Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G044606.23ON36936919160.0
SAKL0E01342g6.23ON34131411821e-162
ZYRO0C07722g6.23ON37330611811e-162
NCAS0D021706.23ON31030211521e-158
NDAI0C026206.23ON31131011101e-152
KAFR0A050806.23ON31130410931e-149
KNAG0D02240singletonON35931210931e-148
Kpol_1061.27singletonON30630110761e-147
CAGL0F01815gsingletonON31430410751e-146
TPHA0M002806.23ON30329410721e-146
Kpol_385.5singletonON30630110721e-146
NCAS0H008406.23ON36031310711e-145
CAGL0I08151gsingletonON38229910631e-143
KLLA0D01243g6.23ON31129810541e-143
KAFR0G026806.23ON38330710531e-142
KNAG0M011906.23ON38029610521e-142
KLTH0C11154g6.23ON30529610311e-140
NDAI0D008306.23ON37431910381e-140
KNAG0K01400singletonON30929310251e-139
Kwal_56.224396.23ON32032010201e-138
KAFR0D038101.106ON377139830.083
ZYRO0F16126g1.106ON282101740.83
TPHA0B042601.106ON34883721.7
NCAS0A007501.108ON27690677.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G04460
         (369 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G04460 Chr7 (809440..810549) [1110 bp, 369 aa] {ON}              742   0.0  
SAKL0E01342g Chr5 (101847..102872) [1026 bp, 341 aa] {ON} conser...   459   e-162
ZYRO0C07722g Chr3 (585947..587068) [1122 bp, 373 aa] {ON} conser...   459   e-162
NCAS0D02170 Chr4 complement(403949..404881) [933 bp, 310 aa] {ON...   448   e-158
NDAI0C02620 Chr3 (608649..609584) [936 bp, 311 aa] {ON} Anc_6.23      432   e-152
KAFR0A05080 Chr1 complement(1009747..1010682) [936 bp, 311 aa] {...   425   e-149
KNAG0D02240 Chr4 complement(385803..386882) [1080 bp, 359 aa] {O...   425   e-148
Kpol_1061.27 s1061 (79476..80396) [921 bp, 306 aa] {ON} (79476.....   419   e-147
CAGL0F01815g Chr6 complement(179470..180414) [945 bp, 314 aa] {O...   418   e-146
TPHA0M00280 Chr13 complement(55778..56689) [912 bp, 303 aa] {ON}...   417   e-146
Kpol_385.5 s385 (12788..13708) [921 bp, 306 aa] {ON} (12788..137...   417   e-146
NCAS0H00840 Chr8 complement(153671..154753) [1083 bp, 360 aa] {O...   417   e-145
CAGL0I08151g Chr9 (793917..795065) [1149 bp, 382 aa] {ON} highly...   414   e-143
KLLA0D01243g Chr4 complement(108848..109783) [936 bp, 311 aa] {O...   410   e-143
KAFR0G02680 Chr7 (553335..554486) [1152 bp, 383 aa] {ON} Anc_6.23     410   e-142
KNAG0M01190 Chr13 complement(216456..217598) [1143 bp, 380 aa] {...   409   e-142
KLTH0C11154g Chr3 (916374..917291) [918 bp, 305 aa] {ON} conserv...   401   e-140
NDAI0D00830 Chr4 complement(188085..189209) [1125 bp, 374 aa] {O...   404   e-140
KNAG0K01400 Chr11 complement(280379..281308) [930 bp, 309 aa] {O...   399   e-139
Kwal_56.22439 s56 complement(129210..130172) [963 bp, 320 aa] {O...   397   e-138
KAFR0D03810 Chr4 (737329..738462) [1134 bp, 377 aa] {ON} Anc_1.1...    37   0.083
ZYRO0F16126g Chr6 (1324806..1325654) [849 bp, 282 aa] {ON} some ...    33   0.83 
TPHA0B04260 Chr2 (997914..998960) [1047 bp, 348 aa] {ON} Anc_1.1...    32   1.7  
NCAS0A00750 Chr1 complement(145092..145922) [831 bp, 276 aa] {ON...    30   7.1  

>TDEL0G04460 Chr7 (809440..810549) [1110 bp, 369 aa] {ON} 
          Length = 369

 Score =  742 bits (1916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/369 (97%), Positives = 358/369 (97%)

Query: 1   MLMTKKNSKKNICRNQCYGYKXXXXXXXXXXXIRFSLLEESITSRKIITDFISQSETMSK 60
           MLMTKKNSKKNICRNQCYGYK           IRFSLLEESITSRKIITDFISQSETMSK
Sbjct: 1   MLMTKKNSKKNICRNQCYGYKLGLLLLALWLGIRFSLLEESITSRKIITDFISQSETMSK 60

Query: 61  TLQVRSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTVSPPAGFPDHPHHG 120
           TLQVRSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTVSPPAGFPDHPHHG
Sbjct: 61  TLQVRSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTVSPPAGFPDHPHHG 120

Query: 121 QETITYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKMDSGQPAVGLQLWV 180
           QETITYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKMDSGQPAVGLQLWV
Sbjct: 121 QETITYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKMDSGQPAVGLQLWV 180

Query: 181 DLPEKLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARDLAYTPVHYYHFAT 240
           DLPEKLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARDLAYTPVHYYHFAT
Sbjct: 181 DLPEKLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARDLAYTPVHYYHFAT 240

Query: 241 SKKGTEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDAVEGFSASDNAEFV 300
           SKKGTEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDAVEGFSASDNAEFV
Sbjct: 241 SKKGTEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDAVEGFSASDNAEFV 300

Query: 301 LIGGEILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRSTIAGGITESEAKK 360
           LIGGEILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRSTIAGGITESEAKK
Sbjct: 301 LIGGEILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRSTIAGGITESEAKK 360

Query: 361 DFRNSKGIK 369
           DFRNSKGIK
Sbjct: 361 DFRNSKGIK 369

>SAKL0E01342g Chr5 (101847..102872) [1026 bp, 341 aa] {ON} conserved
           hypothetical protein
          Length = 341

 Score =  459 bits (1182), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 205/314 (65%), Positives = 257/314 (81%)

Query: 51  FISQSETMSKTLQVRSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTVSPP 110
           F+S     ++  +VR+I K+FVA +Q EGVGA VRRSIGT Q+R F+PFLMLDHF V+PP
Sbjct: 27  FMSNKGQENRMSKVRTIYKHFVAVEQSEGVGARVRRSIGTTQLRNFTPFLMLDHFNVTPP 86

Query: 111 AGFPDHPHHGQETITYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKMDSG 170
           AGFPDHPHHGQETITY+LGGM+AHEDF+ SKG+L PGDLQFMTAGK I+HSEIPVKM+SG
Sbjct: 87  AGFPDHPHHGQETITYVLGGMMAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEIPVKMESG 146

Query: 171 QPAVGLQLWVDLPEKLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARDLAY 230
           +P VGLQLWVDLPE+LKNCEPRYRDL+  + P+ +P ++LKV VISG SYGVQS  +LAY
Sbjct: 147 EPTVGLQLWVDLPERLKNCEPRYRDLRGAETPIAEPHQNLKVRVISGESYGVQSRSELAY 206

Query: 231 TPVHYYHFATSKKGTEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDAVEG 290
           TPVH+YHF +SKKGT F Q+FP  FN FMY+LKGS+ +  K FPQ+S +FF  DG+ VEG
Sbjct: 207 TPVHFYHFISSKKGTPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQYSAIFFKNDGEGVEG 266

Query: 291 FSASDNAEFVLIGGEILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRSTIA 350
            +ASD+ EF L+GG IL Q VVQHGPFVET++ER+I+VF +YQ  +NGF+R  NW+S+I+
Sbjct: 267 IAASDDTEFALVGGSILEQPVVQHGPFVETSKERMIQVFQDYQFGMNGFERAHNWKSSIS 326

Query: 351 GGITESEAKKDFRN 364
            GI++  A+K  ++
Sbjct: 327 DGISQQNAEKQLKS 340

>ZYRO0C07722g Chr3 (585947..587068) [1122 bp, 373 aa] {ON} conserved
           hypothetical protein
          Length = 373

 Score =  459 bits (1181), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 209/306 (68%), Positives = 255/306 (83%)

Query: 58  MSKTLQVRSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTVSPPAGFPDHP 117
           MSK++ VRS++KNF+A +QEEGVGA VRRSIGTM+MRRF PFLMLD F V PPAGFPDHP
Sbjct: 67  MSKSISVRSVLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPAGFPDHP 126

Query: 118 HHGQETITYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKMDSGQPAVGLQ 177
           HHGQETITY L GM+AHEDF+ SKG+L PGDLQFMTAGK I+HSEIPV ++ G  + GLQ
Sbjct: 127 HHGQETITYNLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGSASNGLQ 186

Query: 178 LWVDLPEKLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARDLAYTPVHYYH 237
           LWVDLP +LKNCEPRYRDL+ K  P +K +++L V VISG SYGV S ++LAYTPVH+YH
Sbjct: 187 LWVDLPAELKNCEPRYRDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYTPVHFYH 246

Query: 238 FATSKKGTEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDAVEGFSASDNA 297
           F TSKKGTEF QEFP+ FN F YILKGS+ + +++FP+ S VFFDTDG+ V G S SD+A
Sbjct: 247 FITSKKGTEFAQEFPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGTSVSDDA 306

Query: 298 EFVLIGGEILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRSTIAGGITESE 357
           EFVLIGG+IL Q+V+QHGPFVET+RER+I+VF NYQ  +NGF+   +W S IAGGI+E+E
Sbjct: 307 EFVLIGGKILDQEVLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAGGISEAE 366

Query: 358 AKKDFR 363
           A+K ++
Sbjct: 367 ARKLYK 372

>NCAS0D02170 Chr4 complement(403949..404881) [933 bp, 310 aa] {ON}
           Anc_6.23
          Length = 310

 Score =  448 bits (1152), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 199/302 (65%), Positives = 255/302 (84%)

Query: 58  MSKTLQVRSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTVSPPAGFPDHP 117
           M+K++Q RS++K+FVA +QEEGVGA VRRSIG+M+ R FSPFL++D+FTVS PAGFPDHP
Sbjct: 1   MTKSMQFRSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHP 60

Query: 118 HHGQETITYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKMDSGQPAVGLQ 177
           HHGQETITY+L GM+AHEDF+ S+G+L PGDLQFMTAGKAI+HSEIPV+M++G   +G+Q
Sbjct: 61  HHGQETITYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQ 120

Query: 178 LWVDLPEKLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARDLAYTPVHYYH 237
           LWVDLP+KLKNCEPRYR+L+A +IP++KP++ L V V+SG SYGV+S +DLAYTP+ YY 
Sbjct: 121 LWVDLPKKLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYF 180

Query: 238 FATSKKGTEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDAVEGFSASDNA 297
             T K GTEFVQEFP  FN F+YI+KGS+ I + + PQ+ST+FF TDGDA++G SAS++ 
Sbjct: 181 MNTKKTGTEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDT 240

Query: 298 EFVLIGGEILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRSTIAGGITESE 357
           EFVL+GG+IL Q ++QHGPFVE++RE L+EVF NYQ  INGF+R R WRS IA GI E +
Sbjct: 241 EFVLVGGQILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHEDD 300

Query: 358 AK 359
            +
Sbjct: 301 VE 302

>NDAI0C02620 Chr3 (608649..609584) [936 bp, 311 aa] {ON} Anc_6.23
          Length = 311

 Score =  432 bits (1110), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 201/310 (64%), Positives = 249/310 (80%), Gaps = 1/310 (0%)

Query: 58  MSKTLQVRSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTVSPPAGFPDHP 117
           MSK  Q+RS+ KNF+A +QEEGVGA VRRSIG+M+ R FSPFL++DHFTVS PAGFPDHP
Sbjct: 1   MSKVPQIRSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHP 60

Query: 118 HHGQETITYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKMDSGQPAVGLQ 177
           HHGQETITY+L GM+AHEDF+ SKG+L PGDLQFMTAGKAI+HSEIPVKM++G P +G+Q
Sbjct: 61  HHGQETITYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQ 120

Query: 178 LWVDLPEKLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARDLAYTPVHYYH 237
           LWV LP  LKN EPRYR+L+   IP+IKP+E+L V VISG SYG +S +DLAYTP+ YY 
Sbjct: 121 LWVALPIDLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYI 180

Query: 238 FATSKKGTEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDAVEGFSASD-N 296
           F  +KKG EF QE PR FN F+YI KG++ I   ++P++STVFFDTDGD+++G SA+D  
Sbjct: 181 FNMNKKGVEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEE 240

Query: 297 AEFVLIGGEILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRSTIAGGITES 356
            EF +IGG IL Q ++QHGPFVET+RE L++VF NYQ  INGF+R R WRS+IA GI E 
Sbjct: 241 TEFAIIGGLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEK 300

Query: 357 EAKKDFRNSK 366
           +     ++SK
Sbjct: 301 DVPAFEKSSK 310

>KAFR0A05080 Chr1 complement(1009747..1010682) [936 bp, 311 aa] {ON}
           Anc_6.23
          Length = 311

 Score =  425 bits (1093), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 189/304 (62%), Positives = 246/304 (80%)

Query: 57  TMSKTLQVRSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTVSPPAGFPDH 116
           T       R+I K+FVA +QEEGVGA VRRS+G+M+ R F+PFL+LDHFTVS PAGFPDH
Sbjct: 3   TTENATTFRTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFPDH 62

Query: 117 PHHGQETITYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKMDSGQPAVGL 176
           PHHGQETITY+  GM+AHEDF+ SKGIL PGDLQFMTAGK I+HSEIPV M++G   VGL
Sbjct: 63  PHHGQETITYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGL 122

Query: 177 QLWVDLPEKLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARDLAYTPVHYY 236
           QLWVDLP+++K+CEPRYR+L+  +IP+++P+EHLKV VISG SYGV+S ++LAYTPV +Y
Sbjct: 123 QLWVDLPQEMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVDFY 182

Query: 237 HFATSKKGTEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDAVEGFSASDN 296
           HF ++KKGT+FVQ+ P  FN F+Y++KGS+ IG++ FPQ+ST+FF+ DG+ ++G  + D+
Sbjct: 183 HFISNKKGTDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGVVSDDD 242

Query: 297 AEFVLIGGEILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRSTIAGGITES 356
            EF +IGG IL Q V+QHGPF+E+ RE+LIEVF N+Q  INGF+R   W+S+I  GI E 
Sbjct: 243 TEFAIIGGLILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGILEK 302

Query: 357 EAKK 360
           +  K
Sbjct: 303 DVPK 306

>KNAG0D02240 Chr4 complement(385803..386882) [1080 bp, 359 aa] {ON} 
          Length = 359

 Score =  425 bits (1093), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 190/312 (60%), Positives = 246/312 (78%)

Query: 49  TDFISQSETMSKTLQVRSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTVS 108
           T+  +   TM    ++RSI  +F+  +  EGVGA V+RS+G+MQ RRF+PFLMLD FTV 
Sbjct: 45  TNTTNNDYTMPSLFKLRSIANHFIPREVAEGVGARVKRSVGSMQQRRFTPFLMLDDFTVK 104

Query: 109 PPAGFPDHPHHGQETITYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKMD 168
            P+GFPDHPHHGQETITY++ G++AHEDF+ SKG+L PGDLQFMTAGK I+HSE+PV+M+
Sbjct: 105 SPSGFPDHPHHGQETITYVIDGLIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVEME 164

Query: 169 SGQPAVGLQLWVDLPEKLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARDL 228
            G+PA GLQLWVDLP+ LKNCEPRYR+L+++DIPV+KP E+L+V VISG SYG +S +DL
Sbjct: 165 DGRPARGLQLWVDLPKDLKNCEPRYRNLRSEDIPVVKPHENLEVRVISGKSYGTESVKDL 224

Query: 229 AYTPVHYYHFATSKKGTEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDAV 288
           AYTP+ +Y+   SK GTEF QE P  FNAF+Y++KGS+ I EK+F Q + +FFDTDG+ V
Sbjct: 225 AYTPIDFYYMLASKAGTEFAQEIPSDFNAFLYVMKGSVVINEKVFKQNTAIFFDTDGEGV 284

Query: 289 EGFSASDNAEFVLIGGEILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRST 348
            G + SD+ EF +IGG+IL Q +VQHGPFVET++E+L E F NY+    GF+R + WRS 
Sbjct: 285 AGQAGSDDTEFAIIGGKILDQPLVQHGPFVETDQEKLYEAFMNYEGYTKGFERAKGWRSD 344

Query: 349 IAGGITESEAKK 360
           IA GI ESEAK+
Sbjct: 345 IASGINESEAKQ 356

>Kpol_1061.27 s1061 (79476..80396) [921 bp, 306 aa] {ON}
           (79476..80396) [921 nt, 307 aa]
          Length = 306

 Score =  419 bits (1076), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 189/301 (62%), Positives = 242/301 (80%)

Query: 58  MSKTLQVRSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTVSPPAGFPDHP 117
           MSK   +RSI K+F++ +Q EGVGA VRRSIGTM +R+FSPFLMLDHF V+P AGFPDHP
Sbjct: 1   MSKQQNLRSIFKHFISREQSEGVGARVRRSIGTMLLRKFSPFLMLDHFNVAPGAGFPDHP 60

Query: 118 HHGQETITYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKMDSGQPAVGLQ 177
           HHGQETITY+  GM+AHEDF+  KG+L  GDLQFMTAGKAI H+E+PV+ +SG+  VGLQ
Sbjct: 61  HHGQETITYVNEGMIAHEDFTGCKGVLGKGDLQFMTAGKAICHAEMPVQSNSGEHVVGLQ 120

Query: 178 LWVDLPEKLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARDLAYTPVHYYH 237
           LWVDLP  +KN EPRYRDL+ KDIP   P++ L++ VISG SYGV S +DLAYTP+ +Y 
Sbjct: 121 LWVDLPTDMKNTEPRYRDLRNKDIPRANPTDDLEIEVISGNSYGVDSVKDLAYTPIDFYM 180

Query: 238 FATSKKGTEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDAVEGFSASDNA 297
           +   K GTEF Q+F R FN F+Y+LKG++ IG+++FPQ+S++FF+TDGDAV G  A+D+ 
Sbjct: 181 YRGKKAGTEFTQKFSRDFNVFIYVLKGAVNIGDQVFPQYSSIFFNTDGDAVGGTVAADDT 240

Query: 298 EFVLIGGEILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRSTIAGGITESE 357
           EF +IGG+IL Q+ VQHGPFVE  +E+LI+VF++YQ+  NGF+R RNWRS+I  GI E +
Sbjct: 241 EFAIIGGKILDQETVQHGPFVEETKEKLIKVFYDYQSYSNGFERARNWRSSIRDGIKEDD 300

Query: 358 A 358
           A
Sbjct: 301 A 301

>CAGL0F01815g Chr6 complement(179470..180414) [945 bp, 314 aa] {ON}
           similar to KLLA0D01243g Kluyveromyces lactis and
           DEHA0E07447g Debaryomyces hansenii
          Length = 314

 Score =  418 bits (1075), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 188/304 (61%), Positives = 246/304 (80%), Gaps = 2/304 (0%)

Query: 65  RSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTVSPPAGFPDHPHHGQETI 124
           RSI K+F+  +QEEGVGA VRRS+GTM+ R FSPFLMLD F V  PAGFPDHPHHGQETI
Sbjct: 5   RSIQKHFMTFEQEEGVGARVRRSVGTMKQRMFSPFLMLDDFYVKHPAGFPDHPHHGQETI 64

Query: 125 TYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKMDSGQPAVGLQLWVDLPE 184
           TY+L GM+AHEDF+ +KG+L  GDLQFMTAGK I+HSEIPV+M+SG+   GLQ WVDLP+
Sbjct: 65  TYVLNGMVAHEDFTGAKGVLGKGDLQFMTAGKGIVHSEIPVQMESGEACHGLQFWVDLPK 124

Query: 185 KLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARDLAYTPVHYYHFATSKKG 244
            LK CEPRYR+L+   IPV++P+E+L V VISG SYGV S RDLAYTP+H YH+ T+K G
Sbjct: 125 DLKWCEPRYRNLRGDKIPVVRPNENLTVKVISGKSYGVDSVRDLAYTPIHMYHYLTNKAG 184

Query: 245 TEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDAVEGFSASDNAEFVLIGG 304
           T++ QEFP+ FN FMY++KG + +G+++FP+ + VFF+TDGDAV+G  A+D+A+F ++GG
Sbjct: 185 TQWEQEFPKNFNVFMYVMKGKVSVGDQVFPEHTAVFFNTDGDAVKGEFATDDAQFAIMGG 244

Query: 305 EILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRSTIAGGITESEAKKDFRN 364
           +IL Q  +QHGPFVET+RE L++VF NYQ  INGF+R + W+S+I  GITE + +++   
Sbjct: 245 QILDQQTIQHGPFVETDRESLMKVFMNYQYGINGFERAKGWQSSIIHGITEKQVREN--E 302

Query: 365 SKGI 368
           +KG+
Sbjct: 303 AKGL 306

>TPHA0M00280 Chr13 complement(55778..56689) [912 bp, 303 aa] {ON}
           Anc_6.23
          Length = 303

 Score =  417 bits (1072), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 188/294 (63%), Positives = 237/294 (80%)

Query: 65  RSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTVSPPAGFPDHPHHGQETI 124
           RSI+K+F+A +Q EGVGA VRRSIGT +MR+FSPFLMLDHF V PPAGFPDHPHHGQETI
Sbjct: 6   RSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHHGQETI 65

Query: 125 TYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKMDSGQPAVGLQLWVDLPE 184
           TY+  GM+AHEDF+ SKGIL PGDLQFMTAGKA+ HSE+PV M++G+   GLQLWVDLP 
Sbjct: 66  TYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLWVDLPT 125

Query: 185 KLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARDLAYTPVHYYHFATSKKG 244
            LKN EPRYRDL  ++IP+ KP E+L++ VISG SYG++S +DLAYTPV +Y +   KKG
Sbjct: 126 NLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYKARKKG 185

Query: 245 TEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDAVEGFSASDNAEFVLIGG 304
           + F Q+F R +N F+YI+KGS+ IG ++FPQ S++FF+TDGD V+G   SD+ EF +IGG
Sbjct: 186 SAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDTEFAIIGG 245

Query: 305 EILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRSTIAGGITESEA 358
           +IL Q+ VQHGPFVE   E+L++VFHNY++   GF+R  NWRS+I  GI ES+A
Sbjct: 246 QILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDESQA 299

>Kpol_385.5 s385 (12788..13708) [921 bp, 306 aa] {ON} (12788..13708)
           [921 nt, 307 aa]
          Length = 306

 Score =  417 bits (1072), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 191/301 (63%), Positives = 241/301 (80%)

Query: 58  MSKTLQVRSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTVSPPAGFPDHP 117
           MSK   +RSI K+F+A +Q EGVGA VRRSIGTM +R+FSPFLMLDHF V+P AGFPDHP
Sbjct: 1   MSKQQNLRSIFKHFIAREQAEGVGARVRRSIGTMLLRKFSPFLMLDHFNVAPGAGFPDHP 60

Query: 118 HHGQETITYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKMDSGQPAVGLQ 177
           HHGQETITY+  GM+AHEDF+  KG+L  GDLQFMTAGKAI H+E+PV+ +SG+  VGLQ
Sbjct: 61  HHGQETITYVNEGMIAHEDFTGCKGVLYKGDLQFMTAGKAICHAEMPVQSNSGEHVVGLQ 120

Query: 178 LWVDLPEKLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARDLAYTPVHYYH 237
           LWVDLP  +KN EPRYRDLK K+IP   P++ L+V VISG SYGV S +DLAYTP+ +Y 
Sbjct: 121 LWVDLPTDMKNTEPRYRDLKNKEIPRANPTDDLEVEVISGNSYGVDSVKDLAYTPIDFYM 180

Query: 238 FATSKKGTEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDAVEGFSASDNA 297
           +   K GTEF Q F R FN F+Y+L+G+I IG+++FPQ+S++FF+TDGDAV G  A+DN 
Sbjct: 181 YRGKKAGTEFTQNFSRDFNVFIYVLQGAITIGDQVFPQYSSIFFNTDGDAVGGTIAADNT 240

Query: 298 EFVLIGGEILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRSTIAGGITESE 357
           EF +IGG+IL Q  VQHGPFVE  +E+LI+VF++YQ+  NGF+R RNW+S+I  GI E++
Sbjct: 241 EFAIIGGKILDQQTVQHGPFVEETKEKLIKVFYDYQSYSNGFERARNWKSSIRDGIKEND 300

Query: 358 A 358
           A
Sbjct: 301 A 301

>NCAS0H00840 Chr8 complement(153671..154753) [1083 bp, 360 aa] {ON}
           Anc_6.23
          Length = 360

 Score =  417 bits (1071), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 188/313 (60%), Positives = 245/313 (78%)

Query: 48  ITDFISQSETMSKTLQVRSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTV 107
           + D +++    +++ + RSI+K+F+A +Q EG GATVRRS+G+ QM RFSPFLMLD F V
Sbjct: 45  VMDQVNEDSATAESQKERSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKV 104

Query: 108 SPPAGFPDHPHHGQETITYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKM 167
           +PP GFPDHPHHGQETITY+ GG+LAHEDF+ SKG+L PGDLQFMTAGK I+H E+PV M
Sbjct: 105 TPPEGFPDHPHHGQETITYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTM 164

Query: 168 DSGQPAVGLQLWVDLPEKLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARD 227
           +    + GLQ WVDLP  LKNCEPRYR+L+A  IPV++ +++L V VISG SY V+S +D
Sbjct: 165 NDSAVSTGLQFWVDLPADLKNCEPRYRNLRADTIPVVQVNDNLNVKVISGKSYDVESVKD 224

Query: 228 LAYTPVHYYHFATSKKGTEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDA 287
           LAYTP+ +Y+F ++K GTEF QE P  FNAF+Y+ KG+I IGE++F   S+VFF TDG+ 
Sbjct: 225 LAYTPIDFYYFISNKAGTEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNF 284

Query: 288 VEGFSASDNAEFVLIGGEILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRS 347
           + GF+ASDN EF +IGG+IL Q VVQHGPFVET RE+LIEVF NY+  INGF++   W+S
Sbjct: 285 IRGFTASDNTEFAVIGGKILDQQVVQHGPFVETTREKLIEVFDNYRAGINGFEKALGWKS 344

Query: 348 TIAGGITESEAKK 360
           +I+ GI E  A++
Sbjct: 345 SISNGIDEQTARE 357

>CAGL0I08151g Chr9 (793917..795065) [1149 bp, 382 aa] {ON} highly
           similar to KLLA0D01243g Kluyveromyces lactis and
           DEHA0E07447g Debaryomyces hansenii and YALI0E33297g
           Yarrowia lipolytica and CA2891|CaIFS4 Candida albicans
          Length = 382

 Score =  414 bits (1063), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 187/299 (62%), Positives = 233/299 (77%)

Query: 65  RSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTVSPPAGFPDHPHHGQETI 124
           RSI+ +F+A +QEEGVGA VRRS+GT QMRRF+PFLMLD FTV+PP GFPDHPHHGQETI
Sbjct: 83  RSILTHFIAGEQEEGVGARVRRSVGTYQMRRFTPFLMLDDFTVAPPNGFPDHPHHGQETI 142

Query: 125 TYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKMDSGQPAVGLQLWVDLPE 184
           TY+  GM+AHED + SKG+L  GDLQFMTAGK I+HSEIPV    G+P  GLQLWVDLP 
Sbjct: 143 TYVTDGMIAHEDITGSKGVLLKGDLQFMTAGKGIVHSEIPVTTKDGKPCRGLQLWVDLPS 202

Query: 185 KLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARDLAYTPVHYYHFATSKKG 244
            +KN +PRYR+L+  + PV  P+E+L+V VISG SYGV+S RDLAYTPVH YHF  +K G
Sbjct: 203 DMKNIDPRYRNLRGNETPVAYPNENLEVRVISGKSYGVESLRDLAYTPVHLYHFLANKTG 262

Query: 245 TEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDAVEGFSASDNAEFVLIGG 304
           TEFVQ+ P  FN F+Y++KGSI + +     FS+ FFD DG+A+ G + S++A+F +I G
Sbjct: 263 TEFVQDIPEDFNVFIYVMKGSIQVNDVELTTFSSAFFDVDGNAIRGKALSEDAQFAIIAG 322

Query: 305 EILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRSTIAGGITESEAKKDFR 363
            IL Q+V+QHGPFVETNRE+L+EVF NYQ   NGF+   +WRS+I  GI+E EA K +R
Sbjct: 323 RILDQEVIQHGPFVETNREKLMEVFRNYQEEKNGFENAHSWRSSIHDGISEEEALKLYR 381

>KLLA0D01243g Chr4 complement(108848..109783) [936 bp, 311 aa] {ON}
           conserved hypothetical protein
          Length = 311

 Score =  410 bits (1054), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 183/298 (61%), Positives = 236/298 (79%)

Query: 63  QVRSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTVSPPAGFPDHPHHGQE 122
           +VRS++K+FVA +Q EG GA V+RSIGT+QMR F PFLMLD+F VSPPAGFP+HPHHGQE
Sbjct: 8   KVRSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPEHPHHGQE 67

Query: 123 TITYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKMDSGQPAVGLQLWVDL 182
           TITY+L GM+AHEDF+ SKG+L  GDLQFMTAGKAI+HSEIPVKMD+G+   GLQLWVDL
Sbjct: 68  TITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGLQLWVDL 127

Query: 183 PEKLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARDLAYTPVHYYHFATSK 242
           P  +KN EPRYRDL+ ++IP+  PS++L V VISG SYGV+S  +LAYTPV +YHF  +K
Sbjct: 128 PNDIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEFYHFIANK 187

Query: 243 KGTEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDAVEGFSASDNAEFVLI 302
           K TEF Q F   F++F+YI+KGSI I ++ +P+ S +FF  DGD + GF+ SDNAEF +I
Sbjct: 188 KNTEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSDNAEFAII 247

Query: 303 GGEILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRSTIAGGITESEAKK 360
            G+  +Q VVQ+GPFVE++RE +++V  NYQN +NGF+  R W   I  G+TE+E ++
Sbjct: 248 AGKYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTEAEVQQ 305

>KAFR0G02680 Chr7 (553335..554486) [1152 bp, 383 aa] {ON} Anc_6.23
          Length = 383

 Score =  410 bits (1053), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 185/307 (60%), Positives = 242/307 (78%)

Query: 54  QSETMSKTLQVRSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTVSPPAGF 113
           Q + MS+ +  RSII +F+  +  EG GA V+RSIG+ + RRF+PFLMLD F V+PPAGF
Sbjct: 74  QEDEMSRIIHQRSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFLMLDDFDVTPPAGF 133

Query: 114 PDHPHHGQETITYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKMDSGQPA 173
           PDHPHHGQETITY+L GM+AHEDF+   GILSPGDLQFMTAG+ I+HSEIPV M++G   
Sbjct: 134 PDHPHHGQETITYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIVHSEIPVTMENGGSC 193

Query: 174 VGLQLWVDLPEKLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARDLAYTPV 233
            GLQLWVDLP+ LK  EPRYR+L+A DIP+  P E+LKV VISG SY V+S  DLAYTPV
Sbjct: 194 RGLQLWVDLPQDLKTIEPRYRNLRAADIPIAMPYENLKVYVISGKSYDVESLNDLAYTPV 253

Query: 234 HYYHFATSKKGTEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDAVEGFSA 293
           H YHF T K GT F+QEFP+ FN F+Y++KG++ I EK+F + + +FFD DG+++EG  A
Sbjct: 254 HLYHFVTIKAGTPFIQEFPKDFNVFLYVIKGAVLINEKIFKENTAIFFDVDGESIEGQFA 313

Query: 294 SDNAEFVLIGGEILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRSTIAGGI 353
           +D++EFVL+GGEIL+Q VVQ GPFVET++++L++VF ++++  NGF+R  NW S I  GI
Sbjct: 314 TDDSEFVLVGGEILNQPVVQQGPFVETDKQKLMQVFDDFESYRNGFERAENWESNIRKGI 373

Query: 354 TESEAKK 360
            E+EA++
Sbjct: 374 KEAEARE 380

>KNAG0M01190 Chr13 complement(216456..217598) [1143 bp, 380 aa] {ON}
           Anc_6.23
          Length = 380

 Score =  409 bits (1052), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 182/296 (61%), Positives = 236/296 (79%)

Query: 63  QVRSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTVSPPAGFPDHPHHGQE 122
           + R+I K+F+A +QEEGVGA VRRS+G+M+ R FSPFL+LDHFTVS PAGFPDHPHHGQE
Sbjct: 74  EFRTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPAGFPDHPHHGQE 133

Query: 123 TITYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKMDSGQPAVGLQLWVDL 182
           TITY+  GM+AHEDF  SKG+L PGDLQFMTAGK I+HSEIPV M++G   VGLQLWVDL
Sbjct: 134 TITYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDL 193

Query: 183 PEKLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARDLAYTPVHYYHFATSK 242
           P+ +K+C PRYR+L+  +IP+ +P+EHLK+ VISG S+G+ S ++LAYTPV +YH+ + K
Sbjct: 194 PKDMKDCAPRYRNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELAYTPVDFYHYISDK 253

Query: 243 KGTEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDAVEGFSASDNAEFVLI 302
           KGT FVQE P  FN F+Y++KG++ I  ++FPQ+STVF++ +GDA+ G    D+ EF +I
Sbjct: 254 KGTGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIRGMVDDDDTEFAII 313

Query: 303 GGEILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRSTIAGGITESEA 358
           GG IL Q V+QHGPFVET RE++IEVF N+Q  INGF+R   W+S+I  GI E + 
Sbjct: 314 GGLILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSIRNGILEKDV 369

>KLTH0C11154g Chr3 (916374..917291) [918 bp, 305 aa] {ON} conserved
           hypothetical protein
          Length = 305

 Score =  401 bits (1031), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 188/296 (63%), Positives = 235/296 (79%)

Query: 65  RSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTVSPPAGFPDHPHHGQETI 124
           RSI+K F A +Q EGVGA VRRSIG+ ++R F+PFLMLDHF VSPPAGFPDHPHHGQETI
Sbjct: 5   RSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQETI 64

Query: 125 TYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKMDSGQPAVGLQLWVDLPE 184
           TY+LGGM+AHEDF+ S+G+L PGDLQFMTAGK IIHSEIPV+++SG P+VGLQLWVDLP 
Sbjct: 65  TYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDLPM 124

Query: 185 KLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARDLAYTPVHYYHFATSKKG 244
            LK+CEPRYRDL   +IP ++P   L+V VISG SYGV S  +LAYTPVH+YH+ T K G
Sbjct: 125 HLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRKPG 184

Query: 245 TEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDAVEGFSASDNAEFVLIGG 304
           T F Q FP  FN FMY+LKGS+ +  K F Q+S+VFF+TDG  VEG  +S+ +EF+LIGG
Sbjct: 185 TTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDGSRVEGSGSSEESEFILIGG 244

Query: 305 EILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRSTIAGGITESEAKK 360
           E+L Q ++Q+GPFVET+++ + EV  NYQ+  NGF+R + W S+IA G+  S+  K
Sbjct: 245 EVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAK 300

>NDAI0D00830 Chr4 complement(188085..189209) [1125 bp, 374 aa] {ON}
           Anc_6.23
          Length = 374

 Score =  404 bits (1038), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 185/319 (57%), Positives = 243/319 (76%), Gaps = 6/319 (1%)

Query: 43  TSRKIITDFISQSETMSKTLQVRSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLML 102
           T++ I+ + I++   ++ T   R+I+K F+  +Q EGVGA VRR+IGT +M RF PFLML
Sbjct: 54  TNKNIVNEDIAR---IATTDDARTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLML 110

Query: 103 DHFTVSPPA-GFPDHPHHGQETITYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHS 161
           DHF V+PP  GFPDHPHHGQETITY+L GM+AHEDF+ SKG+L PGDLQFMTAGK I+HS
Sbjct: 111 DHFKVTPPEQGFPDHPHHGQETITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHS 170

Query: 162 EIPVKMDSGQPAVGLQLWVDLPEKLKNCEPRYRDLKAKDIPVIKPSE--HLKVTVISGTS 219
           E+PV M  G+P +GLQLWVDLP +LKNCEPRYR+L+  +IP++   +  H+ V VISG +
Sbjct: 171 EMPVLMKDGRPGIGLQLWVDLPRELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNA 230

Query: 220 YGVQSARDLAYTPVHYYHFATSKKGTEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTV 279
           YGV S RDLAYTP+H+YH+ + K G EF Q  P  FN F+Y++KG++ I +++F Q + V
Sbjct: 231 YGVDSVRDLAYTPIHFYHYISDKAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAV 290

Query: 280 FFDTDGDAVEGFSASDNAEFVLIGGEILHQDVVQHGPFVETNRERLIEVFHNYQNSINGF 339
           FF+ DG +++G SA+++ EF +IGG+IL Q +VQHGPFVET RE L +VF NYQ  INGF
Sbjct: 291 FFNVDGHSIKGQSATNDTEFAIIGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGF 350

Query: 340 DRGRNWRSTIAGGITESEA 358
           +R  NWRS+IA GI E  A
Sbjct: 351 ERAVNWRSSIADGIDEDTA 369

>KNAG0K01400 Chr11 complement(280379..281308) [930 bp, 309 aa] {ON} 
          Length = 309

 Score =  399 bits (1025), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 178/293 (60%), Positives = 231/293 (78%)

Query: 65  RSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTVSPPAGFPDHPHHGQETI 124
           RS+ K F A +Q EGVGA VRRSIG  + R FSPFL+LDHFTVS P+GFPDHPHHGQETI
Sbjct: 6   RSVQKAFRALEQAEGVGALVRRSIGVRRQRNFSPFLLLDHFTVSHPSGFPDHPHHGQETI 65

Query: 125 TYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKMDSGQPAVGLQLWVDLPE 184
           TY+  GM+AHEDF+ SKGIL PGDLQFMTAGK I+HSEIPV     + AVGLQLWVDLP+
Sbjct: 66  TYIQQGMIAHEDFTGSKGILRPGDLQFMTAGKGIVHSEIPVLTKDAKAAVGLQLWVDLPK 125

Query: 185 KLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARDLAYTPVHYYHFATSKKG 244
            +K+C PRYR+L+A +IP+ +P+EHLKV VISG SYGV+S ++LAYTPV +YH+ + K+G
Sbjct: 126 NMKDCPPRYRNLRASEIPIAQPNEHLKVKVISGKSYGVESVKELAYTPVDFYHYISDKEG 185

Query: 245 TEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDAVEGFSASDNAEFVLIGG 304
             FVQE P  +NAF+Y+++GS+ +  + +PQ+ST+F++ +G+A++G +   N EF +I G
Sbjct: 186 INFVQEIPENYNAFLYVMEGSVVVDGQEYPQYSTIFYNANGNAIKGVTGEKNTEFAIIAG 245

Query: 305 EILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRSTIAGGITESE 357
            IL QD+VQHGPFVET+ E++ EVF NYQ  INGF++  NW S+I  GITE +
Sbjct: 246 LILDQDIVQHGPFVETSPEKMKEVFRNYQWGINGFEKAINWESSIINGITEKD 298

>Kwal_56.22439 s56 complement(129210..130172) [963 bp, 320 aa] {ON}
           [contig 185] FULL
          Length = 320

 Score =  397 bits (1020), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 187/320 (58%), Positives = 237/320 (74%), Gaps = 5/320 (1%)

Query: 48  ITDFISQSETMSKTLQVRSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTV 107
           ITD I  SE M K    RSI+K F A +Q EGVGA VRRSIGT ++R F+PFLMLDHFT+
Sbjct: 6   ITD-IEHSELMKK---ARSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTI 61

Query: 108 SPPAGFPDHPHHGQETITYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKM 167
           +PPAGFPDHPHHGQET+T++L G +AHEDF+ SKG+L  GDLQFMTAGK  +HSEIPV++
Sbjct: 62  APPAGFPDHPHHGQETVTHILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQL 121

Query: 168 DSGQPAVGLQLWVDLPEKLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARD 227
           +SG P  G+QLWVDLP +LK+C+PRYRDLK   IP  +    L ++VISG SYGV S ++
Sbjct: 122 ESGDPTEGIQLWVDLPARLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQE 181

Query: 228 LAYTPVHYYHFATSKKGTEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDA 287
           LAYT VHYYH+  S+    F Q FP  FN F+Y+LKG + I  + F + S++FF TDG  
Sbjct: 182 LAYTSVHYYHYVFSEANISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSH 241

Query: 288 VEGFSASDNAEFVLIGGEILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRS 347
           V GFS S++ EF+L GG+IL Q +VQ+GPFVET++ER++EVF NYQ+  NGF++   W S
Sbjct: 242 VSGFSGSNDLEFILAGGQILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTS 301

Query: 348 TIAGGITESEAKKDFRNSKG 367
           +IA GI ES+   DF  S G
Sbjct: 302 SIANGIVESDI-SDFVKSSG 320

>KAFR0D03810 Chr4 (737329..738462) [1134 bp, 377 aa] {ON} Anc_1.106
           YNL254C
          Length = 377

 Score = 36.6 bits (83), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 62/139 (44%), Gaps = 10/139 (7%)

Query: 200 DIPVIKPSEHLKVTVISG----TSYGVQSARDLAYTPVHYYHFATSKKGTEFVQEFPRV- 254
           DIP I  S+ L V+   G      Y ++      Y  +    F  SKK     +EF  + 
Sbjct: 181 DIPTILYSDDL-VSKCEGHFKIVPYILEGKIGSMYYQLAKEAFKNSKKAYLSAEEFREMD 239

Query: 255 ---FNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDAVEGFSASDNAEFVLIGGEILHQDV 311
              F A  Y LK  + IGE++  +F  +        V+ + A+D A +VL   E+L    
Sbjct: 240 LLKFIAGFYGLKRQLVIGEEIVKRFKPMLVKNKSPTVKWWGATDFASYVL-APEVLSSLC 298

Query: 312 VQHGPFVETNRERLIEVFH 330
           ++    ++ N +++ E+++
Sbjct: 299 IEEMGLLKNNDKKIGELYN 317

>ZYRO0F16126g Chr6 (1324806..1325654) [849 bp, 282 aa] {ON} some
           similarities with uniprot|P53850 Saccharomyces
           cerevisiae YNL254C Hypothetical ORF
          Length = 282

 Score = 33.1 bits (74), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 46/101 (45%), Gaps = 10/101 (9%)

Query: 240 TSKKGTEFVQEFPRV----FNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDAVEGFSASD 295
           +S++    VQEF  +    F A  Y +K    IGE +  ++ +      GD ++ +  SD
Sbjct: 162 SSQRAILSVQEFRNMDLTKFTAGYYGMKRQFQIGEVILQKYKSFLLRRQGDTMKWWGVSD 221

Query: 296 NAEFVLIGGEILHQDVVQH-----GPFVETNRERLIEVFHN 331
            A +VL   E+L    ++        + +  RER  ++F N
Sbjct: 222 FAHYVL-APEVLVSLCIKEMQLSDDVYDKNARERAYDIFVN 261

>TPHA0B04260 Chr2 (997914..998960) [1047 bp, 348 aa] {ON} Anc_1.106
           YNL254C
          Length = 348

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 37/83 (44%), Gaps = 5/83 (6%)

Query: 230 YTPVHYYHFATSKKGTEFVQEFPRV----FNAFMYILKGSIGIGEKLFPQFSTVFFDTDG 285
           Y    + H   SKK      EF  +    F A  Y LK  + +G++++ +F  +      
Sbjct: 208 YIEAKHLH-KNSKKALLSTDEFRHMDMTKFQAGFYGLKRQLRLGQEIYNKFRVMLLSNKS 266

Query: 286 DAVEGFSASDNAEFVLIGGEILH 308
             ++ + A D A+FVL    +LH
Sbjct: 267 PTLKWWGALDFAQFVLAPELLLH 289

>NCAS0A00750 Chr1 complement(145092..145922) [831 bp, 276 aa] {ON}
           Anc_1.108 YNL252C
          Length = 276

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 40/90 (44%), Gaps = 5/90 (5%)

Query: 192 RYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARDL--AYTPVHYYHFATSKKGTEFVQ 249
           R R LK +   V+ P E   VT  +G++ G +S  DL  A  P+      T       ++
Sbjct: 92  RERRLKQE---VVLPKEKKDVTESTGSTGGSESVTDLTDASRPIVPNSRITEADKLNDLK 148

Query: 250 EFPRVFNAFMYILKGSIGIGEKLFPQFSTV 279
              R  +  +Y+L     +G+ +FP F  V
Sbjct: 149 SLERQLSRTLYLLVQDKSLGKWIFPSFDVV 178

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,439,723
Number of extensions: 1579256
Number of successful extensions: 3494
Number of sequences better than 10.0: 28
Number of HSP's gapped: 3581
Number of HSP's successfully gapped: 28
Length of query: 369
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 258
Effective length of database: 40,753,473
Effective search space: 10514396034
Effective search space used: 10514396034
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)