Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G044406.25ON73573536570.0
NCAS0H008606.25ON75575219340.0
KAFR0G026606.25ON73574419110.0
ZYRO0C07678g6.25ON74174918930.0
Kpol_1037.296.25ON74674718820.0
Suva_15.1766.25ON74574718630.0
TPHA0J003706.25ON74374518460.0
KNAG0M012306.25ON73874418430.0
NDAI0D008506.25ON79077118440.0
SAKL0E01452g6.25ON73774317890.0
Smik_15.1706.25ON77374217840.0
KLLA0D01309g6.25ON74461517760.0
YOR001W (RRP6)6.25ON73373517690.0
Skud_15.1626.25ON73474617590.0
CAGL0E02585g6.25ON73774017440.0
TBLA0A071706.25ON77174217450.0
ACL001C6.25ON74561217050.0
Kwal_56.224476.25ON73563516440.0
Ecym_30306.25ON74762616300.0
KLTH0C11066g6.25ON73555615810.0
KLLA0F20768g2.49ON23863780.59
KAFR0G004208.860ON37451733.4
Ecym_64132.83ON51753724.5
KLLA0D18942g2.46ON357776910.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G04440
         (735 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.2...  1413   0.0  
NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {O...   749   0.0  
KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.2...   740   0.0  
ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} simila...   733   0.0  
Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {O...   729   0.0  
Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001...   722   0.0  
TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON...   715   0.0  
KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {...   714   0.0  
NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {O...   714   0.0  
SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} simila...   693   0.0  
Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001...   691   0.0  
KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} simila...   688   0.0  
YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nucle...   686   0.0  
Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001...   682   0.0  
CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} simila...   676   0.0  
TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6...   676   0.0  
ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON} S...   661   0.0  
Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001...   637   0.0  
Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to ...   632   0.0  
KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {...   613   0.0  
KLLA0F20768g Chr6 complement(1936804..1937520) [717 bp, 238 aa] ...    35   0.59 
KAFR0G00420 Chr7 (122124..123248) [1125 bp, 374 aa] {ON} Anc_8.860     33   3.4  
Ecym_6413 Chr6 (799650..801203) [1554 bp, 517 aa] {ON} similar t...    32   4.5  
KLLA0D18942g Chr4 (1594560..1595633) [1074 bp, 357 aa] {ON} simi...    31   10.0 

>TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score = 1413 bits (3657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 695/735 (94%), Positives = 695/735 (94%)

Query: 1   MPPAEEDQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSI 60
           MPPAEEDQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSI
Sbjct: 1   MPPAEEDQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSI 60

Query: 61  DQNSEPLVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKLKFLDNSSS 120
           DQNSEPLVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKLKFLDNSSS
Sbjct: 61  DQNSEPLVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKLKFLDNSSS 120

Query: 121 NDSIPSKRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPLISDIVPGNDAVPEHYAQP 180
           NDSIPSKRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPLISDIVPGNDAVPEHYAQP
Sbjct: 121 NDSIPSKRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPLISDIVPGNDAVPEHYAQP 180

Query: 181 YEYEIEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDLEHH 240
           YEYEIEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDLEHH
Sbjct: 181 YEYEIEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDLEHH 240

Query: 241 DYRSYYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIWLQR 300
           DYRSYYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIWLQR
Sbjct: 241 DYRSYYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIWLQR 300

Query: 301 DLGLYVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMNAYA 360
           DLGLYVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMNAYA
Sbjct: 301 DLGLYVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMNAYA 360

Query: 361 RADTHFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCPIDKP 420
           RADTHFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCPIDKP
Sbjct: 361 RADTHFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCPIDKP 420

Query: 421 DPWKVLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTEPIN 480
           DPWKVLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTEPIN
Sbjct: 421 DPWKVLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTEPIN 480

Query: 481 VISVNSIVTDHVRSNSLVLAHLIKNTLASSDKESDKGTFEADNNSTDAASLLTVPQIQKL 540
           VISVNSIVTDHVRSNSLVLAHLIKNTLASSDKESDKGTFEADNNSTDAASLLTVPQIQKL
Sbjct: 481 VISVNSIVTDHVRSNSLVLAHLIKNTLASSDKESDKGTFEADNNSTDAASLLTVPQIQKL 540

Query: 541 AACFAGVSRAFTILQNEYKDGRSSSIFTDILTSEDDAVNYVGNNMDHITKKELGKRAAKA 600
           AACFAGVSRAFTILQNEYKDGRSSSIFTDILTSEDDAVNYVGNNMDHITKKELGKRAAKA
Sbjct: 541 AACFAGVSRAFTILQNEYKDGRSSSIFTDILTSEDDAVNYVGNNMDHITKKELGKRAAKA 600

Query: 601 LQSMEQFDEATSYYMPIPEIAKESNTMEEIRXXXXXXXXXXXXXXXXDMDEIITLXXXXX 660
           LQSMEQFDEATSYYMPIPEIAKESNTMEEIR                DMDEIITL     
Sbjct: 601 LQSMEQFDEATSYYMPIPEIAKESNTMEEIRPPAPEEVKESPSPPKEDMDEIITLKKIKK 660

Query: 661 XXXXXXXELGISEREIPAVDYTKTKKVLATNQXXXXXXXXXXXXPYAASNHSSDAPRAPK 720
                  ELGISEREIPAVDYTKTKKVLATNQ            PYAASNHSSDAPRAPK
Sbjct: 661 QKSQSPKELGISEREIPAVDYTKTKKVLATNQDKNKDKKKRKFDPYAASNHSSDAPRAPK 720

Query: 721 KRKPVNRERNVSFKR 735
           KRKPVNRERNVSFKR
Sbjct: 721 KRKPVNRERNVSFKR 735

>NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {ON}
           Anc_6.25 YOR001W
          Length = 755

 Score =  749 bits (1934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/752 (51%), Positives = 501/752 (66%), Gaps = 25/752 (3%)

Query: 5   EEDQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSIDQNS 64
           +E  LL KVV+T+RA+SALAAQDVDF+RS+ + I  SL+++S ++  +INS+L SID+NS
Sbjct: 8   QEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVLLSIDENS 67

Query: 65  EPLVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKLKFLDNSSSNDSI 124
           E +   KE L + WKDF N+MDNLFE SD S DI+TR  G       ++++D  S  D  
Sbjct: 68  EQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDEFSGRDLT 127

Query: 125 PSKRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPLIS--DIVPGNDAVPEHYAQPYE 182
           P K+I KPQL F  P++NTE  PF+PLLKEKPFAL+PL     ++P ++  P HY QPYE
Sbjct: 128 PGKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPMHYPQPYE 187

Query: 183 YEIEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDLEHHDY 242
           YEI+HQEY + ++ K +PIPS  W   E +WVD +  L++++ DL++ TEIAVDLEHHDY
Sbjct: 188 YEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAVDLEHHDY 247

Query: 243 RSYYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIWLQRDL 302
           R+YYGI CLMQISTR+ DYLIDT+ALR+DLQILN VFANP I KVFHGAFMDIIWLQRDL
Sbjct: 248 RTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDIIWLQRDL 307

Query: 303 GLYVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMNAYARA 362
           GLYVV LFDTFHASRA+GLP+HSLAYLLEKFA FKTSKKYQLADWR+RPLSKAM+AYARA
Sbjct: 308 GLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKAMHAYARA 367

Query: 363 DTHFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRP--IAPSPTVYCPIDKP 420
           DTHFLLNI+DQ+RN+LIEQNKLAGVL ESRNVAKRRFEYS FRP  +  +  VY PI+K 
Sbjct: 368 DTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLVYSPIEKD 427

Query: 421 DPWKVLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTEPIN 480
           DPWK +MFQY+I P +E L+K+LY WRD IARRDDESPR+VMPNQLLV L    P +   
Sbjct: 428 DPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAYTPIDAPG 487

Query: 481 VISVNSIVTDHVRSNSLVLAHLIKNTLAS-------SDKESDKGTFEADNNSTDAASLLT 533
           V+SV++ VTD+VRSNS +LA+LIKN LA         +  +++G         D +  LT
Sbjct: 488 VVSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDNNVAEEGISVVPETGHDLSQKLT 547

Query: 534 VPQIQKLAACFAGVSRAF-TILQNEYKDGRSSSIFTDILTSEDDAVNYVGNNMDHITKKE 592
           + Q+Q L + F  +S  F   ++    +     +F  I  ++D  + Y  +     T ++
Sbjct: 548 IHQLQNLKSKFQLLSDKFNNSVKTRLSNHDQLYLFDGISFADDVTIKYFADGKIQTTAEQ 607

Query: 593 LGKRAAKALQSMEQFDEATSYYMPIPEIAKESNTMEEI----RXXXXXXXXXXXXXXXXD 648
             +R+ +   +M+Q +E   Y +P+ E  K++   + I                     D
Sbjct: 608 YKERSEQFDDAMKQLEEV-EYCIPVIEENKQTQDQDNIPPITVATNAEGQVNEMIEKPED 666

Query: 649 MDEIITLXXXXXXXXXXXXELGISEREIPAVDYTKTKKVLATNQXXXXXXXXXXXX---- 704
           +DE+I L                 E E+  +DY KT KVL  ++                
Sbjct: 667 LDEVIVLRKTNKNKSIKNKPKNREEPELEIIDYFKTAKVLTNDKNSRGGRNNNGNKRKRF 726

Query: 705 -PYAASNHSSDAPRAPKKRKPVNRERNVSFKR 735
            PY+A+N   + P APKKRK V R +NVSFKR
Sbjct: 727 DPYSAAN---EGPAAPKKRKNVTRGKNVSFKR 755

>KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  740 bits (1911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/744 (50%), Positives = 507/744 (68%), Gaps = 27/744 (3%)

Query: 5   EEDQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSIDQNS 64
           E+ +LL  VV+T+RASS LAAQDVDF+RSL   +  S++E +  +  ++NS++ SID+N 
Sbjct: 5   EQKKLLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSIDENY 64

Query: 65  EPLVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKLKFLDNSSSNDSI 124
           E L EGKE L E WK  SN++DNLFE SD S DIL      +      ++ +N+++ ++I
Sbjct: 65  ETLDEGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATTTENI 124

Query: 125 PSKRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPL--ISDIVPGNDAVPEHYAQPYE 182
           P KRI+KPQL F  P++N+E  PF+PLLKEKP AL+ +   + ++  ++ VPEHYA PYE
Sbjct: 125 PQKRINKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYAHPYE 184

Query: 183 YEIEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDLEHHDY 242
           YEI++Q Y +S++   EPIPSK W  TE +WVDN+E L  M++D+K  TEIA+DLEHHDY
Sbjct: 185 YEIDNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLEHHDY 244

Query: 243 RSYYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIWLQRDL 302
           R+YYGIVCLMQISTRE DYL+DTIALR+DL++LNEVF +P ++KV HGAFMDIIWLQRDL
Sbjct: 245 RTYYGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWLQRDL 304

Query: 303 GLYVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMNAYARA 362
           GLY+VSLFDTFHASRA+G PRHSLAYLLE+FANFKTSKKYQLADWR+RPLSKAM AYARA
Sbjct: 305 GLYIVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTAYARA 364

Query: 363 DTHFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCPIDKPDP 422
           DTHFLLNIYDQLRN L+E NKL GVL ESRNVAKRRFEYSKFRP  PSP VY  ++K DP
Sbjct: 365 DTHFLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALEKEDP 424

Query: 423 WKVLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTEPINVI 482
           W+ LMFQY+I   RE+L+K L++WRD IARRDDESPRY+MPNQL+V L    PT+P  VI
Sbjct: 425 WRTLMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDPAGVI 484

Query: 483 SVNSIVTDHVRSNSLVLAHLIKNTLASSDKESDKGTFEADNNSTD---AASLLTVPQIQK 539
           S + +VTD+VRSNS ++A+LIKN L  +  ++ +  F ADN++ +   +   +TV QI++
Sbjct: 485 SASQVVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVADNHTRESYRSTDKMTVSQIKE 544

Query: 540 LAACFAGVSRAFTILQNEYKDGRS--SSIFTDILTSEDDAVNYVGNNMDHITKKELGKRA 597
            A+ F  ++       N+ +  +S   S +   L+ + D + Y       + +++L  R 
Sbjct: 545 TASVFIQIAEKLGTCNNDQQQSKSFARSNYFGSLSKKLDIIEYKNGEKHSVKQQQLVSRF 604

Query: 598 AKALQSMEQFDEATS--YYMPI----PEIAKESNTMEEIRXXXXXXXXXXXXXXXXDMDE 651
               +   Q +E T+  Y +P+    P++ K+   +EE++                D+DE
Sbjct: 605 NTYTK---QVNELTNVRYELPVHKEPPQLQKDD--VEEVK--KTIIADSIPAKPEIDLDE 657

Query: 652 IITLXXXXXXXXXXXXELGISEREIPAVDYTKTKKVL-ATNQXXXXXXXXXXXXPYAASN 710
           ++ L            E      +I  +DY+K++K+L    Q            P+AASN
Sbjct: 658 VVVLKKVNRQPNKTKLE---ENEKIDFIDYSKSEKILKGDKQRKKRESKKRQFDPFAASN 714

Query: 711 HSSDAPRAPKKRKPVNRERNVSFK 734
              + P+A +KRK   R RN+S+K
Sbjct: 715 ---EGPKAARKRKSGTRGRNLSYK 735

>ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 741

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/749 (55%), Positives = 515/749 (68%), Gaps = 26/749 (3%)

Query: 4   AEE--DQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSID 61
           AEE  +QLL KVV T+RA++ALAAQDVDF+RSL + + KSLD+TS  +VS+INS L  ID
Sbjct: 2   AEESNEQLLPKVVGTVRAAAALAAQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCID 61

Query: 62  QNSEPLVEGKETLNEYWKDFSNMMDNLFELSDCSADIL-TRAPGSRKDGEKLKFLDNSSS 120
           QNS  L  GKE L +  KDFSN+MDNLFE SD S DIL  RAP  +  G  L +LD+++ 
Sbjct: 62  QNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDILRGRAPDRK--GAALMYLDDAAR 119

Query: 121 NDSIPSKRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPLISD---IVPGNDAVPEHY 177
           +D IP+KRI KPQ+ F+ P++NTE  PF PLL+ KP ALRPL SD   +V  ++ +PEHY
Sbjct: 120 SDMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPL-SDCVRLVQADEDIPEHY 178

Query: 178 AQPYEYEIEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDL 237
            QPYEYEIE+QEY ES++  +EPIPSKPW+ +E +WVDN E L +M+ DLK  TEIAVDL
Sbjct: 179 PQPYEYEIENQEYNESILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDL 238

Query: 238 EHHDYRSYYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIW 297
           EHHDYRSYYGIVCLMQ+STR+ DYL+DT+ALRDDL +LNEVFANP I+KVFHGAFMDIIW
Sbjct: 239 EHHDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIW 298

Query: 298 LQRDLGLYVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMN 357
           LQRDLGLY+VSLFDT+HASRA+G PRHSLAYLLE FA+FKTSKKYQLADWR+RPLSKAM+
Sbjct: 299 LQRDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMS 358

Query: 358 AYARADTHFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCPI 417
           AYARADTHFLLNIYDQLRN LI +NKLAGVLAESRNVAKR F+YSK+RP  P+ +VY P+
Sbjct: 359 AYARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPV 418

Query: 418 DKPDPWKVLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTE 477
           D+ D WKVLM QY+I   +E LVK LY+WRDTIARRDDESPRYVMPNQLL  L    P +
Sbjct: 419 DRADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLD 478

Query: 478 PINVISVNSIVTDHVRSNSLVLAHLIKNTLAS-SDKESD-KGTFEADNNSTDAASLLTVP 535
           P  VISV+  VTDHVR+N+  LA+LI  +L   +D  SD K       +  D + +LTV 
Sbjct: 479 PTGVISVSPTVTDHVRTNAKALANLIVKSLQQIADAGSDIKVESVQHKDQHDLSQVLTVG 538

Query: 536 QIQKLAACFAGVSRAFTILQNEYKDGRSSS--IFTDILTSEDDAVNYVGNNMDHITKKEL 593
           QI+   + F  +S+AF  L        SSS  IF +IL +    V Y  +    +T K++
Sbjct: 539 QIESQVSQFHDLSKAFKGLSQGTNSSNSSSSIIFGNILHAPCGFVGYGRSLKKPVTDKQI 598

Query: 594 GKRAAKALQSMEQFDEATSYYMPIPEIAKESNTMEE-------IRXXXXXXXXXXXXXXX 646
            KR  +  +++E  D  T+    I E  + S    E                        
Sbjct: 599 EKRKLELSEALEFIDAETA--TTIQEEDRGSELTHEPADDKKVSENDESKKEEAKETEPE 656

Query: 647 XDMDEIITLXXXXXXXXXXXXELGISEREIPAVDYTKTKKVLATNQXXXXXXXXXXXXPY 706
            D +EIITL                SE E P +DY K+KK+L T +            PY
Sbjct: 657 EDKNEIITLKKVKDRGKKSKRS-NESEPEEP-IDYKKSKKILETEKKSKSTKKRAFD-PY 713

Query: 707 AASNHSSDAPRAPKKRKPVNRERNVSFKR 735
           AASN + +AP+ PKK++ + R ++ SFKR
Sbjct: 714 AASNDAGNAPK-PKKKRRMARGKSASFKR 741

>Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {ON}
           complement(68981..71221) [2241 nt, 747 aa]
          Length = 746

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/747 (50%), Positives = 506/747 (67%), Gaps = 27/747 (3%)

Query: 8   QLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSIDQNSEPL 67
           +LL  VV T+RA+S+LAAQDVDF+R+L + I  SL+E+S  + ++IN+LL SI++N+E L
Sbjct: 8   ELLSSVVSTVRAASSLAAQDVDFYRNLDKEISTSLNESSKEITNMINTLLLSINENNEEL 67

Query: 68  VEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKLKFLDNSSSNDSIPSK 127
             GKE L +YWKDFSN+MDNLFE SD S DI+TR+  S  +  + ++L +S+ +DS PSK
Sbjct: 68  ESGKEGLEQYWKDFSNVMDNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQSDSNPSK 127

Query: 128 RISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPLISD--IVPGNDAVPEHYAQPYEYEI 185
           R++KPQL F  PV+N+E +PF+PLL +KP +++       I+P ++ +P HYA PYE EI
Sbjct: 128 RVTKPQLQFSRPVDNSESKPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYAHPYEVEI 187

Query: 186 EHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDLEHHDYRSY 245
           + QEY  SV+  +EP+ S+PW  +E+ WVD  E L++M+  LK  TEIAVDLEHHDYRSY
Sbjct: 188 DKQEYNASVLQVAEPLKSQPW-NSESTWVDTSEALQSMLDKLKECTEIAVDLEHHDYRSY 246

Query: 246 YGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIWLQRDLGLY 305
           YGIVCLMQISTR+ D+L+DT+ALRD+L ILNEVFA+P ILKV HGAFMDIIWLQRDLGLY
Sbjct: 247 YGIVCLMQISTRKEDFLVDTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQRDLGLY 306

Query: 306 VVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMNAYARADTH 365
           VVSLFDT+HASRA+G PRHSLAYLLEK+ANFKTSKKYQLADWR+RPLSK M+AYARADTH
Sbjct: 307 VVSLFDTYHASRALGFPRHSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAYARADTH 366

Query: 366 FLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCPIDKPDPWKV 425
           FLLNIYDQ+RN LI +NKLA VL ESRNVAKRRFEYS+FRP  PSP V+ PI+K +PW+ 
Sbjct: 367 FLLNIYDQIRNQLIRENKLAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIEKEEPWRT 426

Query: 426 LMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTEPINVISVN 485
           L++QY++   + EL+K++++WRD IARRDDESPRY+MPNQL++ L    P +P  VISV+
Sbjct: 427 LVYQYNVPSTKIELLKRIWEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPAGVISVS 486

Query: 486 SIVTDHVRSNSLVLAHLIKNTLASSDKESDKGTFEADNN------STDAASLLTVPQIQK 539
           +++TDHVRSNS V+A+LIK +L    K    G   A  N         A+  LT+ QIQ 
Sbjct: 487 NVMTDHVRSNSKVIANLIKKSLEDM-KSVPAGALTAFQNIDYKIGQKFASDKLTISQIQN 545

Query: 540 LAACFAGVSRAFTILQNEYKDGRSSSIFTDILTSEDDAVNYVGNNMDHITKKELGKRAAK 599
           + A F  ++   +I++ +        +F++I  S+++ V Y  +    +T ++L  RA +
Sbjct: 546 MTALFKEIASNPSIIEKDVSKKIDPILFSNIFLSKNEIVLYDHDKRHVVTNEQLAGRAEE 605

Query: 600 ALQSMEQFDEAT---------SYYMPIPEIAKESNTMEEIRXXXXXXXXXXXXXXXXDMD 650
               M + +  T           ++  PE AKE N +                    DM+
Sbjct: 606 VEGFMNEANNTTLAINIESSAEMHVEEPE-AKEKNALFSPPISNVENASSSNTDGFEDMN 664

Query: 651 EIITLX--XXXXXXXXXXXELGISEREIPAVDYTKTKKVLATNQXXXXXXXXXXXXPYAA 708
           +II L              + G+  +E+  +DY+K   +L+  +            P+  
Sbjct: 665 DIIVLKDVKKRTNIKDHKKKQGMPNKEV--IDYSKLDTILS--KEKRENSKKRKGDPFGE 720

Query: 709 SNHSSDAPRAPKKRKPVNRERNVSFKR 735
            N   + P+A KKRK +NR +NVSFKR
Sbjct: 721 EN-GLEGPKAAKKRKQINRGKNVSFKR 746

>Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001W
           (REAL)
          Length = 745

 Score =  722 bits (1863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/747 (51%), Positives = 498/747 (66%), Gaps = 32/747 (4%)

Query: 1   MPPAEEDQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSI 60
           M     D LL KVV+ IRA+S+LAAQDVDF+R+L R   K L   S+++  ++N ++ SI
Sbjct: 19  MASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSI 78

Query: 61  DQNSEPLVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKLKFLDNSSS 120
           D++ + L   +E +++ WKDF N+MDNL E SD S D L R   S      L++L + S 
Sbjct: 79  DEHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFSG 138

Query: 121 NDSIPSKRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPLISD---IVPGNDAVPEHY 177
            DS P+KR+ KPQL FK P++N+E  PF+PLLKEKP AL+PL SD   ++   +  P HY
Sbjct: 139 KDSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPL-SDSLRMIETEENSPGHY 197

Query: 178 AQPYEYEIEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDL 237
             PYEYEI+HQEY  +++     IPSKPW+ +E +W+++   LK+M+ DLK+  EIAVDL
Sbjct: 198 PHPYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDL 257

Query: 238 EHHDYRSYYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIW 297
           EHHDYRSYYG+VCLMQ+STRERDYL+DT+ LR+DL ILNEVF NP I+KVFHGAFMDIIW
Sbjct: 258 EHHDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIW 317

Query: 298 LQRDLGLYVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMN 357
           LQRDLGLYVV LFDT+HAS+AIGLPRHSLAYLLE FANFKTSKKYQLADWR+RPLSK M 
Sbjct: 318 LQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMT 377

Query: 358 AYARADTHFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCPI 417
           AYARADTHFLLNIYDQLRN LIE NKLAGVL ESRNVAKRRFEYSK+RPI PS  VY P 
Sbjct: 378 AYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPT 437

Query: 418 DKPDPWKVLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTE 477
           +K +PW+VLM+QY+I+P REELVK LY+WRD IARRDDESPR++MPNQLL  L    P +
Sbjct: 438 EKENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPID 497

Query: 478 PINVISVNSIVTDHVRSNSLVLAHLIKNTLASSDKESDKGTFEADNNSTDAASL--LTVP 535
            I V+S+++ VTDHVR N+ +LA+LIK+ L S  K++ K + E  ++   +ASL  +TV 
Sbjct: 498 VIGVVSLSNGVTDHVRQNAKILANLIKSALRSM-KDTHKESAEIVSSKFKSASLEAITVS 556

Query: 536 QIQKLAACFAGVSRAFTILQNEYKDGRSSSI-FTDILTSEDDAVNYVGNNMDHITK---- 590
           QI+ +   F+  S + ++ ++   D  +SSI F  IL  E+  + Y  + + H  K    
Sbjct: 557 QIRDIMDRFSVFS-SNSVTEDRSMDSTASSILFGKILPYEEGDIVYEDSGLPHKVKVEDM 615

Query: 591 KELGKRAAKALQSME--QFDEATSYYMPIPEIAKESNTMEEIRXXXXXXXXXXXXXXXXD 648
           ++  +R   AL  +E  +F+      +   E+ K   T E                   D
Sbjct: 616 RDRAQRFNSALVGLEDIKFEVEKPVNVEKSEMVKIETTPE-------------PPTKIED 662

Query: 649 MDEIITLXXXXXXXXXXXXELGISEREIPAVDYTKTKKVLATNQXXXXXXXXXXXXPYAA 708
            DE++ L               ++  E  AVDY+K   VL++               +  
Sbjct: 663 PDEVVVLKKKRIHKKQVAKRSDVAAEE--AVDYSKIPNVLSSKPGQNNKQQRKRR--FDP 718

Query: 709 SNHSSDAPRAPKKRKPVNRERNVSFKR 735
           S + S+ PRAPKK++P  R +NVSFKR
Sbjct: 719 SFNDSEGPRAPKKKRPTTRGKNVSFKR 745

>TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON}
           Anc_6.25 YOR001W
          Length = 743

 Score =  715 bits (1846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/745 (50%), Positives = 502/745 (67%), Gaps = 21/745 (2%)

Query: 7   DQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSIDQNSEP 66
           D+LL  VV ++RA+SALAAQDVDF+RSL + I  SL  TS ++  +INS++SS+D+NSE 
Sbjct: 4   DELLPLVVSSVRAASALAAQDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEG 63

Query: 67  LVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKLKFLDNSSSNDSIPS 126
           LVEGKE L+E WKD  N++D+LFEL+D S D L++A     +  K+K+L++S + +S   
Sbjct: 64  LVEGKENLDESWKDIGNLLDSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESDNV 123

Query: 127 KRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPL--ISDIVPGNDAVPEHYAQPYEYE 184
            R+SKPQLNF  PV+N+E  PF PLL +KP A+ PL  +  IV G +  P+HY QPYE E
Sbjct: 124 TRLSKPQLNFSVPVDNSETHPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYETE 183

Query: 185 IEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDLEHHDYRS 244
           I+ QEY E V+  S+PIPSK WE TEA+WVDN E L  M+++LK+ TE+AVDLEHHD+RS
Sbjct: 184 IDKQEYNEQVLQFSDPIPSKVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFRS 243

Query: 245 YYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIWLQRDLGL 304
           YYGI CLMQISTR  DYL+DTIALRD LQ+LN VF +PKI K+ HGAFMDIIWLQRDLGL
Sbjct: 244 YYGITCLMQISTRNTDYLVDTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLGL 303

Query: 305 YVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMNAYARADT 364
           Y+VSLFDT+HASRA+G PRHSLAYLLE+FA+FKTSK+YQLADWR RPLSKAMNAYARADT
Sbjct: 304 YIVSLFDTYHASRALGFPRHSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARADT 363

Query: 365 HFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCPIDKPDPWK 424
           HFLLNI+DQLRN LI+++KLA +L ESR VAKRRFEYSK++P  PS  V+ P +   PW+
Sbjct: 364 HFLLNIFDQLRNMLIQEDKLASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMPWR 423

Query: 425 VLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTEPINVISV 484
            +++QY+I   + ELVK+L++WRDTIARRDDESPRY+MPNQL+  L    PT P  VISV
Sbjct: 424 SMIYQYNIPSQKVELVKRLWEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVISV 483

Query: 485 NSIVTDHVRSNSLVLAHLIKNTLASSDKESDKGTFEADNNSTD---AASLLTVPQIQKLA 541
           N ++TD VRSN+  +A+LIK+TL    K ++  T      + D   +++ L+  QI+ + 
Sbjct: 484 NRMMTDPVRSNAKAIANLIKSTLEDM-KNNNISTTVVSTTAKDKETSSNDLSTSQIKFIV 542

Query: 542 ACFAGVSRAFTILQNEY-----KDGRSSSIFTDILTSEDDAVNYVGNNMDHITKKELGKR 596
           + F  +   ++   +       K+G+ S +F+ I  S DD + Y       IT+++L  R
Sbjct: 543 SQFENILEKYSSNNSNLNDVTSKEGKDSLVFSKIFNSRDDIITYDKGTKHLITEQQLSDR 602

Query: 597 AAKALQSMEQFDEATSYYMPIPEIAKESNTM-----EEIRXXXXXXXXXXXXXXXXDMDE 651
             +   +M+Q +E  ++ M + +  KES        EE+                 D+DE
Sbjct: 603 QKEVDAAMKQAEE-IAFSMEVQDTHKESMKQPFPEPEEV-ISQSHLPAFEDKEEQEDLDE 660

Query: 652 IITLXXXXXXXXXXXXELGIS-EREIPAVDYTKTKKVLATNQXXXXXXXXXXXXPYAASN 710
           II L              G S + +   +DY+K  K+L+ +             P++A N
Sbjct: 661 IIVLKDTKDRRNRQHRGRGRSADSDHTVIDYSKGDKILSQDN-RRRTPNKRKYDPFSADN 719

Query: 711 HSSDAPRAPKKRKPVNRERNVSFKR 735
           +  +A +  K+R+P  + RNVSFKR
Sbjct: 720 N-ENALQGAKRRRPTAKNRNVSFKR 743

>KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {ON}
           Anc_6.25 YOR001W
          Length = 738

 Score =  714 bits (1843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/744 (49%), Positives = 485/744 (65%), Gaps = 15/744 (2%)

Query: 1   MPPAEEDQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSI 60
           M   E+ +LL K V T+RASS+L  QDV F  +L   +  S+ E    ++ +IN +L SI
Sbjct: 1   MDSEEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSI 60

Query: 61  DQNSEPLVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGE---KLKFLDN 117
           D+NS+P  E  E + E W+DF+N+ DNLFE SD S DI+  A G+RK+G+   ++++LD+
Sbjct: 61  DENSKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDII--AQGTRKNGQAGSEVQYLDD 118

Query: 118 SSSNDSIPSKRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPLISDI--VPGNDAVPE 175
              NDS   KRI+KPQL+F  PV+N+E QPF PLL EKP AL+PL   +  VP  + +P 
Sbjct: 119 LVGNDSSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPS 178

Query: 176 HYAQPYEYEIEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAV 235
           HY  PY+YEI +QEY   ++    PIPS PW  +E +WVD+ E L++++ DLK   E+A+
Sbjct: 179 HYPNPYDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAI 238

Query: 236 DLEHHDYRSYYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDI 295
           DLEHHDYRSYYGIVCLMQISTR+ DYL+DTIALRD+L ILN+VF +P + KVFHGAFMDI
Sbjct: 239 DLEHHDYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDI 298

Query: 296 IWLQRDLGLYVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKA 355
           IWLQRDLGLY+VSLFDTFHAS+A+G P+HSLAYLLE  ANFKTSKKYQLADWR+RPLSK 
Sbjct: 299 IWLQRDLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKP 358

Query: 356 MNAYARADTHFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYC 415
           M+ YARADTHFLLNI+DQ+RN LI+ NKLAGVL ESR VAKRRFEYSKFRP    P V+ 
Sbjct: 359 MSVYARADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFT 418

Query: 416 PIDKPDPWKVLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAP 475
           PI+K  PW+ LMFQY+++P +EELVK LY+WRDTIARRDDESPRY+MPNQLL+ L+   P
Sbjct: 419 PIEKESPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTP 478

Query: 476 TEPINVISVNSIVTDHVRSNSLVLAHLIKNTLASSDKESDKGTFEADNNSTDAASLLTVP 535
           T+P++++SVNS VTD VRSNS VLA+LIK+ + SS K   + ++  +  +T    +LT+ 
Sbjct: 479 TDPVSLVSVNSYVTDCVRSNSKVLANLIKSFVESS-KLGPQSSYTPNTENTSTPFVLTLS 537

Query: 536 QIQKLAACFAGVSRAFTILQNEYKDGRSSSIFTDILTSEDDAVNYVGNNMDHITKKELGK 595
           QI+ +   F  ++  F     +       S F   L+     V+Y       +++  L  
Sbjct: 538 QIKDIGMRFTKLTENFQSSSCQKISPLQRSSFFGDLSKGKVTVSYNDAKTTPVSQSVLES 597

Query: 596 RAAKALQSMEQFDEAT----SYYMPIPEIAKESNTMEEIRXXXXXXXXXXXXXXXXDMDE 651
           R+ +  + M+ F +      S   P+ ++   S T                     DMDE
Sbjct: 598 RSKQFNEYMKAFGDIEYKIPSIVEPVMDLPIPSGTT-STESADSKTVEKPPKNIKEDMDE 656

Query: 652 IITLXXXXXXXXXXXXELGISEREIPAVDYTKTKKVLATNQXXXXXXXXXXXXPYAASNH 711
           I+ L                +EREI  VDY+K  KVL   Q             +   + 
Sbjct: 657 IVVLKKVKRELPKPKGNDEDAEREI--VDYSKEDKVLVQRQFDKKKKNNNNKKRFDPFSA 714

Query: 712 SSDAPRAPKKRKPVNRERNVSFKR 735
            S+ P+APKKRK V + +N SFKR
Sbjct: 715 ISEGPKAPKKRKAVTKGKNASFKR 738

>NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {ON}
           Anc_6.25 YOR001W
          Length = 790

 Score =  714 bits (1844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/771 (50%), Positives = 501/771 (64%), Gaps = 46/771 (5%)

Query: 6   EDQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSIDQNSE 65
           +DQLL +VV T+RAS ALAAQDVDF+RS+ +   K+L ET++++  +INS+L ++D+NSE
Sbjct: 25  KDQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSE 84

Query: 66  PLVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKLKFLDNSSSNDSIP 125
            L   KE L + WKDFSN+MDNL E SD S D+L R+  +  +   +++LD  S  D   
Sbjct: 85  TLDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEYSGRDDTS 144

Query: 126 SKR--ISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPLISDI--VPGNDAVPEHYAQPY 181
           SKR  I KPQL F  PV+NTE  PF+PLLK KP AL+ L   I  +P ++ VPEHYAQPY
Sbjct: 145 SKRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQPY 204

Query: 182 EYEIEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDLEHHD 241
           EYEI++Q Y + ++  S+PIPS+PW  T A+WVD  E L++MI DL + TE AVDLEHHD
Sbjct: 205 EYEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEHHD 264

Query: 242 YRSYYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIWLQRD 301
           YR+YYGIVCLMQISTR +DY++DT+ LR  LQ LNE F NP+I KV HGAFMDIIWLQRD
Sbjct: 265 YRTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQRD 324

Query: 302 LGLYVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMNAYAR 361
           LGLY+VSLFDTFHASRA+G P++SLAYLLEKF+NFKTSKKYQ+ADWR+RPLSKAMN+YAR
Sbjct: 325 LGLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYAR 384

Query: 362 ADTHFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCPIDKPD 421
           +DTHFLLNI+DQ+RN L++  KLAGVL ESRNVAKRRFEY K+RP+  S  VY PI+K D
Sbjct: 385 SDTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEKID 444

Query: 422 PWKVLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTEPINV 481
           PWK LM+QY+I   +E L+K+LY WRD IARRDDESPRY+MPNQLLV L   AP EP  V
Sbjct: 445 PWKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPAGV 504

Query: 482 ISVNSIVTDHVRSNSLVLAHLIKNTLASSDKESDK------------GTFEADNNSTDAA 529
           +SV+++VTDHVRSNS +LA+LIKN L      +D             GT     N  D +
Sbjct: 505 VSVSNMVTDHVRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTN-VDLS 563

Query: 530 SLLTVPQIQKLAACFAGVSRAFTILQNEYKDGRSSS------IFTDILT-SEDDAVNYVG 582
             L++ Q+  L + F  +      ++    + R++       + TD ++ +++D  N++ 
Sbjct: 564 EQLSIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEKKNSFLLCTDHMSFNDEDGKNFIK 623

Query: 583 -----NNMDHITKKELGKRAAKALQSMEQFDEATSYYMPIPE---IAKESNTME-EIRXX 633
                +  D IT +EL KR     Q+MEQ  +   Y +PIPE   +  ES   E  I   
Sbjct: 624 YSVSPDKKDKITTEELLKREEMFDQAMEQL-QQVEYSIPIPENEIVVVESEQQEPSIPAA 682

Query: 634 XXXXXXXXXXXXXXDMDEIITLXXXXXXXXXXXXELGI---SEREIPAVDYTKTKKVLAT 690
                         D+DEII L                    E EI  +DY+K +KVL  
Sbjct: 683 NAEITTAVASRKKEDLDEIIVLKKTNRNKGKKRERKHSDDDDEGEIEVIDYSKMEKVLDN 742

Query: 691 NQXXXXXXXXXXXX------PYAASNHSSDAPRAPKKRKPVNRERNVSFKR 735
           +                   PY  +N   + PRAPKKRK + R +NVSFKR
Sbjct: 743 SNTKRNQNKNNNGNKRKRFDPYNVNN---EGPRAPKKRKAMTRGKNVSFKR 790

>SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 737

 Score =  693 bits (1789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/743 (49%), Positives = 501/743 (67%), Gaps = 16/743 (2%)

Query: 1   MPPAEEDQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSI 60
           M   + D+LL  +V T+RA+SAL+AQD+DF +SL   I KS++ +S+++++LIN +L SI
Sbjct: 1   MSSDKPDKLLSNLVGTVRAASALSAQDLDFFKSLDSGISKSVEGSSSKLLNLINEVLLSI 60

Query: 61  DQNSEPLVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKLKFLDNSSS 120
           D+N++ +  GK+   E WKD  ++MDNLFE SD + D L R   ++ +   +++LD+SS 
Sbjct: 61  DENNDTIEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKRNSINQGNS-NVQYLDDSSR 119

Query: 121 NDSIPSKRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPL--ISDIVPGNDAVPEHYA 178
           ++  PSKRI KPQLNFK P++NTE  PF PLL+ KP ALRPL  I    P  + +P HY 
Sbjct: 120 SNLNPSKRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYP 179

Query: 179 QPYEYEIEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDLE 238
            PY YEI+ QEY ES++   +PIPS+PWE T+ +WVD  E L+ ++++L+S  EIAVDLE
Sbjct: 180 HPYGYEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLE 239

Query: 239 HHDYRSYYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIWL 298
           HHDYRSYYGIVCLMQISTRERD+L+DTIALR++L +LNE+F +P +LKVFHGAFMDIIWL
Sbjct: 240 HHDYRSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWL 299

Query: 299 QRDLGLYVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMNA 358
           QRDLG+YVVSLFDT+HASR++GLPRHSLAYLLEKFA FKTSKKYQLADWR+RPL+K M A
Sbjct: 300 QRDLGIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRA 359

Query: 359 YARADTHFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCPID 418
           YARADTHFLLNIYDQLRN+LIEQNKLA VL +SRNVAKRRFEY+ FRP   S  V+ PI+
Sbjct: 360 YARADTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIE 419

Query: 419 KPDPWKVLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTEP 478
           K +PW+ LM+QY+I  +RE L++KLY+WRDTIARRDDESPRYVMPNQLLV L   APT+P
Sbjct: 420 KDEPWRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDP 479

Query: 479 INVISVNSIVTDHVRSNSLVLAHLIKNTLASSDKESDKGTFEADNNS---TDAASLLTVP 535
             V+SV++ +TD+VRSNS +L++LIK TL S  K  D  T  A ++     D + +L++ 
Sbjct: 480 AGVLSVSNFITDYVRSNSKMLSNLIKKTLESL-KNGDVSTNNAGSSQLEEKDLSQVLSIS 538

Query: 536 QIQKLAACFAGVSRAFTILQNEYKDGRSSSIF--TDILTSEDDAVNYVGNNMDHITKKEL 593
           QIQ +   F  ++       +        SI    D + S D AV Y  N+   I + +L
Sbjct: 539 QIQNMCLQFNSLASKVKKANSATNSMPKVSILFDGDHIFSNDRAVLYSKNSKIVIDENQL 598

Query: 594 GKRAAKALQSMEQFDEATSYYMPIPEIAKESNTM-EEIRXXXXXXXXXXXXXXXXDMDEI 652
            +R  +  + +++  E   + + +    KE++ + +++                 + DEI
Sbjct: 599 QERKLEVSEKLKEVQEP-DFRLHVNVTTKETDEVSKDVSEKDDVNRASETDPLETNKDEI 657

Query: 653 ITLXXXXXXXXXXXXELGISEREIPAVDYTKTKKVLATNQXXXXXXXXXXX-XPYAASNH 711
           I L            ++G S  ++  +DY   +K+L  ++             PY + N 
Sbjct: 658 IVLKKKKRHEPQDRKKVGNST-DVEPMDYKNAEKLLGNSKKSSKQKTTKRRFDPYTSENV 716

Query: 712 SSDAPRAPKKRKPVNRERNVSFK 734
               P++ KKRK     +N+SFK
Sbjct: 717 ---GPQSAKKRKKPTPGKNMSFK 736

>Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001W
           (REAL)
          Length = 773

 Score =  691 bits (1784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/742 (49%), Positives = 480/742 (64%), Gaps = 16/742 (2%)

Query: 1   MPPAEEDQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSI 60
           M     D LL KVV+ IRA+S+LA QDVDF+++L R  GK L   S ++  + N ++ SI
Sbjct: 41  MASQNPDVLLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSI 100

Query: 61  DQNSEPLVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKLKFLDNSSS 120
           D++ E      E ++  W DF N+MDNL E+SD S D L RA  S+ +G  L++L + S 
Sbjct: 101 DEHHESFELKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNGADLQYLGDFSE 160

Query: 121 NDSIPSKRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPLISD---IVPGNDAVPEHY 177
            +  P+KR+ KPQL FK P++N+E  PF+PLLKEKP AL+PL SD   ++  +D  P HY
Sbjct: 161 KNLSPAKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPL-SDSLRLIEEDDNTPSHY 219

Query: 178 AQPYEYEIEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDL 237
             PYEYEI+HQEYG +++   + IPSK W  +E +W+D +  L++M+ +LK+V EIAVDL
Sbjct: 220 PHPYEYEIDHQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDL 279

Query: 238 EHHDYRSYYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIW 297
           EHHDYRSYYGIVCLMQISTRE+DYL+DT+ LR+ L ILNEVF +P I+KVFHGAFMDIIW
Sbjct: 280 EHHDYRSYYGIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIW 339

Query: 298 LQRDLGLYVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMN 357
           LQRDLGLYVV LFDT+HAS+AIGLPRHSLAYLLE FANFKTSKKYQLADWR+RPLSK M 
Sbjct: 340 LQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMI 399

Query: 358 AYARADTHFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCPI 417
           AYARADTHFLLNIYDQLRN LIE NKLAGVL ESRNVAKRRFEYSK+RP  PS  VY PI
Sbjct: 400 AYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPI 459

Query: 418 DKPDPWKVLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTE 477
           +K  PW+VLM+QY+I+  +EELVK LY WRD IARRDDESPR+VMPNQLL  L    P +
Sbjct: 460 EKEAPWRVLMYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPID 519

Query: 478 PINVISVNSIVTDHVRSNSLVLAHLIKNTL---ASSDKESDKGTFEADNNSTDAASLLTV 534
            I VIS+ + +T+HVR N+ VL +LIKN+L     + KE    TF     +  +   +T+
Sbjct: 520 VIGVISLTNGITEHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFSESMTNEVSLEAITI 579

Query: 535 PQIQKLAACFAGVSRAFTILQNEYKDGRSSSIFTD-ILTSEDDAVNYVGNNMDHITKKEL 593
           PQI+ +   F+ +S +  +     K+G + SI    IL  E++ + Y  N + +  K E 
Sbjct: 580 PQIRDIMERFSVLSNS-NVSNCRAKNGATPSILLGRILPLEENDIAYKNNGLPNRVKFED 638

Query: 594 GKRAAKALQSMEQFDEATSYYMPIPEIAKESNTMEEIRXXXXXXXXXXXXXXXXDMDEII 653
            +  A++  S     E     +  P I      +++I                   D ++
Sbjct: 639 IRARAQSFNSALSNLEDCMLEVEKPHIL--PTNVKKIERINTEDVPKHSATIENPDDIVV 696

Query: 654 TLXXXXXXXXXXXXELGISEREIPAVDYTKTKKVLATNQXXXXXXXXXXXXPYAASNHSS 713
                         +  + E+   A+DY+K   VL++                  ++  S
Sbjct: 697 LKKKNIHRTQSMNAKDTMGEK---AIDYSKIPNVLSSKSDQNRRQQKKRRSDPLFND--S 751

Query: 714 DAPRAPKKRKPVNRERNVSFKR 735
           D PRA KK++P  R RNVSFKR
Sbjct: 752 DGPRAAKKKRPATRGRNVSFKR 773

>KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 744

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/615 (55%), Positives = 453/615 (73%), Gaps = 10/615 (1%)

Query: 1   MPPAEEDQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSI 60
           M   ++D LL  +V T+R+SSALAAQD+DF++SL   I  SL++TST ++SLIN LL SI
Sbjct: 1   MSSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTSTNILSLINDLLLSI 60

Query: 61  DQNSEPLVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKLKFLDNSSS 120
           D N++ + +GK++  + WK  SN+MDNLFE SD + D +    G    G  LK+L++   
Sbjct: 61  DPNNDVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRAGNGGNAGGPSLKYLNDDDR 120

Query: 121 NDSIPSKRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPL-IS-DIVPGNDAVPEHYA 178
           +++ PSKRI KPQL+FK PV+NTE+ PF PLL+ KP +L+P  IS  +VP  +++P HY 
Sbjct: 121 SNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYP 180

Query: 179 QPYEYEIEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDLE 238
            PYEYEI+HQ+Y +S++V +EPIPSK W+ TEA+WVD +E L  M  +L   TE+A+DLE
Sbjct: 181 HPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLE 240

Query: 239 HHDYRSYYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIWL 298
           HHDYRSYYGIVCLMQIS RE D+++DTIALR++L ILN++F +P + KV HGAFMDIIWL
Sbjct: 241 HHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWL 300

Query: 299 QRDLGLYVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMNA 358
           QRDLGLY+V LFDT+HASR +G P+HSLAYLLE+FANFKTSKKYQLADWR+RPL+K M A
Sbjct: 301 QRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLA 360

Query: 359 YARADTHFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCPID 418
           YARADTHFLLNI+D+LRN+L+EQNK++ VL ESR VAKRRFEYS FRP  PS  V+ PI+
Sbjct: 361 YARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIE 420

Query: 419 KPDPWKVLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTEP 478
           K +PWK +MFQY+I  ++E L+++LY+WRDTIARRDDESPRYVMPNQLLV L   APTEP
Sbjct: 421 KDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEP 480

Query: 479 INVISVNSIVTDHVRSNSLVLAHLIKNTLASSDKESDKGTF----EADNNSTDAASLLTV 534
           INV+SV+S V++H+R+NS V+A+LIK TL      S+         A++N TD A+++T 
Sbjct: 481 INVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGTDLANIITT 540

Query: 535 PQIQKLAACFAGVSRAFTI--LQNEYKDGRSSSIFTDILTSE-DDAVNYVGNNMDHITKK 591
            QI+ +   F  ++       L NE ++   S +F  I   + + AV Y       I + 
Sbjct: 541 SQIKSIQNIFHSLASEINSQKLNNE-QNSEKSVLFNGISNLDVNTAVRYTPKTRTLIPQH 599

Query: 592 ELGKRAAKALQSMEQ 606
           EL KR  +  +++EQ
Sbjct: 600 ELLKRQHEITRTLEQ 614

>YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nuclear
           exosome exonuclease component; has 3'-5' exonuclease
           activity; involved in RNA processing, maturation,
           surveillance, degradation, tethering, and export; has
           similarity to E. coli RNase D and to human PM-Sc1 100
           (EXOSC10); mutant displays reduced transcription
           elongation in the G-less-based run-on (GLRO) assay
          Length = 733

 Score =  686 bits (1769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/735 (49%), Positives = 485/735 (65%), Gaps = 14/735 (1%)

Query: 7   DQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSIDQNSEP 66
           D LL +V++ +RA+S+LA+QDVDF+++L R   K L   + ++  + N ++ SID++ E 
Sbjct: 7   DVLLSRVINVVRAASSLASQDVDFYKNLDRGFSKDLKSKADKLADMANEIILSIDEHHES 66

Query: 67  LVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKLKFLDNSSSNDSIPS 126
               +E +++ W +F N+MDNL E+SD S D L  A  S+  G  L++L   S  +  P+
Sbjct: 67  FELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSGKNFSPT 126

Query: 127 KRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPLISDI--VPGNDAVPEHYAQPYEYE 184
           KR+ KPQL FK+P++N+E  PF+PLLKEKP AL+PL   +  V  ++  P HY  PYEYE
Sbjct: 127 KRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYPHPYEYE 186

Query: 185 IEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDLEHHDYRS 244
           I+HQEY   ++   E IPSK W+ +  +WVD    L++M+ DLK+  EIAVDLEHHDYRS
Sbjct: 187 IDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLEHHDYRS 246

Query: 245 YYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIWLQRDLGL 304
           YYGIVCLMQISTRERDYL+DT+ LR++L ILNEVF NP I+KVFHGAFMDIIWLQRDLGL
Sbjct: 247 YYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWLQRDLGL 306

Query: 305 YVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMNAYARADT 364
           YVV LFDT+HAS+AIGLPRHSLAYLLE FANFKTSKKYQLADWR+RPLSK M AYARADT
Sbjct: 307 YVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAYARADT 366

Query: 365 HFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCPIDKPDPWK 424
           HFLLNIYDQLRN LIE NKLAGVL ESRNVAKRRFEYSK+RP+ PS  VY PI+K  PWK
Sbjct: 367 HFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIEKESPWK 426

Query: 425 VLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTEPINVISV 484
           +LM+QY+I P RE LV++LY WRD IARRDDESPR+VMPNQLL  L    PT+ I V+S+
Sbjct: 427 ILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDVIGVVSL 486

Query: 485 NSIVTDHVRSNSLVLAHLIKNTLASSDKESDKGT-FEADNNSTDAASL--LTVPQIQKLA 541
            + VT+HVR N+ +LA+LI++ L +    +++ T   +     D   L  ++VPQI+ + 
Sbjct: 487 TNGVTEHVRQNAKLLANLIRDALRNIKNTNEEATPIPSSETKADGILLETISVPQIRDVM 546

Query: 542 ACFAGVSRAFTILQNEYKDGRSSSI-FTDILTSEDDAVNYVGNNMDHITKKELGKRAAKA 600
             F+ +  +  I ++  K   +SSI    IL  E+  + Y  + + +  K E  +  A+ 
Sbjct: 547 ERFSVLCNS-NISKSRAKPVTNSSILLGKILPREEHDIAYSKDGLPNKVKTEDIRIRAQN 605

Query: 601 LQSMEQFDEATSYYMPIPEIAKESNTMEEIRXXXXXXXXXXXXXXXXDMDEIITLXXXXX 660
            +S     E   + +  P +      +EEI+                ++D+++ L     
Sbjct: 606 FKSALANLEDIIFEIEKPLVVPVK--LEEIK-TVDPASAPNHSPEIDNLDDLVVLKKKNI 662

Query: 661 XXXXXXXELGISEREIPAVDYTKTKKVLATNQXXXXXXXXXXXXPYAASNHSSDAPRAPK 720
                  E G++E++  AVDY+K   +L+                +  S+  S+ PRA K
Sbjct: 663 QKKQPAKEKGVTEKD--AVDYSKIPNILSNKPGQNNRQQKKRR--FDPSSSDSNGPRAAK 718

Query: 721 KRKPVNRERNVSFKR 735
           KR+P  + +N+SFKR
Sbjct: 719 KRRPAAKGKNLSFKR 733

>Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001W
           (REAL)
          Length = 734

 Score =  682 bits (1759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/746 (49%), Positives = 476/746 (63%), Gaps = 23/746 (3%)

Query: 1   MPPAEEDQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSI 60
           MP    D L  K+V  +RA+S+LA+QDVDF+++L R     L   S ++  ++N ++ SI
Sbjct: 1   MPSENPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSI 60

Query: 61  DQNSEPLVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKLKFLDNSSS 120
           D++ E     ++ ++  WKDF N+MDNL E+SD S D L     S+  G +L++L + S 
Sbjct: 61  DEHHESFELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSG 120

Query: 121 NDSIPSKRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPLISDI--VPGNDAVPEHYA 178
            DS+ +KR+ KPQL FK  ++N+E  PF+PLLKEKP AL+PL   +      +  P HY 
Sbjct: 121 KDSLSTKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPLSESLRLAEAEENNPSHYL 180

Query: 179 QPYEYEIEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDLE 238
            PY YEI+HQEY   V+   + IPSK W+ +E +W+D    L  M+ DLK+ +EIAVDLE
Sbjct: 181 HPYAYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLE 240

Query: 239 HHDYRSYYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIWL 298
           HHDYRSYYGIVCLMQ+STRERDYL+DTI LRD L ILNEVF +P I+KVFHGAFMDIIWL
Sbjct: 241 HHDYRSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWL 300

Query: 299 QRDLGLYVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMNA 358
           QRDLGLYVV LFDT+HAS+AIGLPRHSLAYLLE FANFKTSKKYQLADWR RPLSK M A
Sbjct: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTA 360

Query: 359 YARADTHFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCPID 418
           YARADTHFLLNIYDQLRN LIE NKLAGVL ESRNVAKRRFEYSK RP  PS  VY PI+
Sbjct: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIE 420

Query: 419 KPDPWKVLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTEP 478
           K +PW+VLM+QY+I+  +EELVK LY WRD IARRDDESPR+VMPNQLL  L   AP + 
Sbjct: 421 KENPWRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDV 480

Query: 479 INVISVNSIVTDHVRSNSLVLAHLIKNTLASSDKESDKGT-FEADNNSTDAASL--LTVP 535
           I V+S+ + VT+HVR N+ VLA+LI+N L +    + K T   +  +  D  SL  +T+ 
Sbjct: 481 IGVVSLTNGVTEHVRQNAKVLANLIENALGNIKDTNKKTTSITSSESKPDGISLEVITIS 540

Query: 536 QIQKLAACFAGVSRAFTILQNEYKDGRSSS--IFTDILTSEDDAVNYVGNNMDHITKKE- 592
           QI+ +   F+ +S +  ++ N  K G S+S  +    L  E+  ++Y      +  K E 
Sbjct: 541 QIRDIMERFSLLSNS-GVINNRTKTGDSTSSILLGKTLPFEECGISYGKKGTPNKVKVED 599

Query: 593 LGKRAAK---ALQSMEQFDEATSYYMPIPEIAKESNTMEEIRXXXXXXXXXXXXXXXXDM 649
           +  RA K   AL  +E         + +P   ++   +E                     
Sbjct: 600 IKARAQKFNSALAGLENIMFELEKPVTVPASVEKGEAVE-------IESAPELPSKAESF 652

Query: 650 DEIITLXXXXXXXXXXXXELGISEREIPAVDYTKTKKVLATNQXXXXXXXXXXXXPYAAS 709
           D+II L               ++ +E  AVDY+K   VL++               +  S
Sbjct: 653 DDIIVLKKKKMHKKQPAKGKDMTVKE--AVDYSKMPSVLSSKPGQNRKQQRKRR--FDPS 708

Query: 710 NHSSDAPRAPKKRKPVNRERNVSFKR 735
           ++ S+ PRA KK++P  R +N+SFKR
Sbjct: 709 SNDSEGPRAAKKKRPAPRGKNMSFKR 734

>CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001w RRP6
          Length = 737

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/740 (48%), Positives = 483/740 (65%), Gaps = 20/740 (2%)

Query: 7   DQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSIDQNSEP 66
           D +L+KV++T+RAS+ALA+QDV+FH+S+   +  SL+++   M S++N++L SID N+E 
Sbjct: 7   DNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEK 66

Query: 67  LVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKLKFLDNSSSNDSIPS 126
           L    E L E  K+FSN+MD LFE +D S DIL R   +  + + ++FLD+ +  ++ PS
Sbjct: 67  LDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPS 126

Query: 127 KRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPL--ISDIVPGNDAVPEHYAQPYEYE 184
           +RISKPQLNFK PV+N+E  PF PLL EKP AL+ +   + +V   + +PEH+ QPYEYE
Sbjct: 127 RRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYEYE 186

Query: 185 IEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDLEHHDYRS 244
           I +QEY   ++ K EPIPS  W  T A+WVDNI  L+ M+ +LK  +EIAVDLEHHD+RS
Sbjct: 187 ILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEHHDFRS 246

Query: 245 YYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIWLQRDLGL 304
           YYG+VCLMQISTR +DY++DTIALRDDL++LNEVF NP I KVFHGAFMDIIWLQRDLGL
Sbjct: 247 YYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWLQRDLGL 306

Query: 305 YVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMNAYARADT 364
           Y+VSLFDTFHAS+A+GLP+HSLAYLLEK+ANFKTSKKYQLADWR RPLSKAM AYARADT
Sbjct: 307 YIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMAYARADT 366

Query: 365 HFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCPIDKPDPWK 424
           HFLLNI+DQ+RN LI   KLAGVL ESRNVA RRFEYSK++P  P   ++ P++K  PW+
Sbjct: 367 HFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVEKESPWR 426

Query: 425 VLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTEPINVISV 484
            LM+QY+I  ++E L+++LY+WRD +ARRDDESPRYVMPNQLLV L    P +PI+V+SV
Sbjct: 427 TLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDPISVVSV 486

Query: 485 NSIVTDHVRSNSLVLAHLIKNTLASSDKESDKGTFEADNN--------STDAASLLTVPQ 536
           +S+VTDHVR NS  LA+LIK  L    +E   G  ++ NN        S D    L   +
Sbjct: 487 SSVVTDHVRRNSKTLANLIKKKL----EEIKLGEVKSINNRLPSSLDVSQDELQFLPSHK 542

Query: 537 IQKLAACFAGVSRAFTILQNEYKDGRSSSIFTDILTSEDDAVNYVGNNMDHITKKELGKR 596
           I+ +   F  +    T      +   SS + ++IL   + AV Y   +   + + EL  R
Sbjct: 543 IELMTGAFKEIENQLTQATKSKQAMTSSVVLSEILLHPEHAVKYHNGSACSVEESELKDR 602

Query: 597 AAKALQSMEQFDEATSYYMPIPEIAKESNTME-EIRXXXXXXXXXXXXXXXXDMDEIITL 655
               +++      A+     + E +  +  +E E                  DMDEI+ L
Sbjct: 603 YLSYIKAT--LLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQEDMDEIVVL 660

Query: 656 XXXXXXXXXXXXELGISEREIPAVDYTKTKKVLATNQXXXXXXXXXXXXPYAASNHSSDA 715
                       +    +     VDY+K   + + N+            PY++   + + 
Sbjct: 661 KKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNREVKKKDKKRVFDPYSS---TGEG 717

Query: 716 PRAPKKRKPVNRERNVSFKR 735
           P+A KKR+ V + + +SFK+
Sbjct: 718 PKAAKKRRLVTKGKKISFKK 737

>TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6.25
           YOR001W
          Length = 771

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/742 (48%), Positives = 470/742 (63%), Gaps = 15/742 (2%)

Query: 7   DQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSIDQNSEP 66
           ++LL  +V  +RAS+ALAAQDVDF++SL + +  SL++T+   + + NSLL SID+N  P
Sbjct: 32  EELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSIDENCSP 91

Query: 67  LVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKLKFLDNSSSNDSIPS 126
           L EGK+ + ++W  FSN+MDNL E SD   D L++         +  FLDN+S  +S PS
Sbjct: 92  LEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYNETTFLDNNSRTNSNPS 151

Query: 127 KRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPLISDIV--PGNDAVPEHYAQPYEYE 184
           KRI KPQL F  PV+NT+ +PF PLL EKP AL+PL   +V  P +  VP HY QPYEYE
Sbjct: 152 KRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYLQPYEYE 211

Query: 185 IEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDLEHHDYRS 244
           I++QEY E V+   +P P KPWETT A+W+D  E L  ++ DL+  +EIAVDLEHHD RS
Sbjct: 212 IDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLEHHDLRS 271

Query: 245 YYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIWLQRDLGL 304
           YYGI CLMQISTRE+DY++DTI+LRDDL +LNE+F NP I KVFHGA MDIIWLQRDLGL
Sbjct: 272 YYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWLQRDLGL 331

Query: 305 YVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMNAYARADT 364
           Y+VSLFDTFHAS+A+GL RHSLAYLLE +A+FKTSKKYQLADWR RPL+  M AYAR+DT
Sbjct: 332 YIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLAYARSDT 391

Query: 365 HFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCPIDKPDPWK 424
           HFLLNI+DQLRNTLI+QNKLAGVL ESRNVAKRRFEY KFRP  P P +Y  I+K  PWK
Sbjct: 392 HFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLIEKEAPWK 451

Query: 425 VLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTEPINVISV 484
            L+ QY+I   +E LV+KL++WRD IARRDDESPRY+MP Q+L+ L    PT+   VISV
Sbjct: 452 SLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTDSSGVISV 511

Query: 485 NSIVTDHVRSNSLVLAHLIKNTLASS----DKESDKGTFEADNNSTDAASLLTVPQIQKL 540
           +++VT+HVRSNS  LA+LIK  L S+    +      TF      T+ ASL+++ +I  +
Sbjct: 512 SNMVTEHVRSNSTTLANLIKKALESTKSIPNSSDSSSTFNMSRTDTNVASLISITEINNI 571

Query: 541 AACFAGVSRAFTILQNEYKDGRSSS-IFTDILTSEDDAVNYVGNNMDHITKKELGKRAAK 599
              F  +S+ +   +        SS +F++I+TS     +Y  +       +++  R  +
Sbjct: 572 CLKFNSLSKHYNTSKFLTSGIEVSSLLFSNIMTSSPKISDYSKDKTTSFKSEDMIARHIR 631

Query: 600 ALQSMEQFDEATS--YYMPIPEIAKESNTMEE--IRXXXXXXXXXXXXXXXXDMDEIITL 655
             + ++      S  Y  P+ +I     T E                     D +EII L
Sbjct: 632 LSEGLKGLSANNSFIYQPPVEDIKSIEITTENPIPTLEPKSTQKKTTKEINEDNEEIIVL 691

Query: 656 XXXXXXXXXXXXELGISEREIPAVDYTKTKKVLATNQXXXXXXXXXXXX--PYAASNHSS 713
                       +    +     VDY+K KK+                   PY     + 
Sbjct: 692 KKVNRKYQKGKKD--ADKDSTVVVDYSKAKKIFQKKDETINGNSKKRKSFDPYNNDGDTD 749

Query: 714 DAPRAPKKRKPVNRERNVSFKR 735
             PRA KKR+   R +N+S+KR
Sbjct: 750 KVPRALKKRQTNTRGKNISYKR 771

>ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR001W
           (RRP6)
          Length = 745

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/612 (53%), Positives = 430/612 (70%), Gaps = 15/612 (2%)

Query: 1   MPPAEEDQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSI 60
           M   +ED L +++V TIRA++AL+AQD+DF+RSL   +G+ LD+TS  +VSLIN LL S+
Sbjct: 1   MASTDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSV 60

Query: 61  DQNSEPLVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKLKFLDNSSS 120
           D+N+  L  G++   + WK+ SN+MDN+FE SD + D +     SR +G  +++L +SS 
Sbjct: 61  DENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSH 120

Query: 121 NDSIPSKRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPLISDIV--PGNDAVPEHYA 178
           +DS PSKRI KPQL FK PV+NTE+ PF PLLKEKP AL+PL   ++  P  + VP HY 
Sbjct: 121 DDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYP 180

Query: 179 QPYEYEIEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDLE 238
            PYEYEI+ Q Y +SV+   E I  +PWE TE +WVDN+E L  M+ +LK V E+AVDLE
Sbjct: 181 HPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLE 240

Query: 239 HHDYRSYYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIWL 298
           HHDYRSYYGIVCLMQIS+R +D+L+DTIALRDDL +LN +  +P ++KVFHGAFMD+IWL
Sbjct: 241 HHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWL 300

Query: 299 QRDLGLYVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMNA 358
           QRDLGLYVVSLFDT+HASRA+G P+HSLAYLLE FA FKTSKKYQLADWR+RPL K +  
Sbjct: 301 QRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRD 360

Query: 359 YARADTHFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCPID 418
           YAR+DTHFLL+IYD LRN L++  KLA VL  SRNVAKRRFEY+ FRP  P   VY PI+
Sbjct: 361 YARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPIE 420

Query: 419 KPDPWKVLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTEP 478
             +PW+ LM+QY++ P++E L+KKLY+WRDT+ARRDDES RYVMPNQLLV L   +P+E 
Sbjct: 421 STEPWRKLMYQYNLPPSKEPLLKKLYEWRDTVARRDDESVRYVMPNQLLVSLVSLSPSET 480

Query: 479 INVISVNSIVTDHVRSNSLVLAHLIKNTLAS-SDKESDKGTFEADNNS-TDAASLLTVPQ 536
             V+SV++ VTD+VRSN+  LA+LIK TL +     +    F +   + ++ A+ L++  
Sbjct: 481 AGVLSVSTYVTDYVRSNARTLANLIKRTLETIKAGTASVAEFSSSERALSNPAATLSLHM 540

Query: 537 IQKLAACFAGVSRAFTILQNEYKDG------RSSSIFTDILTSEDDAVNYVGNNMDHITK 590
           IQ L   F  +     +++ + + G       SS +F   L +   AV Y       I  
Sbjct: 541 IQNLDDHFRSL-----LMEAQKQSGSICSQHSSSLLFNSDLATGPSAVEYTNGQKHVIGD 595

Query: 591 KELGKRAAKALQ 602
             L  R    LQ
Sbjct: 596 NVLQTRKHALLQ 607

>Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001W
           (RRP6) - involved in 5.8S rRNA processing [contig 185]
           FULL
          Length = 735

 Score =  637 bits (1644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/635 (51%), Positives = 426/635 (67%), Gaps = 13/635 (2%)

Query: 1   MPPAEEDQ---LLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLL 57
           M   +ED+   +L +VV TIRASSA++AQDVDF++SL   I +SLDETS +++SLIN ++
Sbjct: 1   MAKTQEDKRSSILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLSLINDVV 60

Query: 58  SSIDQNSEPLVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKLKFLDN 117
            SID N++ +  G+  L   W +   +MD LFE S+ +   + +  GS   G  L++LD+
Sbjct: 61  ISIDDNNDLIEPGRAGLENSWNNIGEVMDLLFEKSEHALAAMKKK-GSNIIGNNLQYLDD 119

Query: 118 SSSNDSIPSKRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPL--ISDIVPGNDAVPE 175
           S         +I+KPQ +F  PV+NTE  PF PLL +KP ALRPL  +  +    + +P 
Sbjct: 120 SQPLTDTTLTKITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPA 179

Query: 176 HYAQPYEYEIEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAV 235
           HY  PYEYEI+HQEY ESV+    PIPSKPWE T+A WVDN+  L  MI +L    E+A+
Sbjct: 180 HYPHPYEYEIDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAI 239

Query: 236 DLEHHDYRSYYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDI 295
           DLEHHDYR+YYGI CLMQISTRE D+L+DTIALRD L +LNE+F NPK++KVFHGAFMD+
Sbjct: 240 DLEHHDYRTYYGITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDV 299

Query: 296 IWLQRDLGLYVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKA 355
           IWLQRDLGLY+VSLFDTFHASR +G P+HSLAYLLE++A+FKTSKKYQLADWR+RPLSK 
Sbjct: 300 IWLQRDLGLYLVSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKP 359

Query: 356 MNAYARADTHFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYC 415
           + AYARADTHFLLNIYDQ+RN+LIEQ KLA  L  SR VAKRRFEY+KFRP   +  VY 
Sbjct: 360 LKAYARADTHFLLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYS 419

Query: 416 PIDKPDPWKVLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAP 475
           P+++ DPW+ L+F Y+I  ++  L+K+LY+WRDTIARRDDESPRYVMPNQLLV L   AP
Sbjct: 420 PVEREDPWRSLIFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAP 479

Query: 476 TEPINVISVNSIVTDHVRSNSLVLAHLIKNTLASSDKESDKGTFEADNNSTDAASLLTVP 535
           T+   ++SV S VT+HVRSN+  L+ LIK TLAS            D+N +   S L+  
Sbjct: 480 TDTYGLLSVTSFVTEHVRSNAKSLSQLIKKTLASPQDLFTDQINHMDSNKSMVDSKLSPG 539

Query: 536 QIQKLAACFAGVSR-AFTILQNEYKDGRSSSIFTDILTSEDDAVNYVGNNMDHITKKELG 594
            ++     F   +R +  ++ +     R  S+F       +  V+Y G  + HI    L 
Sbjct: 540 DVKANHQNFDQYTRKSRELVIHGPTVVRGCSLFPGKPLPNEAYVSYQGTQVHHIEPTVLD 599

Query: 595 KRAAKALQSMEQFDEATSYYM------PIPEIAKE 623
            R     Q++      T          P PE++ E
Sbjct: 600 DRRELVAQNITTTANVTEKLQVAVEKTPAPEVSDE 634

>Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to
           Ashbya gossypii ACL001C
          Length = 747

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/626 (52%), Positives = 423/626 (67%), Gaps = 20/626 (3%)

Query: 1   MPPAEEDQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSI 60
           M    +D LL K++ T+RA+S+LAAQD+DF R L   +G+ LDETS  +VSL+N ++ S 
Sbjct: 1   MSSDNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILST 60

Query: 61  DQNSEPLVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGE--KLKFLDNS 118
            + +  L  GK+ L   WKD SN++DNLFE SD S D+L +   S        +++L+  
Sbjct: 61  SKANNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHSLDVLQKLLSSSSSQLDTNMQYLNVD 120

Query: 119 SSNDSIPSKRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPL--ISDIVPGNDAVPEH 176
           S  D   S+RI KPQL FK PV+N+E  PF PLLK KP AL+PL  +S +    + VP H
Sbjct: 121 SQRDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAH 180

Query: 177 YAQPYEYEIEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVD 236
           Y  PYEYEI++Q Y +SV+   EPI    W+  E +WVDNI  L  M++ LK+V EIAVD
Sbjct: 181 YPHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVD 240

Query: 237 LEHHDYRSYYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDII 296
           LEHHDYRSYYG+VCLMQISTRE D+L+DTIALR DLQ+LNE+F +P ILKVFHGAFMDII
Sbjct: 241 LEHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDII 300

Query: 297 WLQRDLGLYVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAM 356
           WLQRDLGLYVVSLFDT+HASRA+G P+HSLAYLLE FANFKTSKKYQLADWR+RPLSK M
Sbjct: 301 WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPM 360

Query: 357 NAYARADTHFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCP 416
             YARADTHFLLNIYD+LRN+LI+++KL+GVL  SRNVAKRRFEY+ FRP   SPTV+ P
Sbjct: 361 KTYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSP 420

Query: 417 IDKPDPWKVLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPT 476
           I+K DPW+ LM QY++   +E L++KLY WRD +AR+DDES RYVMPNQLLV L   AP+
Sbjct: 421 IEKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPS 480

Query: 477 EPINVISVNSIVTDHVRSNSLVLAHLIKNTLASSDKESDKGTFEADNNSTDAASLLTVPQ 536
           +P  +++V S + DHVR+N+ VL ++I  T+    +E   G+ E  +      + ++   
Sbjct: 481 DPSGLLTVKSYIPDHVRANARVLCNIINKTM----EEIKSGSHEGQSIENVTTTYVSAQD 536

Query: 537 IQKLAACFAGVSRAFTILQNEYKD--------GRSSSIFTDILTSEDDAVNY--VGNNMD 586
            +   +    + R F  L +E +            S +F   L  +  AV Y  VG  + 
Sbjct: 537 PEMSVSLIKTMDRHFKFLLDEVQSHAVEPSSVCEDSLLFKGFLFDKPKAVAYNSVGKRL- 595

Query: 587 HITKKELGKRAAKALQSMEQFDEATS 612
            +  +EL  R +   Q   +  +A  
Sbjct: 596 -VNDRELLDRKSDLSQKFSKVFKAAG 620

>KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {ON}
           similar to uniprot|Q12149 Saccharomyces cerevisiae
           YOR001W RRP6 Exonuclease component of the nuclear
           exosome contributes to the quality-control system that
           retains and degrades aberrant mRNAs in the nucleus
          Length = 735

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/556 (55%), Positives = 406/556 (73%), Gaps = 13/556 (2%)

Query: 4   AEEDQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSIDQN 63
           +E+  +L +V+ TIRASSA+ AQDV F+++L   I  S++  S R++ LIN +L S+D+N
Sbjct: 7   SEDGSVLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLSVDEN 66

Query: 64  SEPLVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKL----KFLDNSS 119
           ++ + +G E L   W +   +MD LFE S+ +      A G ++D  +L    ++LD+S 
Sbjct: 67  NDIIEQGSEGLESAWSNVGEVMDLLFEKSEHAL-----AAGEKRDNGELSKTVQYLDDSP 121

Query: 120 S-NDSIPSKRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPLISDI--VPGNDAVPEH 176
           S +D  P K+I KPQL FK P++N+E  PF PLLK+KP ALR L   +      + VP H
Sbjct: 122 SLHDGAP-KKILKPQLLFKRPIDNSESHPFKPLLKKKPHALRSLDESLRLTAEQEDVPAH 180

Query: 177 YAQPYEYEIEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVD 236
           Y QPYEYEI+HQEY ESV+  SEP+PS PW+ TEA WVDN + LK M+++L    EIA+D
Sbjct: 181 YPQPYEYEIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTDALKLMLNELLLANEIAID 240

Query: 237 LEHHDYRSYYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDII 296
           LEHHDYR+YYGI CLMQISTRE+D+LIDTIALRDDL ILNEVF +PKI KV HGAFMDII
Sbjct: 241 LEHHDYRTYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDII 300

Query: 297 WLQRDLGLYVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAM 356
           WLQRDLGLY+VSLFDT+HASR +G P+HSLAYLLE++A+FKTSKKYQL+DWR+RPL KA+
Sbjct: 301 WLQRDLGLYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKAL 360

Query: 357 NAYARADTHFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCP 416
            AYARADTHFLLNIYD +RN+LIEQNKL+ VL +SRNVAKRRFE++ FRP   +  V+ P
Sbjct: 361 KAYARADTHFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSP 420

Query: 417 IDKPDPWKVLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPT 476
           I++ DPW+ LMFQY+I  ++  LV++LY+WRD +ARRDDESPRYV+PNQLLV LA  APT
Sbjct: 421 IEREDPWRTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPT 480

Query: 477 EPINVISVNSIVTDHVRSNSLVLAHLIKNTLASSDKESDKGTFEADNNSTDAASLLTVPQ 536
            P  +++ ++ VT+H+R N+  LA LIK +L SS  E  +    A+     + + ++   
Sbjct: 481 TPALIMATSTFVTEHIRQNAKSLALLIKKSLESSSNEFGQLLNSANTVQNSSPTKMSSED 540

Query: 537 IQKLAACFAGVSRAFT 552
           I+K +  F      F+
Sbjct: 541 IEKNSRMFEKFLEDFS 556

>KLLA0F20768g Chr6 complement(1936804..1937520) [717 bp, 238 aa]
           {ON} similar to uniprot|P40165 Saccharomyces cerevisiae
           YNL200C
          Length = 238

 Score = 34.7 bits (78), Expect = 0.59,   Method: Composition-based stats.
 Identities = 23/63 (36%), Positives = 33/63 (52%), Gaps = 5/63 (7%)

Query: 137 KNPVNNTEIQP--FVPLLKEKPFA--LRPLISDIVPGNDAVPEHYAQPYEYEIEHQEYGE 192
           K P++N  IQP   V L   KP A  L+P  +  V G   VP H+AQ Y +E    + G+
Sbjct: 175 KGPIDNKAIQPDTLVSLTVPKPCAQFLKPEANHYV-GGRFVPRHFAQKYGFEPFKYKSGD 233

Query: 193 SVI 195
            ++
Sbjct: 234 QIL 236

>KAFR0G00420 Chr7 (122124..123248) [1125 bp, 374 aa] {ON} Anc_8.860
          Length = 374

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 26/51 (50%)

Query: 321 LPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMNAYARADTHFLLNIY 371
           L +  L  L  +  NF  + +YQ+A W+ R  ++  + +   D HF  NI+
Sbjct: 112 LVKGDLMNLFSEDTNFIENSRYQVALWKYRKRNRQSSCFGLNDIHFCRNIF 162

>Ecym_6413 Chr6 (799650..801203) [1554 bp, 517 aa] {ON} similar to
           Ashbya gossypii AFR022C
          Length = 517

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 6/53 (11%)

Query: 152 LKEKPFALRPLISDIVPGNDAVPEHYAQPYEYEIEHQEYGESVIVKSEPIPSK 204
           L   P++LR LI D  PG D  PE + QP +YE E    G++V+ +++   SK
Sbjct: 282 LNNIPYSLRDLIGD-TPG-DHTPESHIQPIQYESE----GDTVLPEAKIYASK 328

>KLLA0D18942g Chr4 (1594560..1595633) [1074 bp, 357 aa] {ON} similar
           to uniprot|P35197 Saccharomyces cerevisiae YDL226C GCS1
           ADP-ribosylation factor GTPase activating protein
          Length = 357

 Score = 31.2 bits (69), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 36/77 (46%), Gaps = 8/77 (10%)

Query: 35  SRPIGKSLDETSTRMVSLINSLLSSIDQNSEPLVEGKETLNEYWKDFSNMMDNLFELSDC 94
           ++  G+   E+S+  +  +NS    + Q  +   +G  T ++Y K        LF+ +D 
Sbjct: 278 AKQFGQKFQESSSYGLQALNSFTKGLQQQLQETQDGPATSSQYTK--------LFDGADA 329

Query: 95  SADILTRAPGSRKDGEK 111
           ++   T+AP   K  EK
Sbjct: 330 TSTTHTQAPAQNKTSEK 346

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 74,687,278
Number of extensions: 3306634
Number of successful extensions: 11742
Number of sequences better than 10.0: 49
Number of HSP's gapped: 12046
Number of HSP's successfully gapped: 50
Length of query: 735
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 618
Effective length of database: 40,065,477
Effective search space: 24760464786
Effective search space used: 24760464786
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)