHLLTALSMH 515

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 32.7 bits (73), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 40/89 (44%), Gaps = 3/89 (3%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAI--KTD 161
           GN+     D+  A K Y   I   PTN + Y+N+A +    + +++AI+   + +   +D
Sbjct: 10  GNRLFKLGDYTAANKFYDLCIMEEPTNPIGYSNKAMSLIKQEHFDQAIRTCNTGLLYSSD 69

Query: 162 PTYSKGYSRLGYAKFALGQAEDALEAYKK 190
           P +     +L Y +  L Q     E   K
Sbjct: 70  PEHEAIKRKLQY-RLELAQKSQERETVNK 97

>Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON}
           (123502..125622) [2121 nt, 707 aa]
          Length = 706

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 46/97 (47%), Gaps = 12/97 (12%)

Query: 134 YANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQAEDALEAYKKVL- 192
           Y N +A +  ++  ++A + +   I  +P   KGY R+G      G+  +A + YKK L 
Sbjct: 74  YDNLSATYEKLQELDKAYESSSRMIHIEPYNMKGYIRMGKVLQRQGKDPEAYKCYKKGLL 133

Query: 193 ----------DIEGDKASDVMKRDYETAKKKV-EQSL 218
                      +  +K  D++K+  +  KK++  QSL
Sbjct: 134 MSREMLQKFDIVVPEKFRDIIKQQRDIVKKRINNQSL 170

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score = 33.9 bits (76), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 39/67 (58%), Gaps = 1/67 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN+    + ++ A+K Y+ A++ L  + V+Y+N +A + S+   E+ ++ +  A++  P 
Sbjct: 106 GNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSLGNLEKVVESSTKALELKPD 164

Query: 164 YSKGYSR 170
           YSK   R
Sbjct: 165 YSKALLR 171

>TDEL0A00510 Chr1 complement(86493..89204) [2712 bp, 903 aa] {ON}
           Anc_3.32 YNL313C
          Length = 903

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 52/102 (50%), Gaps = 7/102 (6%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           G   + C  F+LA + +S  + +  T+A+ ++N +AA       +EA+   + A+ +D  
Sbjct: 642 GCVGLECGKFELAAEAFSRCVALDSTHAMAWSNLSAAFVEQNKLKEALSCLKRAVASD-- 699

Query: 164 YSKGYSRLG--YAKFA--LGQAEDALEAYKKVLDIEGDKASD 201
            S+   R+   Y   A  + +  D L A + +++I+ DKA +
Sbjct: 700 -SQSNWRIWENYMLVAAKMNEWSDVLLACRHLVNIKRDKAGE 740

>Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON}
           similar to Ashbya gossypii ADR230W
          Length = 688

 Score = 33.9 bits (76), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 48/109 (44%), Gaps = 8/109 (7%)

Query: 128 PTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQAEDALEA 187
           P   +   NRAA+   +    +A+ DA+  IK D    KGY R G     + Q ++AL  
Sbjct: 67  PRYLILLDNRAASWERINNLGKALIDADRMIKVDAYNLKGYIRKGKILQKMAQDKEALYV 126

Query: 188 YKKVL-------DIEGDKASDVMKRDYETAKKKVEQSLDLEK-KPETQA 228
           Y++ L        +  +K         E  K +V + L+L+K  P T A
Sbjct: 127 YREGLSKAKEAYQLHFEKPPSKFVEIVEHQKNEVIKRLNLQKLTPTTGA 175

>NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {ON}
           Anc_8.470
          Length = 578

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 57/124 (45%), Gaps = 15/124 (12%)

Query: 112 DFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRL 171
           DFD  I+ + +++++ P + V +    A+ ++    E+AI+    A+   P++ +    L
Sbjct: 446 DFDKTIECFKESLKINPNDEVMWNRLGASLANSNKPEDAIQAYHRALNLKPSFVRARYNL 505

Query: 172 GYAKFALGQAEDALEAYKKVL---DIEG-------DKASDVMKR-----DYETAKKKVEQ 216
             A   +G  ++A E    VL    +EG       +   +++KR     D E   +KV  
Sbjct: 506 AVASMNIGCYKEAGEHLLTVLRMHQVEGVNNVETDNNVLEILKRVLMGMDREDLLEKVYP 565

Query: 217 SLDL 220
            +DL
Sbjct: 566 GMDL 569

>CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244w PAS10 peroxisomal targeting signal receptor
          Length = 590

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 44/92 (47%), Gaps = 3/92 (3%)

Query: 109 ACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGY 168
           A  +FD  I  +  A++V P + + +    A+ ++    EEAI+    A++  P++ +  
Sbjct: 436 ANDEFDRTIDCFQAALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRAR 495

Query: 169 SRLGYAKFALGQAEDALEAYKKVL---DIEGD 197
             L  +   +G  ++A E     L   D+EG+
Sbjct: 496 YNLAVSSMNIGCYKEAAEHLLTALSMHDVEGE 527

>TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.412
           YBL084C
          Length = 700

 Score = 33.5 bits (75), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 40/91 (43%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN     +D + AIK +  A ++    A  Y  +   HSS  + + A      A+  DP 
Sbjct: 489 GNLYSLQRDHEDAIKYFEKATKIDYNFAYAYTLQGHEHSSNDSIDTAKNCYRRALACDPQ 548

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDI 194
           +   Y  LG     LGQ + AL  ++K  +I
Sbjct: 549 HYNAYYGLGMCYMKLGQYDKALLFFEKARNI 579

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 33.5 bits (75), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 40/87 (45%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN     KD D AI  +  AI++ P  A  Y  +   +S+  A++ A      A+  + T
Sbjct: 499 GNLHSLNKDHDEAITAFGKAIQLDPFFAYAYTLQGHEYSNNDAFDNAKSCFRKALTIEKT 558

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKK 190
           +      LG     LG+ E+AL  ++K
Sbjct: 559 HYNALYGLGMCCVKLGKFEEALLFFEK 585

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 32/66 (48%)

Query: 130 NAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQAEDALEAYK 189
           N + + +    HS  K ++EAI     AI+ DP ++  Y+  G+        ++A   ++
Sbjct: 491 NPIAWCSMGNLHSLNKDHDEAITAFGKAIQLDPFFAYAYTLQGHEYSNNDAFDNAKSCFR 550

Query: 190 KVLDIE 195
           K L IE
Sbjct: 551 KALTIE 556

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 41/91 (45%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN     +D D AIK    A  + P  A  Y  +   +S+  A++ A      A+  +P 
Sbjct: 445 GNLFSLNRDHDEAIKALKKATSLNPQFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPN 504

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDI 194
           +   +  LG +   LGQ ++AL  ++K   I
Sbjct: 505 HYNAHYGLGMSCIKLGQYDEALLHFEKARSI 535

>Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 44/94 (46%), Gaps = 3/94 (3%)

Query: 112 DFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRL 171
           DFD  I  +  A++V P + + +    A+ ++    EEAI+    A++  P++ +    L
Sbjct: 472 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNL 531

Query: 172 GYAKFALGQAEDALEAYKKVL---DIEGDKASDV 202
             +   +G  ++A      VL   ++  +K  DV
Sbjct: 532 AVSSMNIGCLKEAAGYLLSVLSMHEVNTNKKGDV 565

>NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}
           Anc_5.689 YOR080W
          Length = 764

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 1/69 (1%)

Query: 136 NRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIE 195
           NRAA    M   E+A++DA      +P   K + R G     L + +DA   YK  L   
Sbjct: 99  NRAACWEKMGELEKALRDATKMCFIEPYNLKCFIRKGKILQKLHKLKDAYNTYKTALR-N 157

Query: 196 GDKASDVMK 204
            + A+D +K
Sbjct: 158 ANFATDSLK 166

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 30/63 (47%), Gaps = 4/63 (6%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAI----K 159
           GN +     +  AI  Y+  I + P+N + Y+N+A A      ++EAI   E  +    K
Sbjct: 10  GNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKGLQLISK 69

Query: 160 TDP 162
            DP
Sbjct: 70  EDP 72

>ZYRO0C02970g Chr3 (230414..233104) [2691 bp, 896 aa] {ON} similar
           to uniprot|P42842 Saccharomyces cerevisiae YNL313C
           Protein required for cell viability
          Length = 896

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/90 (22%), Positives = 44/90 (48%), Gaps = 1/90 (1%)

Query: 113 FDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYS-KGYSRL 171
            +LA + +S  + + PT+   ++N +AA+  +   +EA    + A+ TD   + + +   
Sbjct: 647 MELAAEAFSRCVSLDPTHGAAWSNLSAAYVELDKLKEAFSCLKQAVSTDARKNWRIWENY 706

Query: 172 GYAKFALGQAEDALEAYKKVLDIEGDKASD 201
                 L + +D L A K ++ I+ D+  +
Sbjct: 707 MLVAMKLNEWQDVLMACKNLVTIKRDRVGE 736

>ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]
           {ON} highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 974

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 49/111 (44%), Gaps = 4/111 (3%)

Query: 116 AIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAK 175
           A+   S ++EV P++A  + +    H     Y  A    + A+  D      +  +G   
Sbjct: 289 ALSFLSKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLY 348

Query: 176 FALGQAEDALEAYKKVLDIEGDKASDV---MKRDYETAKKKVEQSLDLEKK 223
           + + Q  DAL+AY + + +     S+V   +   YET   ++  +LD  K+
Sbjct: 349 YQISQYRDALDAYTRAIRL-NPYISEVWYDLGTLYETCNNQLTDALDAYKQ 398

>NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.412
           YBL084C
          Length = 783

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 39/91 (42%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN     KD   AIK +    ++ PT    Y  +A  + S  +++ A      A+ TD  
Sbjct: 572 GNLFSLQKDHKEAIKAFEKVTKLDPTFTYGYTLQAHEYLSDDSFDLAKNYFRKAVSTDSQ 631

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDI 194
           +   Y  +G     LG+ E AL  ++K   I
Sbjct: 632 HYNAYYGIGMCSMKLGEFEHALLYFEKARSI 662

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 41/91 (45%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN     +D D AIK    A  + P  A  Y  +   +S+  A++ A      A+  +P 
Sbjct: 464 GNLFSLNRDHDEAIKALKKATNLDPRFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPN 523

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDI 194
           +   +  LG +   LGQ ++AL  ++K   I
Sbjct: 524 HYNAHYGLGMSCIKLGQYDEALLHFEKARSI 554

>YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}
           PEX5Peroxisomal membrane signal receptor for the
           C-terminal tripeptide signal sequence (PTS1) of
           peroxisomal matrix proteins, required for peroxisomal
           matrix protein import; also proposed to have
           PTS1-receptor independent functions
          Length = 612

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/73 (23%), Positives = 35/73 (47%)

Query: 112 DFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRL 171
           DFD  I  +  A+ V P + + +    A+ ++    EEAI+    A++  P++ +    L
Sbjct: 472 DFDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNL 531

Query: 172 GYAKFALGQAEDA 184
             +   +G  ++A
Sbjct: 532 AVSSMNIGCFKEA 544

>Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W
           (REAL)
          Length = 612

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/73 (23%), Positives = 36/73 (49%)

Query: 112 DFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRL 171
           DFD  I  +  A++V P + + +    A+ ++    EEAI+    A++  P++ +    L
Sbjct: 473 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNL 532

Query: 172 GYAKFALGQAEDA 184
             +   +G  ++A
Sbjct: 533 AVSSMNIGCFKEA 545

>CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q06677 Saccharomyces cerevisiae YDR320c SWA2
          Length = 661

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 64/137 (46%), Gaps = 25/137 (18%)

Query: 112 DFDLAIKKYSDAIEVLPT----NAVYYANRAAAHSSMKAYEEAIKDAESAIK-------- 159
           D+  A+++Y  ++  LP       + Y+N  A+   +  + +++ DA+ A+K        
Sbjct: 377 DYASAVEEYEKSLNTLPMKHPLRIIAYSNIIASRIKIGQHSQSVVDAQEAMKLLPEEKSL 436

Query: 160 -------TDPTYSKGYSRLGYAKFALGQAE--DALEAYKKVLD-IEGDKASDVMKRDYET 209
                  +DP   + Y+ + + K  L QAE  +A+E YK  LD  +     ++       
Sbjct: 437 WTAAIQNSDPV--RSYNDI-WPKIILRQAESYEAIEKYKLALDAYQTLLEKNLFSEKVIA 493

Query: 210 AKKKVEQSLDLEKKPET 226
            K++ + +L L+ KP++
Sbjct: 494 GKRRCQHALGLDSKPKS 510

>Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/73 (23%), Positives = 36/73 (49%)

Query: 112 DFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRL 171
           DFD  I  +  A++V P + + +    A+ ++    EEAI+    A++  P++ +    L
Sbjct: 472 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNL 531

Query: 172 GYAKFALGQAEDA 184
             +   +G  ++A
Sbjct: 532 AVSSMNIGCYKEA 544

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 30/49 (61%)

Query: 147 YEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIE 195
           +++ I   ESA+K +P     ++RLG +     ++E+A++AY + L ++
Sbjct: 473 FDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

>NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1403

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 30/47 (63%)

Query: 150 AIKDAESAIKTDPTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEG 196
           +I+  +SAI+ DP   + +  LG A  A G+ E +++ ++K ++++G
Sbjct: 688 SIEWFQSAIRVDPNDIESWVGLGQAYLACGRIEASMKVFEKAMELDG 734

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 39/80 (48%), Gaps = 2/80 (2%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIK-TDP 162
           GN      ++  A++ Y   IEV P N + Y+N A +   +  Y EA++   + +K  + 
Sbjct: 10  GNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESCGTGLKYVND 69

Query: 163 TYSKGYSRLGYAKFALGQAE 182
             S+ Y +L Y ++ L   E
Sbjct: 70  ADSQVYKKLQY-RYNLADTE 88

>Kpol_520.6 s520 (15903..16781) [879 bp, 292 aa] {ON} (15903..16781)
           [879 nt, 293 aa]
          Length = 292

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 57/122 (46%), Gaps = 15/122 (12%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAV---------YY----ANRAAAHS-SMKAYEE 149
           GN       FD A   Y + + + P N V         YY     N+  + S   +  +E
Sbjct: 166 GNLYFKLGQFDQAKHCYEEVVLLQPFNYVAFVRISEILYYKVIRLNKKISKSERTQILQE 225

Query: 150 AIKDAESAIKTDPTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGDKASDVMKRDYET 209
           ++ +A  +I+ +  + KG+S +     A+G  +D LE  K  L+ E  K++++  +D +T
Sbjct: 226 SLNNALRSIELNEMFLKGWSLIAIVSKAMGTKKDILEVSKNKLN-EIAKSNELSVQDVKT 284

Query: 210 AK 211
           A+
Sbjct: 285 AE 286

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 40/85 (47%), Gaps = 11/85 (12%)

Query: 112 DFDLAIKKYSDAIEVLPTNA----VYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKG 167
           D+D A+ +Y  ++  LP       + Y+N  AA   +  Y +++KD + A++  P   K 
Sbjct: 561 DYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALELFPKNDKQ 620

Query: 168 YSRLGYAKFALGQAEDALEAYKKVL 192
           +++         Q  D  + YK++ 
Sbjct: 621 WTQ-------FIQDSDPQKTYKEIW 638

>Kwal_55.21839 s55 (998426..1000498) [2073 bp, 690 aa] {ON} YOR080W
           (DIA2) - may be involved in regulation of invasive
           growth and budding pattern [contig 126] FULL
          Length = 690

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 44/99 (44%), Gaps = 10/99 (10%)

Query: 136 NRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIE 195
           NRAA    +    +A+KDA  A+K +P   K Y R G     L   + AL+ Y+     E
Sbjct: 76  NRAATWEKLGDLTKALKDANRAVKYEPYNLKCYLRKGKILQKLQLDDMALKNYE-----E 130

Query: 196 GDKASDVMKRDY-----ETAKKKVEQSLDLEKKPETQAR 229
           G + +D M+  Y     +   + VE    L K   T+ R
Sbjct: 131 GLQKADEMRSRYGLEPPQKLSRIVEHQKSLIKSRITETR 169

>CAGL0G10087g Chr7 (962823..967058) [4236 bp, 1411 aa] {ON} similar
           to uniprot|P17883 Saccharomyces cerevisiae YPR189w SKI3
           antiviral protein
          Length = 1411

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 6/56 (10%)

Query: 146 AYEEAIKDAES------AIKTDPTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIE 195
           AY E  +DAES      A++ DPT  + +  LG +    G+ E +L+ +++ LD++
Sbjct: 688 AYLEKQQDAESIQWFQLALRIDPTDVESWIGLGQSYLNCGRVEASLKVFERALDLD 743

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 29.6 bits (65), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 3/69 (4%)

Query: 116 AIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIK--TDPTYSKGYSRLGY 173
           A+  Y   I   P N V Y+N+A A   +  Y  AI+  +  ++    P ++   S+L Y
Sbjct: 27  AVDSYDQLITAQPQNPVGYSNKAMALIKLAEYTHAIQTCQEGLRYALGPEHAAIRSKLQY 86

Query: 174 AKFALGQAE 182
            +  L Q E
Sbjct: 87  -RLKLSQTE 94

>Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AFR453W
          Length = 573

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 39/88 (44%), Gaps = 3/88 (3%)

Query: 112 DFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRL 171
           +FD  I  +  A+ V P +   +    A+ ++    EEAI+    AI+  P + +    L
Sbjct: 436 EFDKTIDCFKAALHVRPNDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPAFVRARYNL 495

Query: 172 GYAKFALGQAEDALEAYKKVL---DIEG 196
             +   +G  ++A E     L   ++EG
Sbjct: 496 AVSSMNIGCYKEAAEQLLTALSMHEVEG 523

>SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 690

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 23/37 (62%)

Query: 136 NRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLG 172
           NRAA+   +   ++A+KDA++ I+ +P   K Y R G
Sbjct: 76  NRAASWEKLGKLDKALKDAKNMIRVEPHNLKCYIRCG 112

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 41/88 (46%), Gaps = 3/88 (3%)

Query: 112 DFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRL 171
           D+D  +  +  A+ V P + + +    A+ ++    EEAI+    A++  PT+ +    L
Sbjct: 441 DYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVRARCNL 500

Query: 172 GYAKFALGQAEDALEAYKKVL---DIEG 196
             +   +G  ++A E     L   ++EG
Sbjct: 501 AVSCMNMGCYKEAAEYLLTALSMHEVEG 528

>CAGL0J09570g Chr10 complement(941571..943220) [1650 bp, 549 aa]
           {ON} some similarities with uniprot|P35056 Saccharomyces
           cerevisiae YDR244w PAS10 peroxisomal targeting signal
           receptor
          Length = 549

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 40/83 (48%)

Query: 114 DLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGY 173
           D AIK +   +E  P + + + +  A  ++ K Y+ AI+   + I+  P++ +    LG 
Sbjct: 408 DNAIKCFEKLLEQDPKDEITWNHLGATLANSKRYDTAIQVYMNTIELKPSFVRARYNLGS 467

Query: 174 AKFALGQAEDALEAYKKVLDIEG 196
                G+ +  +E+    L ++G
Sbjct: 468 TLVKNGELQRGIESLLTALVMQG 490

>KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 941

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 45/104 (43%), Gaps = 4/104 (3%)

Query: 123 AIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQAE 182
           ++E+  T+A  + +    H     Y  A    + A+  D      +  +G   + + Q  
Sbjct: 350 SLEIDSTDATSWYHLGRIHMIRNDYTSAYDAFQQAVNRDSRNPTFWCSIGVLYYQIAQYR 409

Query: 183 DALEAYKKVLDIEGDKASDV---MKRDYETAKKKVEQSLDLEKK 223
           DAL+AY + + +     S+V   +   YET   +V  +LD  K+
Sbjct: 410 DALDAYTRAIRL-NPYISEVWYDLGTLYETCNNQVNDALDAYKQ 452

>Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON}
           (161135..162958) [1824 nt, 608 aa]
          Length = 607

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 21/92 (22%), Positives = 43/92 (46%), Gaps = 3/92 (3%)

Query: 112 DFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRL 171
           +FD  I  +  A++V P + + +    A+ ++    EEAI+    A+   P++ +    L
Sbjct: 465 EFDKTIDCFKAALKVSPNDELLWNRLGASLANSNRSEEAIQAYHKALNLKPSFVRARYNL 524

Query: 172 GYAKFALGQAEDALEAYKKVL---DIEGDKAS 200
             +   +G  ++A +     L   ++EG K S
Sbjct: 525 AVSSINIGCYKEAAQYLLTALSMHEVEGLKGS 556

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 29.6 bits (65), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 34/76 (44%), Gaps = 4/76 (5%)

Query: 147 YEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGDKASDVMKRD 206
           Y EA+   +  I   P    GYS    A   LG+   A++A ++ L      AS     D
Sbjct: 24  YLEAVDSYDRLIAAQPQNPVGYSNKAMALIKLGEHAQAIQACQQGL----QHASTTTTPD 79

Query: 207 YETAKKKVEQSLDLEK 222
           + T + K++  L+L +
Sbjct: 80  HVTIRAKLQYRLELSQ 95

>KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 566

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 20/92 (21%), Positives = 41/92 (44%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           G    A ++F   I  +  A+EV P + + +    A+ ++    EEAI+    A+   P+
Sbjct: 423 GTLFYANEEFGKTIDCFRTALEVNPNDELMWNRLGASLANSNRSEEAIQAYHKALALKPS 482

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKKVLDIE 195
           + +    L  +   +G  ++A E+    L + 
Sbjct: 483 FVRARYNLAISSMNIGCYKEAAESLLSALSMH 514

>TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa]
           {ON} Anc_3.367 YBR112C
          Length = 1043

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 41/95 (43%), Gaps = 1/95 (1%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           G   M   D+  A   +  A+     N +++ +    +  +  Y +A+     AI+ +P 
Sbjct: 312 GRVHMIRADYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 371

Query: 164 YSKGYSRLGYAKFALG-QAEDALEAYKKVLDIEGD 197
            S+ +  LG        Q  DAL+AYK+   ++ D
Sbjct: 372 ISEVWYDLGTLYETCNKQLNDALDAYKQAARLDPD 406

 Score = 30.8 bits (68), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 52/116 (44%), Gaps = 8/116 (6%)

Query: 111 KDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSR 170
           K  +L +K    ++E+ P++A  + +    H     Y  A    + A+  D      +  
Sbjct: 289 KALNLLLK----SLEIDPSDAATWYHLGRVHMIRADYTAAYDAFQQAVNRDSRNPIFWCS 344

Query: 171 LGYAKFALGQAEDALEAYKKVLDIEGDKASDV---MKRDYETAKKKVEQSLDLEKK 223
           +G   + + Q  DAL+AY + + +     S+V   +   YET  K++  +LD  K+
Sbjct: 345 IGVLYYQISQYRDALDAYTRAIRL-NPYISEVWYDLGTLYETCNKQLNDALDAYKQ 399

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 30.0 bits (66), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 26/48 (54%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAI 151
           GN      D++ AI  Y  A  +  +N +Y++N A A   ++ ++EA+
Sbjct: 48  GNTFFKNGDYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEAV 95

>Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}
           complement(5901..9536) [3636 nt, 1212 aa]
          Length = 1211

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%)

Query: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCI 40
           +SP  KE    I  YL++L E   V+ EA+  L + ID +
Sbjct: 794 LSPKEKEELENITTYLTELTENFEVTVEALSGLTIQIDSL 833

>CAGL0M08030g Chr13 complement(800149..801312) [1164 bp, 387 aa]
           {ON} similar to uniprot|P47103 Saccharomyces cerevisiae
           YJR032w Peptidyl-prolyl cis-trans isomerase CYP7
          Length = 387

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 46/96 (47%), Gaps = 13/96 (13%)

Query: 134 YANRAAAHSSMKAYEEAIKDAESAIKTDPT----YSKGYSRLGYAKFALGQAEDALEAYK 189
           Y N   A  ++K Y+E++K     ++ D       +K Y R+G + FA  + ++AL+ Y+
Sbjct: 289 YLNICLALFNLKDYDESMKYGHYLLELDSVDDKDKAKAYYRIGNSLFAKKRYDEALKNYR 348

Query: 190 KVLDIEGD---------KASDVMKRDYETAKKKVEQ 216
              D   D         K  ++++++ E  KK + +
Sbjct: 349 LCRDHNPDDNVIGQKIEKTENILEKEKERTKKNISK 384

>TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {ON}
           Anc_3.367 YBR112C
          Length = 759

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 46/104 (44%), Gaps = 4/104 (3%)

Query: 123 AIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQAE 182
           ++EV P++A  + +    H     Y  A    + A+  D      +  +G   + + Q  
Sbjct: 268 SLEVNPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYR 327

Query: 183 DALEAYKKVLDIEGDKASDV---MKRDYETAKKKVEQSLDLEKK 223
           DAL+AY + + +     S+V   +   YET   ++  +LD  K+
Sbjct: 328 DALDAYTRAIRL-NPYISEVWYDLGTLYETCNNQLTDALDAYKQ 370

>KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.367
           YBR112C
          Length = 973

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 46/104 (44%), Gaps = 4/104 (3%)

Query: 123 AIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQAE 182
           ++EV P++A  + +    H     Y  A    + A+  D      +  +G   + + Q  
Sbjct: 307 SLEVDPSDATTWYHLGRVHMVRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYR 366

Query: 183 DALEAYKKVLDIEGDKASDV---MKRDYETAKKKVEQSLDLEKK 223
           DAL+AY + + +     S+V   +   YET   ++  +LD  K+
Sbjct: 367 DALDAYTRAIRL-NPYISEVWYDLGTLYETCNNQLTDALDAYKQ 409

>KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {ON}
           Anc_7.412 YBL084C
          Length = 739

 Score = 30.4 bits (67), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 37/87 (42%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPT 163
           GN     KD   AIK +  A  +    A  Y  +   H++ + Y+ A      AI  DP 
Sbjct: 528 GNYFSLIKDHGEAIKAFEKATSLDRKFAYAYTLQGHEHAANETYDTAKIMYRKAIACDPQ 587

Query: 164 YSKGYSRLGYAKFALGQAEDALEAYKK 190
           +   Y  LG     LG+ + AL  ++K
Sbjct: 588 HYNAYYGLGDCASRLGKYDKALLYFEK 614

>NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa]
           {ON} Anc_3.367
          Length = 907

 Score = 30.4 bits (67), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 45/104 (43%), Gaps = 4/104 (3%)

Query: 123 AIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQAE 182
           ++EV P ++  + +    H     Y  A    + A+  D      +  +G   + + Q  
Sbjct: 298 SLEVDPNDSTTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYR 357

Query: 183 DALEAYKKVLDIEGDKASDV---MKRDYETAKKKVEQSLDLEKK 223
           DAL+AY + + +     S+V   +   YET   ++  +LD  K+
Sbjct: 358 DALDAYTRAIRL-NPYISEVWYDLGTLYETCNNQLNDALDAYKQ 400

>Suva_4.191 Chr4 (335199..340547) [5349 bp, 1782 aa] {ON} YDL058W
           (REAL)
          Length = 1782

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 43/77 (55%), Gaps = 4/77 (5%)

Query: 142 SSMKAYEEAIKDAESAIKTDPTYSK----GYSRLGYAKFALGQAEDALEAYKKVLDIEGD 197
           S++   EEAI+  E  ++T  +  K    G +++G   FAL + + A+E  ++ L  E D
Sbjct: 830 STIHKQEEAIRTLEKELETISSQKKKAEDGINKMGKDLFALSREKQAVEEKQRSLQKEKD 889

Query: 198 KASDVMKRDYETAKKKV 214
           K++   +++ ++ K ++
Sbjct: 890 KSNSDHQKETKSLKDEI 906

>KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 568

 Score = 30.0 bits (66), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 41/88 (46%), Gaps = 3/88 (3%)

Query: 112 DFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRL 171
           D+D  +  +  A+ V P + + +    A+ ++    EEAI+    A++  PT+ +    L
Sbjct: 434 DYDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVRARCNL 493

Query: 172 GYAKFALGQAEDALEAYKKVL---DIEG 196
             +   +G  ++A E     L   ++EG
Sbjct: 494 AVSCMNMGCFKEAAEYLLTALSMHEVEG 521

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 28.9 bits (63), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 26/56 (46%)

Query: 104 GNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIK 159
           GN      D++ A+  Y  AI   P+N + Y+N A     ++ + EA+      +K
Sbjct: 11  GNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDACNKGLK 66

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.127    0.344 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,951,719
Number of extensions: 946468
Number of successful extensions: 3897
Number of sequences better than 10.0: 226
Number of HSP's gapped: 3780
Number of HSP's successfully gapped: 349
Length of query: 343
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 233
Effective length of database: 40,868,139
Effective search space: 9522276387
Effective search space used: 9522276387
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 66 (30.0 bits)