Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G044706.22ON54254227990.0
KAFR0A050706.22ON56454021360.0
ZYRO0C07744g6.22ON54753821010.0
NCAS0D021606.22ON56354220990.0
Kpol_1037.276.22ON54654620910.0
NDAI0C026306.22ON58054320770.0
KNAG0F028906.22ON56354020530.0
KLLA0D01221g6.22ON56654720130.0
SAKL0E01364g6.22ON54153919980.0
TBLA0G009706.22ON55954319950.0
Suva_15.1776.22ON54454419940.0
YOR002W (ALG6)6.22ON54454419910.0
Smik_15.1716.22ON54454419870.0
CAGL0E02629g6.22ON54854419840.0
Skud_15.1636.22ON54454419750.0
Ecym_30276.22ON54954119500.0
KLTH0C11176g6.22ON53653619290.0
Kwal_56.224376.22ON53653419240.0
TPHA0J003506.22ON55954619210.0
ACR004W6.22ON56353618490.0
Kwal_55.217425.669ON5554172942e-27
TPHA0J013805.669ON5754182845e-26
TBLA0A093105.669ON5463972801e-25
YOR067C (ALG8)5.669ON5772552792e-25
KLTH0F17666g5.669ON5554212739e-25
CAGL0L10450g5.669ON5504152702e-24
Skud_15.2345.669ON5772552694e-24
Smik_15.2475.669ON5772552694e-24
TDEL0B025405.669ON5693732677e-24
KAFR0D024405.669ON5752662667e-24
Kpol_1018.735.669ON6214172678e-24
NCAS0G004505.669ON5702612641e-23
ADR210C5.669ON5722612641e-23
Suva_8.1185.669ON5762552623e-23
ZYRO0A11506g5.669ON5562612571e-22
KLLA0F16621g5.669ON5612562571e-22
SAKL0G00836g5.669ON5612672524e-22
KNAG0L019205.669ON5682612508e-22
NDAI0F005105.669ON5704192472e-21
Ecym_40515.669ON6043812429e-21
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G04470
         (542 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.2...  1082   0.0  
KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa] ...   827   0.0  
ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly...   813   0.0  
NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {O...   813   0.0  
Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {O...   810   0.0  
NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.2...   804   0.0  
KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {O...   795   0.0  
KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {...   780   0.0  
SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} simila...   774   0.0  
TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.2...   773   0.0  
Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002...   772   0.0  
YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha...   771   0.0  
Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002...   769   0.0  
CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly...   768   0.0  
Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002...   765   0.0  
Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON} s...   755   0.0  
KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} simila...   747   0.0  
Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {...   745   0.0  
TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON...   744   0.0  
ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic ho...   716   0.0  
Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {...   117   2e-27
TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {...   114   5e-26
TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON} Anc_5...   112   1e-25
YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON} ...   112   2e-25
KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]...   109   9e-25
CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa...   108   2e-24
Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {...   108   4e-24
Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {...   108   4e-24
TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.6...   107   7e-24
KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.6...   107   7e-24
Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa] ...   107   8e-24
NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669...   106   1e-23
ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}...   106   1e-23
Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON...   105   3e-23
ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {...   103   1e-22
KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]...   103   1e-22
SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly s...   101   4e-22
KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {...   100   8e-22
NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.6...   100   2e-21
Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar t...    98   9e-21

>TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.22
           YOR002W
          Length = 542

 Score = 1082 bits (2799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/542 (97%), Positives = 530/542 (97%)

Query: 1   MAPKNKEAKRNTVEESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYSG 60
           MAPKNKEAKRNTVEESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYSG
Sbjct: 1   MAPKNKEAKRNTVEESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYSG 60

Query: 61  QFSPPMFGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKP 120
           QFSPPMFGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKP
Sbjct: 61  QFSPPMFGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKP 120

Query: 121 EWFELNESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAA 180
           EWFELNESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAA
Sbjct: 121 EWFELNESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAA 180

Query: 181 ILFQPSLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPI 240
           ILFQPSLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPI
Sbjct: 181 ILFQPSLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPI 240

Query: 241 FFAYLLSKSLFSPRFNFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRIFPFAR 300
           FFAYLLSKSLFSPRFNFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRIFPFAR
Sbjct: 241 FFAYLLSKSLFSPRFNFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRIFPFAR 300

Query: 301 GIFEDKVANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIICYA 360
           GIFEDKVANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIICYA
Sbjct: 301 GIFEDKVANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIICYA 360

Query: 361 LATCSMSFYLFSFQVHEKXXXXXXXXXXXXYTSSNWDVLSMANWINNVGLFTLYPLLKKD 420
           LATCSMSFYLFSFQVHEK            YTSSNWDVLSMANWINNVGLFTLYPLLKKD
Sbjct: 361 LATCSMSFYLFSFQVHEKTILVPLLPITLLYTSSNWDVLSMANWINNVGLFTLYPLLKKD 420

Query: 421 GLTLQYFVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWKII 480
           GLTLQYFVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWKII
Sbjct: 421 GLTLQYFVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWKII 480

Query: 481 IVSSYTAMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKTLQ 540
           IVSSYTAMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKTLQ
Sbjct: 481 IVSSYTAMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKTLQ 540

Query: 541 QL 542
           QL
Sbjct: 541 QL 542

>KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa]
           {ON} Anc_6.22 YOR002W
          Length = 564

 Score =  827 bits (2136), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/540 (71%), Positives = 450/540 (83%), Gaps = 1/540 (0%)

Query: 4   KNKEAKRNTVEESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYSGQFS 63
           K  +     +EE FYASPLYDFLYPFRPAG+QWL +Y+IV FALII CA+G GSYSG   
Sbjct: 25  KASKLNNEAIEEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMGH 84

Query: 64  PPMFGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKPEWF 123
            PMFGDFEAQRHWMEITQHL  S+WYWFDL+YWGLDYPPLTAYHSY+LGKIGSFI P+WF
Sbjct: 85  SPMFGDFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWF 144

Query: 124 ELNESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILF 183
            LN+SRGIE   +K++MR TVL+SE +FY PA++YF+KW GKHR +SPIGQ+I+A AILF
Sbjct: 145 TLNDSRGIEMEGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILF 204

Query: 184 QPSLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFA 243
           QPSLMLIDHGHFQYN VMLGLTVYAIN+L ++FY+VA++CFVLSICFKQM+LYYAPIFF 
Sbjct: 205 QPSLMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFG 264

Query: 244 YLLSKSLFSPR-FNFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRIFPFARGI 302
           YLLSKSLF PR FN PRL  IA  T+++F AMY+PLYIFGGGL N+IQSVHRIFPFARGI
Sbjct: 265 YLLSKSLFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHRIFPFARGI 324

Query: 303 FEDKVANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIICYALA 362
           FEDKVANFWCVTN+  KYK  F Q+QLQLYSL AT+LGFLPA+++I LYPKKH++ YALA
Sbjct: 325 FEDKVANFWCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLPYALA 384

Query: 363 TCSMSFYLFSFQVHEKXXXXXXXXXXXXYTSSNWDVLSMANWINNVGLFTLYPLLKKDGL 422
            CSMSF+LFSFQVHEK            YTS++W+VLSM  WINNV LFTL+PLLKKDGL
Sbjct: 385 ACSMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSMVCWINNVALFTLWPLLKKDGL 444

Query: 423 TLQYFVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWKIIIV 482
            LQY VCF LSNWLLGNFSFVTPKFLPK LTPGPS+S++  NY RRS LP N++WK++IV
Sbjct: 445 ILQYAVCFALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWKVVIV 504

Query: 483 SSYTAMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKTLQQL 542
           SSY +M V H +DF + PP +YPD+W+ LNC +GFG F  FW+W+YYMLFT+  KTL  L
Sbjct: 505 SSYLSMAVFHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKTLMDL 564

>ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 547

 Score =  813 bits (2101), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/538 (72%), Positives = 452/538 (84%)

Query: 5   NKEAKRNTVEESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYSGQFSP 64
            K    NT EESFYASPLYDFLYPF+P GSQWL EY+I+LFA+II CA+G G YSGQ   
Sbjct: 10  EKAQADNTAEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGLGPYSGQSVK 69

Query: 65  PMFGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKPEWFE 124
           PM GDFEAQRHW+EITQHL  SQWY+FDLEYWGLDYPPLTAYHSY+LGK+GS I P+WF 
Sbjct: 70  PMHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPDWFA 129

Query: 125 LNESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILFQ 184
           LN SRG+E+ DLKT+MRFTV+LSE +FYIPAVVYFTKW+G+HR  SP+GQFI+AAAILFQ
Sbjct: 130 LNVSRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQ 189

Query: 185 PSLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFAY 244
           P+LMLIDHGHFQYNCVMLG TVYAINSL +EFYA AA CFVLSICFKQMALYY+PIFFAY
Sbjct: 190 PALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFFAY 249

Query: 245 LLSKSLFSPRFNFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRIFPFARGIFE 304
           LL + +F     FPR  +IA+AT+ +F  MY PLYI G G  NV+QSVHRIFPFARGIFE
Sbjct: 250 LLGRCVFKTGIRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHRIFPFARGIFE 309

Query: 305 DKVANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIICYALATC 364
           DKVANFWCVTN+F KYK +F Q+QLQLYSL+AT LGFLPAV+++ LYPKKH++ +ALA C
Sbjct: 310 DKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKHLVPFALAAC 369

Query: 365 SMSFYLFSFQVHEKXXXXXXXXXXXXYTSSNWDVLSMANWINNVGLFTLYPLLKKDGLTL 424
           SMSF+LFSFQVHEK            YTS+NWDVLS+ +WINNVGLFTL+PLLKKDGL L
Sbjct: 370 SMSFFLFSFQVHEKTILVPLLPITLLYTSTNWDVLSLVSWINNVGLFTLWPLLKKDGLAL 429

Query: 425 QYFVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWKIIIVSS 484
           QY VCF   NWL+GNFSFVTP FLPKFLTPGPSVSSVD NYRRRS LP ++IWK+IIV S
Sbjct: 430 QYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSIIWKLIIVGS 489

Query: 485 YTAMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKTLQQL 542
           Y +MG +HV+D  + PP++YPDLWV+LNC LGFGCF LFWLW+YY LF++  ++LQQL
Sbjct: 490 YISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLAGQSLQQL 547

>NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  813 bits (2099), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/542 (71%), Positives = 448/542 (82%), Gaps = 3/542 (0%)

Query: 4   KNKEAKRNTVEESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYSGQFS 63
           K    K +  EESFYASPLYD LYPFRPAGSQW+TEY IVLF+LII CAVG G +SG   
Sbjct: 22  KETSKKHDIPEESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAVGLGPFSGYGV 81

Query: 64  PPMFGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKPEWF 123
           PPMFGDFEAQRHWMEITQHL   +WYWFDL+YWGLDYPPLTAYHSY+ GKIGSF  P WF
Sbjct: 82  PPMFGDFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWF 141

Query: 124 ELNESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILF 183
            L+ SRG E  DLKTFMR TVL+SE LFYIP VVYF KWLGKHR++SPIGQFI+AAAIL 
Sbjct: 142 ALDSSRGYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILL 201

Query: 184 QPSLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFA 243
           QPSL+LIDHGHFQYN V LGLTVYAIN+L +EFYA+AA+CFVLSICFKQM LYY+PIFFA
Sbjct: 202 QPSLILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFA 261

Query: 244 YLLSKSLFSPR-FNFPRLFAIAVATVLSFAAMYAPLYIFGG--GLANVIQSVHRIFPFAR 300
           YLLSKSLF+P+ FN PR  AIA+ATV SF  MY PLY+FGG  GL NV+QS+HRIFPFAR
Sbjct: 262 YLLSKSLFTPKLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQGLNNVLQSIHRIFPFAR 321

Query: 301 GIFEDKVANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIICYA 360
           GIFEDKVANFWCVTNV FKYK +F Q++LQLYSL+ T++GFLPA+++I  YPKK+++ YA
Sbjct: 322 GIFEDKVANFWCVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYPKKYLLPYA 381

Query: 361 LATCSMSFYLFSFQVHEKXXXXXXXXXXXXYTSSNWDVLSMANWINNVGLFTLYPLLKKD 420
           L+ CSM+FYLFSFQVHEK            YTS++ +VLS  +W+NN+GLFTL+PLLKKD
Sbjct: 382 LSACSMAFYLFSFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGLFTLWPLLKKD 441

Query: 421 GLTLQYFVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWKII 480
           GLTLQY+VC  LSNWL+GNFSF+TP FLPK LTPGPSVS +  NY  RS LP N+ WK+I
Sbjct: 442 GLTLQYWVCLLLSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLPRNIFWKVI 501

Query: 481 IVSSYTAMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKTLQ 540
           IV SY AMG +HV+D  + PPV+YPDLWV+LNC LGFGCF LFW+W+YY LF+M +K+L 
Sbjct: 502 IVLSYIAMGAIHVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLFSMIKKSLH 561

Query: 541 QL 542
            L
Sbjct: 562 HL 563

>Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {ON}
           complement(65544..67184) [1641 nt, 547 aa]
          Length = 546

 Score =  810 bits (2091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/546 (71%), Positives = 456/546 (83%), Gaps = 4/546 (0%)

Query: 1   MAPKNKEAKRNT-VEESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYS 59
           MA K K ++ N  VEESF+ASPLYDFL PFRP  +QWLTEY+IV+FALI+ CA+G GSYS
Sbjct: 1   MASKKKISRINKPVEESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYS 60

Query: 60  GQFSPPMFGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIK 119
           G  +PPMFGDFEAQRHWMEITQHL  S+WY+FDLEYWGLDYPPLTAYHSYVLG IGSF+ 
Sbjct: 61  GMGNPPMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLN 120

Query: 120 PEWFELNESRGIETP--DLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFIS 177
             WF LN+SRG E+   DLKT+MR TV++SE +FYIP V+YFTKW+G+HRQ+S IGQ+I+
Sbjct: 121 KSWFALNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIA 180

Query: 178 AAAILFQPSLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYY 237
           AAAILFQPSLMLIDHGHFQYN VMLGLTVYAIN+L +EFYA AA+CFVLSICFKQMALYY
Sbjct: 181 AAAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYY 240

Query: 238 APIFFAYLLSKSLFSPRF-NFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRIF 296
           APIFF YLL +SLFS +F N  R  +IA++TV +F +MYAPLY+FGGGL NVIQSVHRIF
Sbjct: 241 APIFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQSVHRIF 300

Query: 297 PFARGIFEDKVANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHI 356
           PFARG+FEDKVANFWCVTN+F KYK ++ Q++LQLYSLIAT++GFLPAV+ I  YPKKH+
Sbjct: 301 PFARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHL 360

Query: 357 ICYALATCSMSFYLFSFQVHEKXXXXXXXXXXXXYTSSNWDVLSMANWINNVGLFTLYPL 416
           + YALA CSMSFYLFSFQVHEK            YTS++W+VLS  +W+NNVGLFTL+PL
Sbjct: 361 LPYALAACSMSFYLFSFQVHEKTILVPLLPITLLYTSTDWNVLSFVSWVNNVGLFTLWPL 420

Query: 417 LKKDGLTLQYFVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVI 476
           LKKDGLTLQY VCF LSNWL+GNFSF+TPKFLPK LTPGP V + +  Y RRS LP N++
Sbjct: 421 LKKDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNIL 480

Query: 477 WKIIIVSSYTAMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPR 536
           WKIIIVSSY  M ++H+ +  + PP  YPD+WVL+NC LGFGCF LFWLW+YY +FT+  
Sbjct: 481 WKIIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLAN 540

Query: 537 KTLQQL 542
           KTLQ L
Sbjct: 541 KTLQYL 546

>NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.22
           YOR002W
          Length = 580

 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/543 (70%), Positives = 450/543 (82%), Gaps = 4/543 (0%)

Query: 4   KNKEAKRNTVEESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYSGQFS 63
            N+  +  T +ESFYASPLYDFLYPFRPAGSQW+TEY+IVLFA+II CAVG G YSG  +
Sbjct: 38  NNQPLETETSKESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFNT 97

Query: 64  PPMFGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKPEWF 123
           PPMFGDFEAQRHWMEITQ+L  SQWYWFDL+YWGLDYPPLTA+HSY+ GKIGSF +P WF
Sbjct: 98  PPMFGDFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNWF 157

Query: 124 ELNESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILF 183
            L +SRG E  DLKTFMR TVL SE L YIPAVVYFTKWLGK R +SPIGQFI+ AAILF
Sbjct: 158 TLGDSRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILF 217

Query: 184 QPSLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFA 243
           QPSL+LIDHGHFQ+N VMLGLTVY +N+L +EFYA AA+CFVLSICFKQMALYY+PIFFA
Sbjct: 218 QPSLILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFA 277

Query: 244 YLLSKSLFSPR-FNFPRLFAIAVATVLSFAAMYAPLYIFG---GGLANVIQSVHRIFPFA 299
           YLLSKSLF PR FN PR  AI+ AT+ +FA+M+ P+Y FG   GG+ N++QS+ RIFPFA
Sbjct: 278 YLLSKSLFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLLQSIKRIFPFA 337

Query: 300 RGIFEDKVANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIICY 359
           RGIFEDKVANFWCVTNV FKYK  F QEQLQLYSLI T++ FLPA++VI LYP+K+++ Y
Sbjct: 338 RGIFEDKVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLLY 397

Query: 360 ALATCSMSFYLFSFQVHEKXXXXXXXXXXXXYTSSNWDVLSMANWINNVGLFTLYPLLKK 419
           AL+ CSMSFYLFSFQVHEK            YTS++ +VLS  +W+NN+GLFTL+PLLKK
Sbjct: 398 ALSACSMSFYLFSFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGLFTLWPLLKK 457

Query: 420 DGLTLQYFVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWKI 479
           DGL+LQY+VC  LSNWL+GNFSF+TP+FLPK LTPGPS+  +  NYRR + LPSN IWK+
Sbjct: 458 DGLSLQYWVCLILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLPSNWIWKV 517

Query: 480 IIVSSYTAMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKTL 539
           IIV SY  MGV+H VD+ + PP +YPDLWV+LNC LGFGCF LFWLW+YY LF+M +K +
Sbjct: 518 IIVLSYVMMGVIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLFSMTKKNI 577

Query: 540 QQL 542
            QL
Sbjct: 578 HQL 580

>KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  795 bits (2053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/540 (69%), Positives = 447/540 (82%), Gaps = 2/540 (0%)

Query: 4   KNKEAKRNTVEESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYSGQFS 63
           +NK+     VEE FYASP+YDFLYPFR  GSQW+TEY+IV+F LII  A+G GSYSG  +
Sbjct: 25  RNKDEAAPEVEECFYASPIYDFLYPFRSPGSQWVTEYIIVVFLLIIKSAIGLGSYSGFQT 84

Query: 64  PPMFGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKPEWF 123
           PPMFGDFEAQRHWMEITQHL  SQWYWFDL+YWGLDYPP TAYHSY+LGKIG+FI P WF
Sbjct: 85  PPMFGDFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWF 144

Query: 124 ELNESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILF 183
           EL+ SRG+ET  +K++MRFTVLLSE +FYIPA+VYFTKW+G+ +++SPIGQF++AAAILF
Sbjct: 145 ELDASRGMETDGIKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILF 204

Query: 184 QPSLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFA 243
           QP+LMLIDHGHFQYNCVMLGLTVYAIN+L + FYA+AA+CFVLSICFKQMALYYAPIFFA
Sbjct: 205 QPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFA 264

Query: 244 YLLSKSLFSPR-FNFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRIFPFARGI 302
            LLSKSLF PR FN PR  ++A AT+ S   M+APLYIF GG+ NV+QS+HRIFPFARGI
Sbjct: 265 VLLSKSLFFPRLFNIPRFLSVAFATLASLFVMFAPLYIF-GGVGNVLQSIHRIFPFARGI 323

Query: 303 FEDKVANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIICYALA 362
           FEDKVANFWCVTNVFFKYK +F Q +LQ YSL+AT++GF PA +++  YPKK +I Y LA
Sbjct: 324 FEDKVANFWCVTNVFFKYKTMFTQSELQFYSLVATVVGFFPAFMIMIFYPKKFLIPYGLA 383

Query: 363 TCSMSFYLFSFQVHEKXXXXXXXXXXXXYTSSNWDVLSMANWINNVGLFTLYPLLKKDGL 422
            CSM+F+LFSFQVHEK            +TS+NW+ LSM  W+NNV LFTL+PLLKKDGL
Sbjct: 384 ACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLLKKDGL 443

Query: 423 TLQYFVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWKIIIV 482
            LQY VC  + NWLLGNFSF+TP+FLPK LTPGPS+S++  NYRRRS LP N+IWKIII+
Sbjct: 444 WLQYCVCLVMYNWLLGNFSFITPRFLPKILTPGPSISNIAENYRRRSLLPHNIIWKIIIL 503

Query: 483 SSYTAMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKTLQQL 542
            SY  M ++HV+++ +  P  YPDLWV LNC +GFGCF LFW+W+YY L T+  KT+Q+L
Sbjct: 504 VSYLCMLMIHVLEYTIAAPSQYPDLWVQLNCTVGFGCFVLFWMWTYYKLITLRNKTIQEL 563

>KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {ON}
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease,
          Length = 566

 Score =  780 bits (2013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/547 (66%), Positives = 445/547 (81%), Gaps = 8/547 (1%)

Query: 3   PKNKEAKRNT-----VE--ESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGH 55
           P N E   +T     VE  E+F+ASP+YDFL PFRP G+QW  +YVIV+FALII CAVG 
Sbjct: 21  PANAETTTSTAIMKKVESVEAFFASPMYDFLTPFRPVGNQWCAKYVIVIFALIIRCAVGL 80

Query: 56  GSYSGQFSPPMFGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIG 115
           G YSG  +PPMFGDFEAQRHWMEITQHL   +WYW+DL+YWGLDYPPLTAYHSY+LGK+G
Sbjct: 81  GGYSGMNTPPMFGDFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLG 140

Query: 116 SFIKPEWFELNESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQF 175
           SF +  WF+L  SRG E+ +LK++MRFTV++SE L YIPAV+YFTKW+GK+R +SPIGQ+
Sbjct: 141 SFFREGWFDLESSRGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQY 200

Query: 176 ISAAAILFQPSLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMAL 235
           I+AAAILFQP+L+L+DHGHFQYNCVMLG+TVY +N+L + FYA+ AICFVLS+CFKQMAL
Sbjct: 201 IAAAAILFQPALILVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMAL 260

Query: 236 YYAPIFFAYLLSKSLFSPRFNFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRI 295
           YY+PIFFAYLLSKS +SP  N PRLFAI+V+T L+F   + P+YIF GG  N++QS+HRI
Sbjct: 261 YYSPIFFAYLLSKSTYSPGINLPRLFAISVSTALAFIGSFGPIYIF-GGYKNLVQSMHRI 319

Query: 296 FPFARGIFEDKVANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKH 355
           FPFARGIFEDKVANFWCV+N+F KY+N+F Q+ LQLYSL+AT++G LP+ I+ FLYPK+H
Sbjct: 320 FPFARGIFEDKVANFWCVSNIFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKRH 379

Query: 356 IICYALATCSMSFYLFSFQVHEKXXXXXXXXXXXXYTSSNWDVLSMANWINNVGLFTLYP 415
           ++ YALA CSMSF+LFSFQVHEK            YTS +W+VLS+  WINNV LFTL+P
Sbjct: 380 LLPYALAACSMSFFLFSFQVHEKTILLPLLPITLLYTSRDWNVLSLVCWINNVALFTLWP 439

Query: 416 LLKKDGLTLQYFVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNV 475
           LLKKD L LQY V F  SNWL+GNFSFVTP+FLPKFLTPGPS+S +D++YRR S LP ++
Sbjct: 440 LLKKDNLVLQYGVMFMFSNWLIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKSL 499

Query: 476 IWKIIIVSSYTAMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMP 535
           IW++IIV SY AMG++H +D+ + PP  YPDLWVL NC+LGF CF  FW+W+ Y LF M 
Sbjct: 500 IWRLIIVGSYIAMGIIHFLDYYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEMR 559

Query: 536 RKTLQQL 542
             TLQ L
Sbjct: 560 NSTLQDL 566

>SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 541

 Score =  774 bits (1998), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/539 (69%), Positives = 441/539 (81%), Gaps = 1/539 (0%)

Query: 1   MAPKNKEAKRNTVEESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYSG 60
           M+ K K   R  V+ESF+ASPL+DFL PFRP  +QW  +Y+IVLFALII C VG GS+SG
Sbjct: 1   MSSKRKPYSRKIVKESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSG 60

Query: 61  QFSPPMFGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKP 120
              PPM GDFEAQRHWME+T +L  SQWYW+DL YWGLDYPPLTAYHSY+LGK+G    P
Sbjct: 61  MNVPPMHGDFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDP 120

Query: 121 EWFELNESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAA 180
            WF+L  SRG E+ DLK++MRFTVLLSE L YIP V+YF KW+GKHR ++PIGQ+I+AAA
Sbjct: 121 TWFQLGVSRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAA 180

Query: 181 ILFQPSLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPI 240
           ILFQPSL+LIDHGHFQYN VMLGLTVYAIN+L +E+YA AAICFVLS+CFKQMALYYAPI
Sbjct: 181 ILFQPSLILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPI 240

Query: 241 FFAYLLSKSLFSPRFNFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRIFPFAR 300
           FF+YLLSKSLFSP FN PRL A+A AT++SFAAM+ PLY++ GG+ NV+QS+HRIFPF+R
Sbjct: 241 FFSYLLSKSLFSPLFNLPRLLAVAAATLISFAAMFFPLYMW-GGIRNVLQSIHRIFPFSR 299

Query: 301 GIFEDKVANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIICYA 360
           GIFEDKVANFWC +N+F KYK ++ Q QLQ+YSL AT LGFLPA I+IF YPKKH+I YA
Sbjct: 300 GIFEDKVANFWCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIPYA 359

Query: 361 LATCSMSFYLFSFQVHEKXXXXXXXXXXXXYTSSNWDVLSMANWINNVGLFTLYPLLKKD 420
           L  CSMSF+LFSFQVHEK            YTS++W+VLSM +WINN+  FTL+PLLKKD
Sbjct: 360 LTACSMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSMVSWINNMAFFTLWPLLKKD 419

Query: 421 GLTLQYFVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWKII 480
           GL LQY     LSNWL+GNFSFVTP+FLPKFLTPGPS S V  NYRRRS LP N+ WK+I
Sbjct: 420 GLVLQYATLLLLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWKLI 479

Query: 481 IVSSYTAMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKTL 539
           IV+SY +MG+LH++DF + PP  YPDLWVLLNC+LGF  F LFW+W+YY +FT+  KTL
Sbjct: 480 IVASYISMGILHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKTL 538

>TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.22
           YOR002W
          Length = 559

 Score =  773 bits (1995), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/543 (68%), Positives = 440/543 (81%), Gaps = 14/543 (2%)

Query: 14  EESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYSGQFSPPMFGDFEAQ 73
           EE+FYASPL+DFLYPFRP GSQWLTEYVI++FA+II CA+  GSYSG+ +PPMFGDFEAQ
Sbjct: 17  EEAFYASPLFDFLYPFRPVGSQWLTEYVIIIFAIIIRCAISLGSYSGKGTPPMFGDFEAQ 76

Query: 74  RHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKPEWFELNESRGIET 133
           RHWMEITQHL  S+WYWFDL+YWGLDYPP TAYHSY  GK+GSF  P+WF LN SRG E+
Sbjct: 77  RHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYES 136

Query: 134 PD--LKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILFQPSLMLID 191
            D  LKT+MRFTV+LSE +FYIPAVVYFTKWLGKHR +SPIGQFI+AAAILFQPSLMLID
Sbjct: 137 DDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLMLID 196

Query: 192 HGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFAYLLSKSLF 251
           HGHFQYN VMLGLTVYAIN+L +EFY  AAICFVLS+CFKQMALYY+PIFF YLLSKSL 
Sbjct: 197 HGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKSLV 256

Query: 252 SPRFNFPRLFAIAVATVLSFAAMYAPLYIFGG------------GLANVIQSVHRIFPFA 299
            P  N  R   +A++TV+SF  M+ P+Y+FG             GL N+IQ + RIFPFA
Sbjct: 257 HPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFPFA 316

Query: 300 RGIFEDKVANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIICY 359
           RGIFEDKVANFWCVTNV  KY+ +F QEQLQ YSL+AT++GFLP++I IFLYP+K +I Y
Sbjct: 317 RGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLIPY 376

Query: 360 ALATCSMSFYLFSFQVHEKXXXXXXXXXXXXYTSSNWDVLSMANWINNVGLFTLYPLLKK 419
           ALA CSMSF+LFSFQVHEK            YTS++W+VLS+  WINNV LFTL+PLL+K
Sbjct: 377 ALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLRK 436

Query: 420 DGLTLQYFVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWKI 479
           DGL LQYFVC+ LSNWL+GNFSF+TPKFLP FLTPGPS+S++D +YRR S LP N++WKI
Sbjct: 437 DGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILWKI 496

Query: 480 IIVSSYTAMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKTL 539
           II+SSY  MG + ++D    PP +YPDLW++LNC +GFGCF LFWLW+ Y +  M  KTL
Sbjct: 497 IIISSYIVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNKTL 556

Query: 540 QQL 542
             L
Sbjct: 557 NDL 559

>Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  772 bits (1994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/544 (66%), Positives = 444/544 (81%), Gaps = 2/544 (0%)

Query: 1   MAPKNKEAKRNTVEESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYSG 60
           MA   +       EESFYASP+YDFLYPFRP G+QWL EY+I + A+I+ CA+G G YSG
Sbjct: 1   MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSG 60

Query: 61  QFSPPMFGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKP 120
           + +PP+ GDFEAQRHWMEITQHL  S+WYW+DL+YWGLDYPPLTA+HSY+LG IG+F  P
Sbjct: 61  KATPPLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGTFFNP 120

Query: 121 EWFELNESRGIETPD--LKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISA 178
            WF L++SRG E+PD  LKT+MR TV++S+ LFY PAV+YFTKWLG++R +SPIGQ I+A
Sbjct: 121 SWFALDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA 180

Query: 179 AAILFQPSLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYA 238
           AAILFQPSLMLIDHGHFQYN VMLGLT YAIN+L +E+YA+AA+CFVLSICFKQMALYYA
Sbjct: 181 AAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYA 240

Query: 239 PIFFAYLLSKSLFSPRFNFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRIFPF 298
           PIFFAYLLS+SLF P+FN  RL  IA AT+ +F+ M+APLY  GGGL N+ Q +HR+FPF
Sbjct: 241 PIFFAYLLSRSLFFPKFNIARLTVIAFATLATFSLMFAPLYFLGGGLRNIYQCIHRMFPF 300

Query: 299 ARGIFEDKVANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIIC 358
           ARGIFEDKVANFWCV+N+F KYK  F  +QLQLYSL+AT+LGFLPA+++  L+PKKH++ 
Sbjct: 301 ARGIFEDKVANFWCVSNIFVKYKERFSIQQLQLYSLVATVLGFLPAMMMTLLHPKKHLLP 360

Query: 359 YALATCSMSFYLFSFQVHEKXXXXXXXXXXXXYTSSNWDVLSMANWINNVGLFTLYPLLK 418
           Y L  CSMSF+LFSFQVHEK            Y+S++W+VLS+ +WINNV LFTL+PLLK
Sbjct: 361 YVLIACSMSFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLK 420

Query: 419 KDGLTLQYFVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWK 478
           KDGL LQY V F L+NWL+GNFSF+TP+FLPK LTPGPS+SS++ +YRRRS LP NV+WK
Sbjct: 421 KDGLHLQYVVSFLLTNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480

Query: 479 IIIVSSYTAMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKT 538
             I+ +Y AMG+ H +D  + PP  YPDLWVLLNCA+GF CF++FW+WSYY +FT   K+
Sbjct: 481 SFIIGTYIAMGLYHFLDLFVAPPKKYPDLWVLLNCAVGFICFSIFWIWSYYKIFTSGNKS 540

Query: 539 LQQL 542
           ++ L
Sbjct: 541 MKDL 544

>YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha
           1,3 glucosyltransferase, involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation; mutations in human ortholog are
           associated with disease
          Length = 544

 Score =  771 bits (1991), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/544 (67%), Positives = 441/544 (81%), Gaps = 2/544 (0%)

Query: 1   MAPKNKEAKRNTVEESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYSG 60
           MA   +       EESFYASP+YDFLYPFRP G+QWL EY+I + A+I+ C +G G YSG
Sbjct: 1   MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSG 60

Query: 61  QFSPPMFGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKP 120
           + SPP++GDFEAQRHWMEITQHL  S+WYW+DL+YWGLDYPPLTA+HSY+LG IGSF  P
Sbjct: 61  KGSPPLYGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNP 120

Query: 121 EWFELNESRGIETPD--LKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISA 178
            WF L +SRG E+PD  LKT+MR TV++S+ LFY PAV+YFTKWLG++R +SPIGQ I+A
Sbjct: 121 SWFALEKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA 180

Query: 179 AAILFQPSLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYA 238
           +AILFQPSLMLIDHGHFQYN VMLGLT YAIN+L +E+YA+AA+CFVLSICFKQMALYYA
Sbjct: 181 SAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYA 240

Query: 239 PIFFAYLLSKSLFSPRFNFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRIFPF 298
           PIFFAYLLS+SL  P+FN  RL  IA AT+ +FA ++APLY  GGGL N+ Q +HRIFPF
Sbjct: 241 PIFFAYLLSRSLLFPKFNIARLTVIAFATLATFAIIFAPLYFLGGGLKNIHQCIHRIFPF 300

Query: 299 ARGIFEDKVANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIIC 358
           ARGIFEDKVANFWCVTNVF KYK  F  +QLQLYSLIAT++GFLPA+I+  L+PKKH++ 
Sbjct: 301 ARGIFEDKVANFWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLP 360

Query: 359 YALATCSMSFYLFSFQVHEKXXXXXXXXXXXXYTSSNWDVLSMANWINNVGLFTLYPLLK 418
           Y L  CSMSF+LFSFQVHEK            Y+S++W+VLS+ +WINNV LFTL+PLLK
Sbjct: 361 YVLIACSMSFFLFSFQVHEKTILIPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLK 420

Query: 419 KDGLTLQYFVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWK 478
           KDGL LQY V F LSNWL+GNFSF+TP+FLPK LTPGPS+SS++ +YRRRS LP NV+WK
Sbjct: 421 KDGLHLQYAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480

Query: 479 IIIVSSYTAMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKT 538
             I+ +Y AMG  H +D  + PP  YPDLWVLLNCA+GF CF++FWLWSYY +FT   K+
Sbjct: 481 SFIIGTYIAMGFYHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKS 540

Query: 539 LQQL 542
           ++ L
Sbjct: 541 MKDL 544

>Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  769 bits (1987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/544 (66%), Positives = 440/544 (80%), Gaps = 2/544 (0%)

Query: 1   MAPKNKEAKRNTVEESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYSG 60
           MA   +       EESFYASP+YDFLYPFRP G+QWL EY+I + A+I+ C +G G YSG
Sbjct: 1   MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCTIGLGPYSG 60

Query: 61  QFSPPMFGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKP 120
           + SPP+ GDFEAQRHWMEITQHL  S+WYW+DL+YWGLDYPPLTA+HSY+LG IGSF  P
Sbjct: 61  KGSPPLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNP 120

Query: 121 EWFELNESRGIETPD--LKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISA 178
            WF L++SRG E+PD  LKT+MR TV++S+ LFY PAV+YFTKWLG++R +SPIGQ I+A
Sbjct: 121 SWFALDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA 180

Query: 179 AAILFQPSLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYA 238
           +AILFQPSLMLIDHGHFQYN VMLGLT YAIN+L +E+YA+AA+CFVLSICFKQMALYYA
Sbjct: 181 SAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYA 240

Query: 239 PIFFAYLLSKSLFSPRFNFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRIFPF 298
           PIFFAYLLS+SL  P+FN  RL  I+ AT+ +FA M APLY  GGGL N+ Q +HRIFPF
Sbjct: 241 PIFFAYLLSRSLLFPKFNIARLTVISFATLATFALMLAPLYFLGGGLKNIYQCIHRIFPF 300

Query: 299 ARGIFEDKVANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIIC 358
           ARGIFEDKVANFWCVTNVF KYK  F  +QLQLYSL+AT++GFLPA+++  L+PKKH++ 
Sbjct: 301 ARGIFEDKVANFWCVTNVFVKYKERFSVQQLQLYSLVATVIGFLPAMVMTLLHPKKHLLP 360

Query: 359 YALATCSMSFYLFSFQVHEKXXXXXXXXXXXXYTSSNWDVLSMANWINNVGLFTLYPLLK 418
           Y L  CSMSF+LFSFQVHEK            Y+S++W+VLS+ +WINNV LFTL+PLLK
Sbjct: 361 YVLIACSMSFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLK 420

Query: 419 KDGLTLQYFVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWK 478
           +DGL LQY V F LSNWL+GNFSF+TP+FLPK LTPGPS+SS++ +YRRRS LP NV+WK
Sbjct: 421 RDGLHLQYAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480

Query: 479 IIIVSSYTAMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKT 538
             I+ +Y AMG+ H +D  + PP  YPDLWVLLNC +GF CF++FW+WSYY +FT   K+
Sbjct: 481 SFIIGTYIAMGLYHFLDLFVAPPSKYPDLWVLLNCTVGFTCFSIFWVWSYYKIFTSGSKS 540

Query: 539 LQQL 542
           ++ L
Sbjct: 541 MKDL 544

>CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002w ALG6 glucosyltransferase
          Length = 548

 Score =  768 bits (1984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/544 (66%), Positives = 444/544 (81%), Gaps = 6/544 (1%)

Query: 4   KNKEA----KRNTVEESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYS 59
           K+K+A    +    EESFYASPLYDFL+PFRPAGSQWLTE++I++FA+II CA+G G YS
Sbjct: 6   KDKKAVSKFESEQGEESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIGLGPYS 65

Query: 60  GQFSPPMFGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIK 119
           G    PM GDFEAQRHWMEITQHL  S+WY++DL+YWGLDYPPLTA+HSY+LGK+G+F  
Sbjct: 66  GYKDGPMHGDFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCN 125

Query: 120 PEWFELNESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAA 179
           P+WF L+ SRGIET  LK +MRFTVLLSE +FY+PAVVYFTKWLG+ R +SPIGQFI+AA
Sbjct: 126 PDWFALDSSRGIETQGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAA 185

Query: 180 AILFQPSLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAP 239
           AILFQPSLMLIDHGHFQYN +MLG TVYAIN+L +EFYA AAICFVLSICFKQM+LYYAP
Sbjct: 186 AILFQPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAP 245

Query: 240 IFFAYLLSKSLFSPR-FNFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRIFPF 298
           IFFAYLL +S+F P+ FN PR  +I++AT+++F AM++P YIF GGL  + Q+V RIFPF
Sbjct: 246 IFFAYLLGRSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIF-GGLDGLAQTVRRIFPF 304

Query: 299 ARGIFEDKVANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIIC 358
           ARGIFEDKVANFWCV N   K+K +F  +QL++YSLI T++GF PA+I+I LYP+KH++ 
Sbjct: 305 ARGIFEDKVANFWCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRKHLLP 364

Query: 359 YALATCSMSFYLFSFQVHEKXXXXXXXXXXXXYTSSNWDVLSMANWINNVGLFTLYPLLK 418
           YALA CSMSFYLFSFQVHEK            +TS +W+VLSM +WINNV LFTL+PLLK
Sbjct: 365 YALAACSMSFYLFSFQVHEKTILVPLLPITLLFTSRDWNVLSMVSWINNVALFTLWPLLK 424

Query: 419 KDGLTLQYFVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWK 478
           ++GL LQYFVCF LSNWL+GNFSF+TP+FLPKF+TPGPS+SSV  NYRRRS LP ++ WK
Sbjct: 425 REGLYLQYFVCFFLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHSIFWK 484

Query: 479 IIIVSSYTAMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKT 538
           +IIVSSY  M   H +D  +  P  +PDLWV+LNC +GF  F+LFWLW+YY   T+ +K 
Sbjct: 485 LIIVSSYIGMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTLLKKN 544

Query: 539 LQQL 542
           +Q L
Sbjct: 545 IQDL 548

>Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  765 bits (1975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/544 (65%), Positives = 442/544 (81%), Gaps = 2/544 (0%)

Query: 1   MAPKNKEAKRNTVEESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYSG 60
           MA   +       EESFYASP+YDFLYPFRP G+QWL EY+I + A+I+ CA+G G YSG
Sbjct: 1   MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSG 60

Query: 61  QFSPPMFGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKP 120
           + SPP+ GDFEAQRHWMEITQHL  S+WYW+DL+YWGLDYPPLTA+HS + G IG+F  P
Sbjct: 61  KDSPPLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNP 120

Query: 121 EWFELNESRGIETPD--LKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISA 178
            WF L++SRG E+PD  LKT+MR TV++S+ LFY PAV+YFTKWLG++R +SPIGQ I+A
Sbjct: 121 SWFALDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA 180

Query: 179 AAILFQPSLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYA 238
           AAILFQPSLMLIDHGHFQYN VMLGLT YAIN+L +E+YA+AA+CFVLSICFKQMALYYA
Sbjct: 181 AAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYA 240

Query: 239 PIFFAYLLSKSLFSPRFNFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRIFPF 298
           PIFFAYLLS+SL  P+FN  RL  IA AT+ +F+ + APLY  GGGL N+ Q ++RIFPF
Sbjct: 241 PIFFAYLLSRSLLFPKFNIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIFPF 300

Query: 299 ARGIFEDKVANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIIC 358
           +RGIFEDKVANFWCVTN+F KYK+ F  +QLQLYSL+AT++GFLPA+I+  L+PKKH++ 
Sbjct: 301 SRGIFEDKVANFWCVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLP 360

Query: 359 YALATCSMSFYLFSFQVHEKXXXXXXXXXXXXYTSSNWDVLSMANWINNVGLFTLYPLLK 418
           Y L  CSMSF+LFSFQVHEK            Y+S++W+VLS+ +WINNV LFTL+PLLK
Sbjct: 361 YVLIACSMSFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLK 420

Query: 419 KDGLTLQYFVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWK 478
           KDGL LQY V F LSNWL+GNFSF+TP+FLPK LTPGPS+SS++ +YRRRS LP NV+WK
Sbjct: 421 KDGLHLQYTVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480

Query: 479 IIIVSSYTAMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKT 538
             I+ +Y AMGV H++D  + PP  YPDLWVLLNCA+GF CF++FW+WSYY +FT   K+
Sbjct: 481 SFIIGTYIAMGVYHLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKS 540

Query: 539 LQQL 542
           ++ L
Sbjct: 541 VKDL 544

>Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON}
           similar to Ashbya gossypii ACR004W
          Length = 549

 Score =  755 bits (1950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/541 (65%), Positives = 431/541 (79%), Gaps = 1/541 (0%)

Query: 2   APKNKEAKRNTVEESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYSGQ 61
           + K ++ +R+ VEESF+ASPLYDFLYP RP  +QW  +Y+I++FALI+  AVG G YSG+
Sbjct: 10  SEKGQDTRRSCVEESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAVGLGGYSGK 69

Query: 62  FSPPMFGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKPE 121
              P+FGDFEAQRHWMEIT  L  S+WY++DLEYWGLDYPPLTAYHSY+LG++GSF+   
Sbjct: 70  GKGPLFGDFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNAT 129

Query: 122 WFELNESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAI 181
           WF+LN SRG E+ DLK+FMR TVLLSE + YIPAV+YFT+W+G+HR +SPIGQ+++ AAI
Sbjct: 130 WFKLNTSRGFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAI 189

Query: 182 LFQPSLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIF 241
           LFQPSL+LIDHGHFQYNCVMLGL VY IN+L +EFY  AAICFVLS+ FKQMALYY+P+ 
Sbjct: 190 LFQPSLILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVI 249

Query: 242 FAYLLSKSLFSPRFNFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRIFPFARG 301
           FAYL S+S + PRFNFPR   IA+AT+L+F A+YAPL +F G   N+IQSV+R+FPF+RG
Sbjct: 250 FAYLFSRSAYYPRFNFPRFAGIAIATLLTFGALYAPLCLF-GDFRNIIQSVYRVFPFSRG 308

Query: 302 IFEDKVANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIICYAL 361
           IFEDKVANFWCVTNV  KY+ ++ Q+QLQ Y L+ T +   PA I+IFLYPKK ++ YAL
Sbjct: 309 IFEDKVANFWCVTNVIIKYRELYTQKQLQFYCLLTTAIAQFPAFIIIFLYPKKFLLPYAL 368

Query: 362 ATCSMSFYLFSFQVHEKXXXXXXXXXXXXYTSSNWDVLSMANWINNVGLFTLYPLLKKDG 421
           A CSM+F+LFSFQVHEK            + S+NWDVLSM  WINNV LFTL+PLLKKDG
Sbjct: 369 AACSMAFFLFSFQVHEKTILVPLLPITLLHISTNWDVLSMVAWINNVALFTLWPLLKKDG 428

Query: 422 LTLQYFVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWKIII 481
           L LQY + F LSNWLLGNFSFVTP FLPKFLTPGPSVS V  +YRRRS LP N+ W+III
Sbjct: 429 LLLQYAIMFLLSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIFWRIII 488

Query: 482 VSSYTAMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKTLQQ 541
           VSSY  M  +H++D  + PP +YPD+WVL  CALGF CFT FWLW+YY L+ M   +L +
Sbjct: 489 VSSYVCMAFIHLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRNSSLNE 548

Query: 542 L 542
           L
Sbjct: 549 L 549

>KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 536

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/536 (64%), Positives = 434/536 (80%), Gaps = 1/536 (0%)

Query: 7   EAKRNTVEESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYSGQFSPPM 66
           +A+++  +ESF+ASPLYDFL PFRP  +Q+  EYVIV+FAL+I CAVG GS+SG+ + PM
Sbjct: 2   DARKSLPKESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPM 61

Query: 67  FGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKPEWFELN 126
            GDFEAQRHWME+T +L  SQWYWFDL+YWGLDYPPLTAYHSY LGK+GS + PEWF L 
Sbjct: 62  HGDFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALG 121

Query: 127 ESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILFQPS 186
            SRG ETP+LK +MRFTV+LSE   YIPAV+YFTKW G  R++SPIGQ+I+AAAILFQPS
Sbjct: 122 SSRGNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPS 181

Query: 187 LMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFAYLL 246
           L+LIDHGHFQYN VMLGLTVYAIN+L + F+  AAICF+LS+CFKQMAL+Y+PIFFAYLL
Sbjct: 182 LILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLL 241

Query: 247 SKSLFSPRFNFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRIFPFARGIFEDK 306
           S+SLFSP F F R  ++A++TV++F  M++PLY+F GG+ NV+QS+HRIFPF+RGIFEDK
Sbjct: 242 SRSLFSPSFKFSRFMSVALSTVITFCLMFSPLYVF-GGMKNVLQSIHRIFPFSRGIFEDK 300

Query: 307 VANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIICYALATCSM 366
           VANFWCV+NV  KY + F Q+QLQ  S  AT  GFLP+  ++ LYPKKH+I Y LA CSM
Sbjct: 301 VANFWCVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSM 360

Query: 367 SFYLFSFQVHEKXXXXXXXXXXXXYTSSNWDVLSMANWINNVGLFTLYPLLKKDGLTLQY 426
           +F+LF FQVHEK            + S++W+VL++ +WINNV LFTL+PLLKKD L LQY
Sbjct: 361 AFFLFGFQVHEKSILVPLLPISLLFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQY 420

Query: 427 FVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWKIIIVSSYT 486
            +   LSNWL+GNFSFVTP+FLP F+TPGPS+S+V   YRRRSFLP+N++WKI+I++SY 
Sbjct: 421 GIMMLLSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYI 480

Query: 487 AMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKTLQQL 542
            M V+H++D  + PP   PDLWVL+NCALGF CF++FWLW+ Y LFTM  K++  L
Sbjct: 481 VMAVIHILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILDL 536

>Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {ON}
           YOR002W (ALG6) - glucosyltransferase [contig 185] FULL
          Length = 536

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/534 (65%), Positives = 426/534 (79%), Gaps = 1/534 (0%)

Query: 8   AKRNTVEESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYSGQFSPPMF 67
            K+ +  E F+ASPLYDFL PFRP  +Q+  EYVIV+FAL+I CAVG GS+SG+ S P+ 
Sbjct: 3   GKKVSKNEPFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENSGPIH 62

Query: 68  GDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKPEWFELNE 127
           GDFEAQRHWME+T HL  SQWYW+DL+YWGLDYPPLTAYHSYVLGK+GS +  EWF L  
Sbjct: 63  GDFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWFALLS 122

Query: 128 SRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILFQPSL 187
           SRGIE PD+K +MRFTV+LSE   YIPAV+YFTKW G  R++SPIGQ+I+AAAILFQPSL
Sbjct: 123 SRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSL 182

Query: 188 MLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFAYLLS 247
           +LIDHGHFQYN VMLGLTVY+IN+L + +Y  AAICFVLS+CFKQMALYY+P+FFAYLLS
Sbjct: 183 ILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLLS 242

Query: 248 KSLFSPRFNFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRIFPFARGIFEDKV 307
           + L SP  N PR  ++A +TV+SF  +++PLY+FGG   NV+QS+HRIFPF+RGIFEDKV
Sbjct: 243 ECLISPSLNVPRFLSVAFSTVISFCIIFSPLYVFGGT-KNVLQSIHRIFPFSRGIFEDKV 301

Query: 308 ANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIICYALATCSMS 367
           ANFWCV+NV FKY   + Q++LQ +S+IAT  GFLP+ +V+  YPKKH+I +ALA CSM+
Sbjct: 302 ANFWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFALAACSMA 361

Query: 368 FYLFSFQVHEKXXXXXXXXXXXXYTSSNWDVLSMANWINNVGLFTLYPLLKKDGLTLQYF 427
           F+LFSFQVHEK            Y S++W+VLSM +WINNV LFTL+PLLKKD LTLQY 
Sbjct: 362 FFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDHLTLQYG 421

Query: 428 VCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWKIIIVSSYTA 487
           +   LSNWL+GNFSFVTP+FLPKF+TPGPS+S V   YRRRSFLP N  WK+IIV+SY  
Sbjct: 422 ILMLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLIIVASYLI 481

Query: 488 MGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKTLQQ 541
           M  +H++DF +  P   PDLWVLLNCALGF CFT+FWLW +Y LFTM    LQ 
Sbjct: 482 MAAIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQD 535

>TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON}
           Anc_6.22 YOR002W
          Length = 559

 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/546 (65%), Positives = 430/546 (78%), Gaps = 9/546 (1%)

Query: 6   KEAKRNTVE--------ESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGS 57
           K+  +N +         E FYASPLY FL PF+   +QWL+ Y+IVLFALII CA+G G 
Sbjct: 14  KQTHKNDISSLDETLDTEPFYASPLYTFLSPFKSTTNQWLSVYIIVLFALIIRCAIGLGP 73

Query: 58  YSGQFSPPMFGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSF 117
           YSG    PMFGDFEAQRHWMEITQHL  SQWY++DL+YWGLDYPPLTAYHSY+ G IG F
Sbjct: 74  YSGMNEAPMFGDFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKF 133

Query: 118 IKPEWFELNESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFIS 177
             P WFEL  SRG+E  +LKTFMR T ++SE +FYIPA++YFT W+GK R++SP+GQ+I+
Sbjct: 134 FNPAWFELETSRGMEMKELKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIA 193

Query: 178 AAAILFQPSLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYY 237
           AAAILFQP LMLIDHGHFQYN VMLGLTVYAIN+L ++ YA AAI FV+SICFKQM+LYY
Sbjct: 194 AAAILFQPCLMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYY 253

Query: 238 APIFFAYLLSKSLFSPRF-NFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRIF 296
           APIFFAYLL +SLF  +F N  R   IA+AT++SF  ++APLY+FGGG  N+IQSVHRIF
Sbjct: 254 APIFFAYLLGRSLFKKQFFNVSRFLNIAIATMVSFFTVFAPLYVFGGGKRNIIQSVHRIF 313

Query: 297 PFARGIFEDKVANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHI 356
           PFARGIFEDKVANFWCVTNV  KYK  + Q++LQLYSLI T++GFLPA++ I  +PKKH+
Sbjct: 314 PFARGIFEDKVANFWCVTNVIMKYKVNYTQDELQLYSLILTVVGFLPAMVTILWFPKKHL 373

Query: 357 ICYALATCSMSFYLFSFQVHEKXXXXXXXXXXXXYTSSNWDVLSMANWINNVGLFTLYPL 416
           + Y+LA C+MSF+LFSFQVHEK            YTS++W+VLS+ +WINNV LFTL+PL
Sbjct: 374 LPYSLAACAMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSLVSWINNVALFTLWPL 433

Query: 417 LKKDGLTLQYFVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVI 476
           LKKDG+ LQY VCF LSNWL+GNFSF TP+FLPK LTPGP + +V+ +YRRRS LP+N+I
Sbjct: 434 LKKDGVVLQYGVCFILSNWLIGNFSFFTPRFLPKILTPGPPIQNVNTHYRRRSLLPNNII 493

Query: 477 WKIIIVSSYTAMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPR 536
           WKIIIV SY  M  +  ++  + PP  YPD++VLLNC LGF CFT FWLW+YY LFT+  
Sbjct: 494 WKIIIVLSYIVMVAIQGLELFVEPPPQYPDIFVLLNCTLGFCCFTSFWLWNYYKLFTLTS 553

Query: 537 KTLQQL 542
           K LQ L
Sbjct: 554 KNLQYL 559

>ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR002W (ALG6)
          Length = 563

 Score =  716 bits (1849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/536 (61%), Positives = 418/536 (77%), Gaps = 1/536 (0%)

Query: 7   EAKRNTVEESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYSGQFSPPM 66
           +AK+  ++E+F+ASPLYDFLYP RP  +QW  +Y+IV+FALII  AVG G YSG   PPM
Sbjct: 29  DAKKPGLKEAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGLGGYSGMGKPPM 88

Query: 67  FGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKPEWFELN 126
           FGDFEAQRHWME+TQH+  S+WY+  L+YWGLDYPPLTAYHSY+LGK+GS+I PEWF L+
Sbjct: 89  FGDFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLH 148

Query: 127 ESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILFQPS 186
            SRG E+ DLK++MR TV+LSE  FYIPAV+YFT+W+G+ RQ+SPIGQ+I+ AAILFQP+
Sbjct: 149 ASRGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPA 208

Query: 187 LMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFAYLL 246
           L+LIDHGHFQYNCVMLGLTV AIN+L +++YA+AA+ FV S+ FKQMALYYAP+ F YLL
Sbjct: 209 LILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLL 268

Query: 247 SKSLFSPRFNFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRIFPFARGIFEDK 306
           S+S++ PR N PR  A+AVAT+++F  +YAPLY+  G ++ + QS+HR+FPF RG+FEDK
Sbjct: 269 SRSIYYPRLNIPRFVAVAVATLIAFGVLYAPLYLL-GNISAIFQSIHRVFPFERGLFEDK 327

Query: 307 VANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIICYALATCSM 366
           VANFWCVTNV  KYK  +   QL+ +SL+ T    LP++I+ FLYPKK ++ YALA CSM
Sbjct: 328 VANFWCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKFMLPYALAACSM 387

Query: 367 SFYLFSFQVHEKXXXXXXXXXXXXYTSSNWDVLSMANWINNVGLFTLYPLLKKDGLTLQY 426
           SF+LF FQVHEK            YTS++W+VLSM  WINN+ LFTL+PLLKKDGL+LQY
Sbjct: 388 SFFLFGFQVHEKTILVPLLPITLLYTSTDWNVLSMVAWINNIALFTLWPLLKKDGLSLQY 447

Query: 427 FVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWKIIIVSSYT 486
            + F LSNWL+GNFSF+TP FLPK LTPGPSVS V   YRRRS LPSN+IW+IIIV SY 
Sbjct: 448 AIMFLLSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNIIWRIIIVVSYI 507

Query: 487 AMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKTLQQL 542
            +G +H+ +    P    PD+WVL NC +G   F LFW+W+ Y +F M   T+  L
Sbjct: 508 CVGAIHIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMRNSTISDL 563

>Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {ON}
           YOR067C (ALG8) - glycosyl transferase [contig 126] FULL
          Length = 555

 Score =  117 bits (294), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 107/417 (25%), Positives = 172/417 (41%), Gaps = 79/417 (18%)

Query: 69  DFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFI--KPEWFELN 126
           DF+  R+W+ IT  L   QWY+ +   W LDYPP  AY  + L ++   I  +    ++ 
Sbjct: 44  DFDVHRNWLAITNKLPLKQWYFENTSQWTLDYPPFFAYFEWALSQLVPNIVRQDGCLDIV 103

Query: 127 ESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILFQPS 186
           +      P +  F R TV+ SE L ++   VY  K     R       F+ A++I+  P 
Sbjct: 104 KVGQFGMPTI-VFQRLTVIASEILLFVVLQVYINKSHISERS----ANFVVASSIVLSPG 158

Query: 187 LMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFAYLL 246
            ++IDH HFQYN  +  + + +I +  E+ Y +  + F ++ICFK + LY AP FF +LL
Sbjct: 159 FLIIDHIHFQYNGFLFAILIASIVAAKEQRYLLCGLFFSIAICFKHIFLYLAPSFFVFLL 218

Query: 247 SKSLFS-PRFNFP------------RLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVH 293
              +     F+F              LF +    +  F   +AP       ++   Q + 
Sbjct: 219 RVYVLDFSNFHFKSYNDLISIVQWRNLFKLGSVVLCVFGVCFAPF------ISQWPQLLS 272

Query: 294 RIFPFARGIFEDKVA-NFWCVTNVFFK--------------------------------- 319
           R+FPF+RG+     A NFW + ++  K                                 
Sbjct: 273 RLFPFSRGLTHAYWAPNFWAMYSLLDKVLTLIILKVPYVHKFLTQFIAPPLIPATIGEIK 332

Query: 320 -----------------YKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIICYALA 362
                            Y  I PQ Q +L + I T+   + A+I +   P       +L 
Sbjct: 333 QKLLQYNVGTKGLVQDVYFVILPQIQPRL-TFILTLFYQILAIIPVLFSPSFKRFVGSLT 391

Query: 363 TCSMSFYLFSFQVHEKXXXXXXXXXXXXYTSSNWDVLSMANWINNVGLFTLYPLLKK 419
            C  + +LF + VHEK             TS    +L+  N + + G  +L+PLL +
Sbjct: 392 LCGFASFLFGWHVHEKAIMLIIIPFSFLVTSDR-RLLTPFNLLASAGYVSLFPLLHE 447

>TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {ON}
           Anc_5.669 YOR067C
          Length = 575

 Score =  114 bits (284), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 110/418 (26%), Positives = 176/418 (42%), Gaps = 79/418 (18%)

Query: 69  DFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIG-SFIKPE-WFELN 126
           DF+  R+W+ IT +L  S+WY+ +   W LDYPP  AY  +VL +     +K +   ++ 
Sbjct: 64  DFDVHRNWLAITSNLPISKWYYENTSEWTLDYPPFFAYFEWVLSRFAPEIVKNDGCLDIV 123

Query: 127 ESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQ-FISAAAILFQP 185
           E      P +  F R TV++SE L +     Y      K R     GQ F+ A++I+  P
Sbjct: 124 EVGQFGLPTI-VFQRLTVIISEILLFAVLQYYINTSNSKER-----GQCFVVASSIVLSP 177

Query: 186 SLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFAYL 245
             ++IDH HFQYN  +  + + +I +  ++ Y   A+ + +S+CFK + LY AP +F +L
Sbjct: 178 GFLIIDHIHFQYNGFLFAIFIASIVAAKQKKYLACAVFYSISLCFKHIFLYLAPCYFVFL 237

Query: 246 LSKSLFS-PRFNF------------PRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSV 292
           L   + +   F F             RLF +A      F   +AP +IF      + Q +
Sbjct: 238 LRAYVLNFENFKFKSYMDLQSVIQWKRLFKLAGIVSGIFTICFAP-FIF-----QLPQVL 291

Query: 293 HRIFPFARGI--------------FEDKVANFWCVT-------NVFFKYKNIFPQEQLQL 331
            R+FPF+RG+              F DKV  F  +         + F    I P+   ++
Sbjct: 292 SRLFPFSRGLTHAYWAPNFWAMYSFIDKVLTFVMLRFPYVHKLMLSFTSSPILPKTAAEI 351

Query: 332 YSLIA-----------------------------TMLGFLPAVIVIFLYPKKHIICYALA 362
              +A                             T+   + AVI +   P       +L 
Sbjct: 352 RERMAQNNNGTKGLVQDYFFVILPQITPKLTFLLTLFYQILAVIPLLFDPSYKRFIGSLT 411

Query: 363 TCSMSFYLFSFQVHEKXXXXXXXXXXXXYTSSNWDVLSMANWINNVGLFTLYPLLKKD 420
            C M+ YLF + VHEK              S    ++S    +   G  +L+PLL ++
Sbjct: 412 LCGMASYLFGWHVHEKAIMLVIIPFSFLVVSDRRLLISFM-LVTAAGYVSLFPLLFEN 468

>TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON}
           Anc_5.669 YOR067C
          Length = 546

 Score =  112 bits (280), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 98/397 (24%), Positives = 169/397 (42%), Gaps = 52/397 (13%)

Query: 69  DFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGK-IGSFIKPEWFELNE 127
           DF+  R+W+ IT  L   +WY+ +   W LDYPP  AY  + L + +  F+K +      
Sbjct: 43  DFDVHRNWLAITNKLPLREWYYENTSQWTLDYPPFFAYFEWFLSQFVPKFVKEDGCLDIL 102

Query: 128 SRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILFQPSL 187
             G        F R TV++SE L ++   V+        + +S    F+ A++I+  P  
Sbjct: 103 PEGEFGWSTIVFQRLTVIISEILLFVVLQVFINNSGSNEKTQS----FVVASSIILSPGF 158

Query: 188 MLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFAYLLS 247
           ++IDH HFQYN  + G+ + +I +   + Y +  + + +++CFK + LY AP +F +LL 
Sbjct: 159 LMIDHIHFQYNGFLFGILIASIVAAKNKRYLLCGLFYSIALCFKHIFLYLAPCYFVFLLR 218

Query: 248 KSLFS-PRFNFPR----LFAIAVATVLSFAAMYAPLY--IFGGGLANVIQSVHRIFPFAR 300
             + +   F F      +  +    ++    +   +    FG    ++ Q + R+FPF+R
Sbjct: 219 AYVLNFQDFKFKSYKDLILVVQWGNLMKLGGIVVCVMGVCFGPFWRDMNQLLSRLFPFSR 278

Query: 301 GI--------------FEDKVANFWCVTNVFFKYKN------------------------ 322
           G+              F DK+ +   V   F K+ N                        
Sbjct: 279 GLTHAYWAPNFWAIYSFVDKMLSILFVRVPFNKFINLDKIEERKRWNNGSRGLVEDVFFV 338

Query: 323 IFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIICYALATCSMSFYLFSFQVHEKXXXX 382
           I PQ Q  L + + T+   + AV+ +   P       +L  C  + +LF + VHEK    
Sbjct: 339 ILPQIQPNL-TFVLTLFYQVLAVVPVLFDPSFKRFIGSLTLCGFASFLFGWHVHEKAILL 397

Query: 383 XXXXXXXXYTSSNWDVLSMANWINNVGLFTLYPLLKK 419
                          +LS    + + G  +L+PLL K
Sbjct: 398 VIIPFSFLVVCDR-RLLSSFMLVGSAGYVSLFPLLFK 433

>YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON}
           ALG8Glucosyl transferase, involved in N-linked
           glycosylation; adds glucose to the dolichol-linked
           oligosaccharide precursor prior to transfer to protein
           during lipid-linked oligosaccharide biosynthesis;
           similar to Alg6p
          Length = 577

 Score =  112 bits (279), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 78/255 (30%), Positives = 124/255 (48%), Gaps = 15/255 (5%)

Query: 69  DFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKI--GSFIKPEWFELN 126
           DF+  R+W+ IT  L  S+WY+     W LDYPP  AY  + L +    S       ++ 
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKSVRDDGCLDIV 125

Query: 127 ESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILFQPS 186
           E      P +  F R TV+ SE L ++   +Y        R +S    F+ A++I+  P 
Sbjct: 126 EIGKFGLPTI-VFQRLTVIFSEILLFVILQIYINTTKLSERSQS----FVVASSIVLSPG 180

Query: 187 LMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFAYLL 246
            ++IDH HFQYN  +  + + +I +   + Y + A+ +  +ICFK + LY AP +F +LL
Sbjct: 181 FLIIDHIHFQYNGFLFAILIGSIVAAKNKRYILCAVLYTTAICFKHIFLYLAPCYFVFLL 240

Query: 247 SKSLFS-PRFNFPR----LFAIAVATVLSFAAMYAPLYI--FGGGLANVIQSVHRIFPFA 299
              + +   F F      LF I  A +L  A +   ++   F      + Q + R+FPF+
Sbjct: 241 RAYVLNVNNFKFKSYKDFLFLIRWANLLKLATVVVGIFTICFLPFAHQMPQVLSRLFPFS 300

Query: 300 RGIFEDKVA-NFWCV 313
           RG+     A NFW +
Sbjct: 301 RGLTHAYWAPNFWAL 315

>KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 555

 Score =  109 bits (273), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 108/421 (25%), Positives = 170/421 (40%), Gaps = 87/421 (20%)

Query: 69  DFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKPEWFELNES 128
           DF+  R+W+ IT  L   +WY+     W LDYPP  AY  ++L +      P+  + +  
Sbjct: 44  DFDVHRNWLAITNKLPLHKWYYESTSQWTLDYPPFFAYFEWLLSQF----VPQRVQDDGC 99

Query: 129 RGIET------PDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAIL 182
             I        P +  F R TV++SE L ++   VY  K     R       F+ A++I+
Sbjct: 100 LDIVAVGQFGLPTI-VFQRVTVIVSEILLFVVLQVYINKSHISDRS----ANFVVASSIV 154

Query: 183 FQPSLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFF 242
             P  ++IDH HFQYN  +  + + +I +   + Y +    F  ++CFK + LY AP FF
Sbjct: 155 LSPGFLIIDHIHFQYNGFLFAILIASIVAAKHQRYLLCGFFFSTALCFKHIFLYLAPSFF 214

Query: 243 AYLLSKSLFS-PRFNF------------PRLFAIAVATVLSFAAMYAPLYIFGGGLANVI 289
           A+LL   +     F F              LF +    +  FA  +AP       +  + 
Sbjct: 215 AFLLRVYILDFSNFRFRTYNDLISMVRWKNLFKLGTVVLSVFAVCFAPF------IYQLP 268

Query: 290 QSVHRIFPFARGIFEDKVA-NFWC-------VTNVFF----------------------- 318
           Q + R+FPF+RG+     A NFW        V  +FF                       
Sbjct: 269 QLMSRLFPFSRGLTHAYWAPNFWALYSALDKVLTLFFLKVPYVHKFLTQVVSPPLIPVTI 328

Query: 319 --------------------KYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIIC 358
                                Y  I PQ Q +L + I T+   + AVI +   P      
Sbjct: 329 DEIKTKLQQYNVGTKGLVQDVYFVILPQIQPKL-TFILTLFYQILAVIPVLFSPSFERFV 387

Query: 359 YALATCSMSFYLFSFQVHEKXXXXXXXXXXXXYTSSNWDVLSMANWINNVGLFTLYPLLK 418
            +L  C  + +LF + VHEK             T+    +L+  + + + G  +L+PLL 
Sbjct: 388 GSLTLCGFASFLFGWHVHEKAVLLIIIPFSFLVTTDR-RLLTPFHLVASAGYVSLFPLLH 446

Query: 419 K 419
           +
Sbjct: 447 E 447

>CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa]
           {ON} similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067c ALG8 Glucosyltransferase
          Length = 550

 Score =  108 bits (270), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 106/415 (25%), Positives = 174/415 (41%), Gaps = 79/415 (19%)

Query: 69  DFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGK-IGSFIKPE-WFELN 126
           DF+  R+W+ IT  L   QWY+     W LDYPP  AY  + L + + S++K +   ++ 
Sbjct: 36  DFDVHRNWLAITNKLPLRQWYYEHTSQWTLDYPPFFAYFEWFLSQFVPSYVKSDGCLDIV 95

Query: 127 ESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILFQPS 186
           E      P +  F R TV+ SE L ++   VY        R +S    F+ A++I   P 
Sbjct: 96  EVGQFGMPTV-VFQRLTVIASEILLFVVLQVYINTSKVSERTQS----FVVASSIAISPG 150

Query: 187 LMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFAYLL 246
            ++IDH HFQYN  +  + + +I +   + Y      + +++CFK + LY AP +F +LL
Sbjct: 151 FLIIDHIHFQYNGFLFAILIASIVAAKNKKYLWCGFFYSVALCFKHIYLYLAPCYFVFLL 210

Query: 247 SKSLFSPR-FNFP------------RLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVH 293
              + + + F F              L  +    + +FA  + P +IF     ++ Q + 
Sbjct: 211 RAYVLNLKDFKFKSYRDLIFIVKWRHLVKLGSVVIATFAVAFGP-FIF-----DLPQLLT 264

Query: 294 RIFPFARGIFEDKVA-NFWCV--------TNVFFK------------------------- 319
           R+FPF+RG+     A NFW +        T VF K                         
Sbjct: 265 RLFPFSRGLTHAYWAPNFWAIYSTIDKILTMVFLKMPYTYKLASQFISPPLIPASLNEIK 324

Query: 320 -----------------YKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIICYALA 362
                            Y  I PQ   +L + + T+L  + AV+ +   P       ++ 
Sbjct: 325 AKMAANNNGSKGLVEDVYFVILPQIVPKL-TFLLTLLYQVLAVVPVLFDPSFKRFMGSMT 383

Query: 363 TCSMSFYLFSFQVHEKXXXXXXXXXXXXYTSSNWDVLSMANWINNVGLFTLYPLL 417
            C ++ +LF + VHEK              S    +LS    + + G  +L+PLL
Sbjct: 384 LCGLASFLFGWHVHEKAIMLVIIPFSFLVISDR-RLLSSFMLLTSAGYVSLFPLL 437

>Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  108 bits (269), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 76/255 (29%), Positives = 126/255 (49%), Gaps = 15/255 (5%)

Query: 69  DFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGK-IGSFIKPE-WFELN 126
           DF+  R+W+ IT  L  S+WY+     W LDYPP  AY  + L + +   ++ +   ++ 
Sbjct: 66  DFDVHRNWLAITNKLPISKWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDIV 125

Query: 127 ESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILFQPS 186
           E      P +  F R TV+ S+ L ++   VY        R +S    F+ A++I+  P 
Sbjct: 126 EVGKFGLPTI-VFQRLTVIFSDILLFVVLQVYINTTDLSERSQS----FVVASSIVLSPG 180

Query: 187 LMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFAYLL 246
             +IDH HFQYN  +  + + +I +  ++ Y + AI +  +ICFK + LY AP +F +LL
Sbjct: 181 FFMIDHIHFQYNGFLFAILIGSIVAAKKKRYILCAILYTTAICFKHIFLYLAPCYFVFLL 240

Query: 247 SKSLFS-PRFNFPR----LFAIAVATVLSFAAMYAPLYI--FGGGLANVIQSVHRIFPFA 299
              + +   F F      LF I  A +    ++   ++   F      + Q + R+FPF+
Sbjct: 241 RAYVLNVNNFKFKSYKDFLFLIRWANLFKLGSIVIGIFTICFLPFAHQMPQVLSRLFPFS 300

Query: 300 RGIFEDKVA-NFWCV 313
           RG+     A NFW +
Sbjct: 301 RGLTHAYWAPNFWAL 315

>Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  108 bits (269), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 76/255 (29%), Positives = 124/255 (48%), Gaps = 15/255 (5%)

Query: 69  DFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGK-IGSFIKPE-WFELN 126
           DF+  R+W+ IT  L  S+WY+     W LDYPP  AY  + L + +   ++ +   ++ 
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDIV 125

Query: 127 ESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILFQPS 186
           E      P +  F R TV+ SE L Y    +Y        R +S    F+ A++I+  P 
Sbjct: 126 EVGKFGLPTI-VFQRLTVIFSEILLYAVLQIYINTTKLSERSQS----FVVASSIVLSPG 180

Query: 187 LMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFAYLL 246
            ++IDH HFQYN  +  + + +I +   + Y + A  +  +ICFK + LY AP +F +LL
Sbjct: 181 FLMIDHIHFQYNGFLFAILIGSIVAAKNKKYLLCAFLYTTAICFKHIFLYLAPCYFVFLL 240

Query: 247 SKSLFS-PRFNFPR----LFAIAVATVLSFAAMYAPLYI--FGGGLANVIQSVHRIFPFA 299
              + +   F F      LF I  A +    ++   ++   F      + Q + R+FPF+
Sbjct: 241 RAYVLNVNNFKFKSYKDFLFLIRWANLFKLGSIVIGIFTICFVPFAHQMPQVLSRLFPFS 300

Query: 300 RGIFEDKVA-NFWCV 313
           RG+     A NFW +
Sbjct: 301 RGLTHAYWAPNFWAL 315

>TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.669
           YOR067C
          Length = 569

 Score =  107 bits (267), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 99/373 (26%), Positives = 157/373 (42%), Gaps = 72/373 (19%)

Query: 69  DFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKPE--WFELN 126
           DF+  R+W+ IT  L   +WY+     W LDYPP  AY  ++L +    I  E    ++ 
Sbjct: 55  DFDVHRNWLAITNELPLKEWYYEKTSQWTLDYPPFFAYFEWLLSQFVPKIVKEDGALDIV 114

Query: 127 ESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILFQPS 186
           E      P +  F R TV+ SE L ++   V+        + +S    F+ A++I+  P 
Sbjct: 115 EIGQFGWPTV-VFQRLTVIFSEVLLFVVLQVFVNTSSATEKTRS----FVVASSIVLSPG 169

Query: 187 LMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFAYLL 246
            ++IDH HFQYN  +    + +I +   + Y   A  + +++CFK + LY AP +F +LL
Sbjct: 170 FLMIDHIHFQYNGFLFAPLIASIVAAKHKKYMWCATFYAIALCFKHIFLYLAPCYFVFLL 229

Query: 247 SKSLFS-PRFNFPR----LFAIAVATVLSFAAMYAPLYI--FGGGLANVIQSVHRIFPFA 299
              + +   F F      +F +    +   A++   ++   FG  L ++ Q + R+FPF+
Sbjct: 230 RAYVLNFKNFEFKSYKDLIFIVQWKHLFKMASVVLGIFFICFGPFLYDLPQVMTRLFPFS 289

Query: 300 RGI--------------FEDKVANF----------------------------------- 310
           RG+              F DK+  F                                   
Sbjct: 290 RGLTHAYWAPNFWAIYSFLDKILTFVMLKLPYVHAFATKFISPPLIPESLDDLKERLVQN 349

Query: 311 -----WCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIICYALATCS 365
                  V +VFF    I PQ   +L + I TM     AVI +   P       +L  C 
Sbjct: 350 NSGTKGLVQDVFFA---ILPQISPKL-TFILTMFYQALAVIPLLFDPSFKRFIGSLTLCG 405

Query: 366 MSFYLFSFQVHEK 378
           +S YLF + VHEK
Sbjct: 406 LSSYLFGWHVHEK 418

>KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.669
           YOR067C
          Length = 575

 Score =  107 bits (266), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 75/266 (28%), Positives = 132/266 (49%), Gaps = 15/266 (5%)

Query: 69  DFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGK-IGSFIKPE-WFELN 126
           DF+  R+W+ IT  +    WY+     W LDYPP  AY  + +   + SF++ +   ++ 
Sbjct: 64  DFDVHRNWLAITNGMHLKDWYYEHTSQWTLDYPPFFAYFEWFISHLVPSFVRRDGCLDIV 123

Query: 127 ESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILFQPS 186
           E      P +  F R TV+ SE L ++   +Y      + R +S    FI A++I+  P 
Sbjct: 124 EVGQFGWPTV-LFQRLTVIFSESLLFLVLQIYINTSEVEERTQS----FIVASSIVLSPG 178

Query: 187 LMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFAYLL 246
            +++DH HFQYN  +  + V +I +   + Y + A+ + +++CFK + LY AP +F +LL
Sbjct: 179 FLIVDHIHFQYNGFLFAILVASIVAARNKRYLLCALFYSIALCFKHIFLYLAPCYFVFLL 238

Query: 247 SKSLFS-PRFNFPR----LFAIAVATVLSFAAMYAPLY--IFGGGLANVIQSVHRIFPFA 299
              + +   F F      +F I    +     +   ++   FG  + ++ Q + R+FPF+
Sbjct: 239 RVYVLNFENFKFRSYKDLIFLIRWKNLCQLGMIVVGVFSLCFGPFIFDMPQLLSRLFPFS 298

Query: 300 RGIFEDKVA-NFWCVTNVFFKYKNIF 324
           RG+     A NFW + +   K   +F
Sbjct: 299 RGLTHAYWAPNFWALYSFLDKVLTVF 324

>Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa]
           {ON} complement(205615..207480) [1866 nt, 622 aa]
          Length = 621

 Score =  107 bits (267), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 106/417 (25%), Positives = 175/417 (41%), Gaps = 77/417 (18%)

Query: 69  DFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGK-IGSFIKPE-WFELN 126
           DF+  R+WM IT  L  S+WY+ +   W LDYPP  AY  + L + +   ++ +   ++ 
Sbjct: 109 DFDVHRNWMAITNALPISKWYFENTSQWTLDYPPFFAYFEWFLSQFVPKIVRDDGCLDIV 168

Query: 127 ESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILFQPS 186
           E      P +  F R TV++SE   +     Y        R +S    F+ A++I+  P 
Sbjct: 169 EVGQFGWPTV-VFQRLTVIISEICLFAVLQYYINTSNLNERTQS----FVVASSIVLSPG 223

Query: 187 LMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFAYLL 246
            +++DH HFQYN  +  + + +I +  ++ Y   A+ + +++CFK + LY AP +F +LL
Sbjct: 224 FLIVDHIHFQYNAFLFSILIASIVAAKQKKYIACAVFYTIALCFKHIFLYLAPCYFVFLL 283

Query: 247 SKSLFS-PRFNFPR----LFAIAVATVLSFAAMYAPLYIFGGGLANVI----QSVHRIFP 297
              + +   F F      +F +    +L   ++   L IFG   A  I    Q + R+FP
Sbjct: 284 RAYVLNFKDFKFKSYKDLIFIVQWRRLLKLGSIV--LGIFGICFAPFIFQMPQVLSRLFP 341

Query: 298 FARGIFEDKVA-NFWC-------------------------------------------- 312
           F+RG+     A NFW                                             
Sbjct: 342 FSRGLTHAYWAPNFWAIYSFLDKILAVVMLKFPYVHRFISKFISSPLIPSSIAEIKLRME 401

Query: 313 ---------VTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIICYALAT 363
                    V +VFF    I PQ Q +L + + T+   + AVI +   P       +L  
Sbjct: 402 ENNNGSKGLVEDVFFV---ILPQIQPKL-TFLLTLFYQILAVIPVLFNPSFKRFIGSLTL 457

Query: 364 CSMSFYLFSFQVHEKXXXXXXXXXXXXYTSSNWDVLSMANWINNVGLFTLYPLLKKD 420
           C ++ YLF + VHEK                   +LS    + + G  +L+PLL ++
Sbjct: 458 CGLASYLFGWHVHEKAILLVIIPFSFLVVCDR-RLLSSFMLVASAGYVSLFPLLYEN 513

>NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score =  106 bits (264), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 74/261 (28%), Positives = 129/261 (49%), Gaps = 27/261 (10%)

Query: 69  DFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGK-IGSFIKPE-WFELN 126
           DF+  R+W+ +T  L   QWY+     W LDYPP  AY  +++ + +   ++ +   ++ 
Sbjct: 56  DFDVHRNWLAVTNKLPLKQWYYEHTSQWTLDYPPFFAYFEWIISQFVPQVVRDDGCLDIV 115

Query: 127 ESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILFQPS 186
           E      P +  F R +V+ SE L ++    +      K R +S    FI A +I+  P 
Sbjct: 116 EIGKFGEPTV-IFQRLSVITSEILLFVVLQWFINTSNVKERTQS----FIVATSIILSPG 170

Query: 187 LMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFAYLL 246
            +++DH HFQYN  +  + + +I +  ++ Y + A+ +  ++CFK + LY AP +F +LL
Sbjct: 171 FLIVDHIHFQYNGFLFSILIASIVAAKQKRYILCAVFYTTALCFKHIFLYLAPCYFVFLL 230

Query: 247 SKSLFSPR-FNFP------------RLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVH 293
              + + + F F              LF +A   VLS   +      FG  + ++ Q + 
Sbjct: 231 RAYVLNVKGFQFKSYKDLVRLVQWTNLFRLA-GVVLSIVGV-----CFGPFIFDMPQLLT 284

Query: 294 RIFPFARGIFEDKVA-NFWCV 313
           R+FPF+RG+     A NFW +
Sbjct: 285 RLFPFSRGLTHAYWAPNFWAI 305

>ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR067C
           (ALG8)
          Length = 572

 Score =  106 bits (264), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 79/261 (30%), Positives = 123/261 (47%), Gaps = 27/261 (10%)

Query: 69  DFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKI--GSFIKPEWFELN 126
           DFE  R+W+ +T  L   +WY      W +DYPPL A+  + L ++  G+  +    +L 
Sbjct: 59  DFEVHRNWLAVTHRLPLRKWYVDATSQWTMDYPPLFAWLEWALSQVVPGAVRRDGCLKLV 118

Query: 127 ESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILFQPS 186
                  P +  F R TV+ SE L Y+   VY +    + R  +    F+   ++   P+
Sbjct: 119 AEGRYGWPTV-VFQRLTVIASEVLLYVVLQVYVSSSAAQERTVN----FVVTTSVALSPA 173

Query: 187 LMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFAYLL 246
            +L+DH HFQYN  +  + V +I +  E  Y +    F +++C K + LY AP +F +LL
Sbjct: 174 FLLVDHIHFQYNGFLFAVLVASIVAARERRYVLCGALFTVALCLKHIFLYLAPAYFVFLL 233

Query: 247 SK---SLFSPRFNFPRLFAIAV---------ATVLSFAAM-YAPLYIFGGGLANVIQSVH 293
                 L   RF   R    AV           VL+  A+ +AP   F G +    Q + 
Sbjct: 234 RAYVLDLGEFRFRSYRDLVFAVRWGNLCRLGGVVLAIMAVTFAP---FAGVMP---QLMA 287

Query: 294 RIFPFARGIFEDKVA-NFWCV 313
           R+FPF+RG+     A NFW +
Sbjct: 288 RLFPFSRGLTHAYWAPNFWAI 308

>Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON}
           YOR067C (REAL)
          Length = 576

 Score =  105 bits (262), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 75/255 (29%), Positives = 123/255 (48%), Gaps = 15/255 (5%)

Query: 69  DFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGK-IGSFIKPE-WFELN 126
           DF+  R+W+ IT  L  S+WY+     W LDYPP  AY  + L + +   ++ +   ++ 
Sbjct: 66  DFDVHRNWLAITNKLPMSEWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDIV 125

Query: 127 ESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILFQPS 186
           E      P +  F R TV+ SE L +    +Y        R +S    F+ A++I+  P 
Sbjct: 126 EVGKFGLPTI-VFQRLTVIFSEILLFAVLQIYINTTKLSERSQS----FVVASSIVLSPG 180

Query: 187 LMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFAYLL 246
            ++IDH HFQYN  +  + + +I +   + Y   A+ +  SICFK + LY AP +F +LL
Sbjct: 181 FLMIDHIHFQYNGFLFAILIGSIVAAKNKKYLWCAVLYTTSICFKHIFLYLAPCYFVFLL 240

Query: 247 SKSLFS-PRFNFPR----LFAIAVATVLSFAAMYAPLYI--FGGGLANVIQSVHRIFPFA 299
              + +   F F      LF I    +    ++   ++   F      + Q + R+FPF+
Sbjct: 241 RAYVLNVNNFKFKSYKDFLFLIRWTNLFKLGSIVIGIFTICFLPFAHQMPQVLSRLFPFS 300

Query: 300 RGIFEDKVA-NFWCV 313
           RG+     A NFW +
Sbjct: 301 RGLTHAYWAPNFWAL 315

>ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {ON}
           highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 556

 Score =  103 bits (257), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 75/261 (28%), Positives = 123/261 (47%), Gaps = 27/261 (10%)

Query: 69  DFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKI--GSFIKPEWFELN 126
           DF+  R+W+ IT +L   QWY+     W LDYPP  AY  + L +   G+  +    E+ 
Sbjct: 45  DFDVHRNWLAITHNLPLRQWYYEATSQWTLDYPPFFAYFEWFLSQFVPGTVKQDGCLEIV 104

Query: 127 ESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILFQPS 186
           +        L  F R TV+LSE L ++   V+        R +S    F+ A++I+  P+
Sbjct: 105 DKGQFGWSTL-VFQRSTVILSEILLFVVLQVFINTSSVTERTQS----FVIASSIVLSPA 159

Query: 187 LMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFAYLL 246
            +++DH HFQYN  +  + + +I +     Y   A  + +++CFK + LY AP +F +LL
Sbjct: 160 FLIVDHIHFQYNGFLFAILIASIVAAKRGKYLWCATFYSVALCFKHIFLYLAPCYFVFLL 219

Query: 247 SKSLFS-PRFNFP------------RLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVH 293
                +   F F              LF +    +  FA  + P       + ++ Q + 
Sbjct: 220 RAYCLNFQDFKFKSYKDLIFIVKWRHLFQLGSIVIGVFALCFGPF------VKDLPQVLT 273

Query: 294 RIFPFARGIFEDKVA-NFWCV 313
           R+FPF+RG+     A NFW +
Sbjct: 274 RLFPFSRGLTHAYWAPNFWAL 294

>KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 561

 Score =  103 bits (257), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 78/256 (30%), Positives = 128/256 (50%), Gaps = 17/256 (6%)

Query: 69  DFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKI--GSFIKPEWFELN 126
           DF+  R+W+ IT  L  ++WY      W LDYPP  AY  + L +    S  +    ++ 
Sbjct: 52  DFDVHRNWLAITNKLPLNKWYVESTSQWTLDYPPFFAYFEWFLSQFVPKSVAEDGCLDIV 111

Query: 127 ESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILFQPS 186
           +      P +  F R TV+LSE + Y    V+         +KS    F+ A++I+  P 
Sbjct: 112 KVGSFGLPTI-IFQRITVILSELVLYAALQVFINT--SDISEKS--ANFVVASSIVLSPG 166

Query: 187 LMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFF---- 242
           L+++DH HFQYN  + G+ + +I +   + Y + A  F +++CFK + LY AP +F    
Sbjct: 167 LLIVDHIHFQYNGFLFGILISSIVAAKNKRYILCAAFFSIALCFKHIFLYLAPAYFVFLL 226

Query: 243 -AYLLSKSLFSPRFNFPRLFAIAV-ATVLSFAAMYAPLY--IFGGGLANVIQSVHRIFPF 298
            AY+L  S F  R ++  L +I   + +L  A++   ++   F   +    Q + R+FPF
Sbjct: 227 RAYVLDFSSFKFR-SYKDLISIVQWSNLLKLASVVMGIFSLAFLPFITTWQQLLARLFPF 285

Query: 299 ARGIFEDKVA-NFWCV 313
           +RG+     A N W V
Sbjct: 286 SRGLTHAYWAPNVWAV 301

>SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly
           similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067C ALG8 adds glucose to the dolichol- linked
           oligosaccharide precursor prior to transfer to protein
           glycosyl transferase
          Length = 561

 Score =  101 bits (252), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 76/267 (28%), Positives = 126/267 (47%), Gaps = 27/267 (10%)

Query: 69  DFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGK-IGSFIKPE-WFELN 126
           DF+  R+W+ IT  L   +WY      W LDYPP  AY  + L + +   ++ +   ++ 
Sbjct: 48  DFDVHRNWLAITNKLPLREWYIEATSQWTLDYPPFFAYFEWFLSQFVPKIVRDDGCLDIV 107

Query: 127 ESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILFQPS 186
           E      P +  F R TV++SE L ++   ++  K      +KS    FI A++I+  P 
Sbjct: 108 EVGNFGMPTI-IFQRITVIVSEVLLFVVLQIFINK--SATNEKS--ANFIVASSIVLSPG 162

Query: 187 LMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFAYLL 246
            +++DH HFQYN  +  + + AI +     Y +    F  ++CFK + LY AP FF +LL
Sbjct: 163 FLIVDHIHFQYNGFLFAILIAAIVAAKHHRYLLCGAFFATALCFKHIFLYLAPSFFVFLL 222

Query: 247 SKSLFS-PRFNFP------------RLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVH 293
              +     F F             R   + +  +  FA  +AP       ++ + Q + 
Sbjct: 223 RAYILDFTNFKFKSYKDLVSIVKWQRALKLGLVVLGIFAVCFAPF------ISEMPQLLE 276

Query: 294 RIFPFARGIFEDKVA-NFWCVTNVFFK 319
           R+FPF+RG+     A NFW + ++  K
Sbjct: 277 RLFPFSRGLTHAYWAPNFWALYSLLDK 303

>KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {ON}
           Anc_5.669 YOR067C
          Length = 568

 Score =  100 bits (250), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 73/261 (27%), Positives = 125/261 (47%), Gaps = 27/261 (10%)

Query: 69  DFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGK-IGSFIKPEWFELNE 127
           DF+  R+W+ IT  L   +WY+     W LDYPP  AY  +VL + + + ++ +      
Sbjct: 53  DFDVHRNWLAITNALPLREWYYEKTSQWTLDYPPFFAYFEWVLSQFVPAAVRADGCLDIV 112

Query: 128 SRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILFQPSL 187
            +G+       F R TV+ SE L ++   VY        + +S    F+ A++I+  P L
Sbjct: 113 PQGVFGALTVLFQRCTVIASEVLLFVVLQVYINTSPPAEKTQS----FVVASSIVLSPML 168

Query: 188 MLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFAYLLS 247
           +++DH HFQYN  +  + + +I +  +  + + A  +  ++CFK + LY AP +F +LL 
Sbjct: 169 LIVDHIHFQYNGFLFAILIASIVAARKRKFLLCAFFYSTALCFKHIFLYLAPCYFMFLLR 228

Query: 248 --------------KSLFSPRFNFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVH 293
                         K LF    ++ RLF +    +      +AP         ++ Q + 
Sbjct: 229 TYVLQFEGFRFKSYKDLFRI-IHWGRLFKLGGVVLGVAVVCFAPF------ARDMPQLLS 281

Query: 294 RIFPFARGIFEDKVA-NFWCV 313
           R+FPF+RG+     A NFW +
Sbjct: 282 RLFPFSRGLTHAYWAPNFWAL 302

>NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score = 99.8 bits (247), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 101/419 (24%), Positives = 169/419 (40%), Gaps = 78/419 (18%)

Query: 69  DFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGK-IGSFIKPEWFELNE 127
           DF+  R+W+ IT  L   +WY+     W LDYPP  AY  + + + +   ++ +      
Sbjct: 54  DFDVHRNWLAITNKLPLKEWYYEHTSQWTLDYPPFFAYFEWFMSQFVPKVVRDDGCLDIV 113

Query: 128 SRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILFQPSL 187
             G        F R +V++SE L ++    +  K     R +S    FI A +I+  P  
Sbjct: 114 PVGQFGWATVVFQRTSVIISEILLFVVLQWFINKSKDNERTQS----FIVATSIILSPGF 169

Query: 188 MLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFAYLLS 247
           ++IDH HFQYN  +  + + +I +  +E Y +  + + +++CFK + LY AP +F +LL 
Sbjct: 170 LIIDHIHFQYNGFLFAILIASIVAAKQERYLLCGLFYSIALCFKHIFLYLAPCYFVFLLR 229

Query: 248 KSLFSPR-FNFP------------RLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHR 294
             + + + F F              LF +    +  F   + P       + ++ Q   R
Sbjct: 230 AYVLNVKNFKFKSYKDLILLIQWNNLFKLGGIVLSIFGICFLPF------IYHLPQVFTR 283

Query: 295 IFPFARGI--------------FEDKVANFW-------------CVTNVFF--------- 318
           +FPF RG+              F DK+A                C+ +  F         
Sbjct: 284 LFPFGRGLTHAYWAPNFWAIYSFTDKIATTLLLKLPYVHKLLCKCIKHPLFPTTREEIQS 343

Query: 319 ---KYKN-------------IFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIICYALA 362
              +Y N             I PQ   +L S I T    L AV+ +   P       +L 
Sbjct: 344 RIMEYGNNGSKGLVEDVYFIILPQIIPKL-SFILTGFYQLLAVVPLLFDPSFKRFIGSLT 402

Query: 363 TCSMSFYLFSFQVHEKXXXXXXXXXXXXYTSSNWDVLSMANWINNVGLFTLYPLLKKDG 421
            C M+ +LF + VHEK                   +L+    +++ G  +L+PLL K+ 
Sbjct: 403 LCGMASFLFGWHVHEKAILLVIIPFSFLVVCDR-RLLTSFMLVSSAGYVSLFPLLYKND 460

>Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar to
           Ashbya gossypii ADR210C
          Length = 604

 Score = 97.8 bits (242), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 99/381 (25%), Positives = 161/381 (42%), Gaps = 88/381 (23%)

Query: 69  DFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGK-IGSFIKPE-WFELN 126
           D E  R+W+ +T  L    WY      W LDYPP  AY  +VL + + + ++ +   ++ 
Sbjct: 93  DLEVHRNWLALTNKLPLLDWYREATSQWTLDYPPFFAYFEWVLSQFVPAVVRDDGCLDIV 152

Query: 127 ESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILFQPS 186
           +      P +  F+R TV+ +E L ++   V+    +    +      FI A++I   P 
Sbjct: 153 KEGKFGWPTV-VFLRLTVIGTEILLFVVLQVF----INTSDESERTVNFIIASSIALSPG 207

Query: 187 LMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFF---- 242
            +++DH HFQYN  +  + + +I +  +E Y +    F   +CFK + LY AP +F    
Sbjct: 208 FLIVDHMHFQYNGFLFAILIASIVAAKKERYLLCGAFFTTVLCFKHIFLYLAPAYFTFLL 267

Query: 243 -AYLLSKSLFSPR-----------FNFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQ 290
            AY+L+ S FS R           FN  +L  I V+ +   A  + P       +  + Q
Sbjct: 268 RAYVLNFSNFSFRTYRDLIFVVRWFNLLKLGVIIVSIL---AVCFVPF------IPVLPQ 318

Query: 291 SVHRIFPFARGI--------------FEDKVANFW---------CVTNVFF--------- 318
            + R+FPF+RG+              F D++  F          C T +           
Sbjct: 319 LISRLFPFSRGLTHAYWAPNFWAVYAFMDRILTFIMLKMPYVHKCATKIVLPPLIPNSIE 378

Query: 319 KYKN-------------------IFPQEQLQLYSLIATMLGFLPAVIVIFLYP--KKHII 357
           + KN                   I PQ Q +L +   T+   + A+I +   P  K+ I 
Sbjct: 379 EIKNRIGASNYGTRGLVQDILFIILPQVQPRL-TFALTLFYQILAIIPVLFNPSFKRFIG 437

Query: 358 CYALATCSMSFYLFSFQVHEK 378
           C  L  C  S +LF + VHEK
Sbjct: 438 CLTL--CGFSSFLFGWHVHEK 456

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.143    0.471 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,397,477
Number of extensions: 2406781
Number of successful extensions: 6408
Number of sequences better than 10.0: 44
Number of HSP's gapped: 6465
Number of HSP's successfully gapped: 54
Length of query: 542
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 428
Effective length of database: 40,409,475
Effective search space: 17295255300
Effective search space used: 17295255300
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 68 (30.8 bits)