Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G044306.26ON34734718440.0
ZYRO0C07634g6.26ON3823148611e-113
KNAG0I017506.26ON3242458151e-107
Kpol_1037.306.26ON3672447991e-104
TPHA0J003806.26ON3562447635e-99
CAGL0E02541g6.26ON3422387608e-99
Skud_15.1616.26ON2932497541e-98
YOL001W (PHO80)6.26ON2932357532e-98
Smik_15.1696.26ON2912427523e-98
SAKL0E01408g6.26ON3072367534e-98
KLTH0C11110g6.26ON2802607494e-98
Kwal_56.224436.26ON2802627495e-98
Suva_15.1746.26ON2952437481e-97
ACR001C6.26ON3462397356e-95
KLLA0D01287g6.26ON3452417182e-92
Ecym_30296.26ON3512217011e-89
TBLA0A071606.26ON2682336652e-85
NCAS0D021506.26ON3692335978e-74
NDAI0C026406.26ON4272295712e-69
Smik_9.1407.240ON2851571943e-16
Skud_9.1197.240ON2851601944e-16
YIL050W (PCL7)7.240ON2851571901e-15
Suva_9.1497.240ON2861571882e-15
KNAG0D016307.240ON4381691807e-14
Kwal_23.58077.240ON4651211781e-13
KAFR0I018407.240ON3251461716e-13
KLTH0A04268g7.240ON5801101728e-13
KLLA0C08305g7.240ON4091711701e-12
TPHA0C010907.240ON3851941682e-12
CAGL0M12342g7.240ON4571241682e-12
Ecym_43367.240ON3851401673e-12
SAKL0F08602g7.240ON4741531673e-12
NDAI0A025607.240ON5031891673e-12
NCAS0A134807.240ON4481201665e-12
NCAS0E032207.240ON3411871637e-12
KAFR0L008807.240ON3131831628e-12
ADL075W7.240ON2071011562e-11
TDEL0H020207.240ON3631811478e-10
KNAG0L014707.240ON3541711442e-09
TBLA0D040707.240ON661611443e-09
ZYRO0C08118g7.240ON4051511425e-09
Kpol_1033.137.240ON250611351e-08
Suva_5.1677.240ON424611336e-08
Smik_5.1897.240ON415611336e-08
YER059W (PCL6)7.240ON420611311e-07
Skud_5.1737.240ON420611311e-07
Kpol_2000.147.289ON3101431254e-07
TBLA0C048507.289ON3681741221e-06
NDAI0E047707.240ON303571175e-06
Suva_14.503.70ON2791041102e-05
NCAS0A137707.289ON3121431103e-05
ZYRO0C09284g7.289ON3111121069e-05
TDEL0H015507.289ON3091411051e-04
CAGL0J09328g7.289ON297951051e-04
Kwal_23.60067.289ON3041381042e-04
KNAG0A014903.70ON2621171013e-04
Skud_14.483.70ON2791061013e-04
YNL289W (PCL1)3.70ON2791041013e-04
Smik_14.423.70ON2791041014e-04
CAGL0E02233g3.70ON2661061004e-04
YDL127W (PCL2)7.289ON3081121005e-04
YPL219W (PCL8)6.236ON492141998e-04
SAKL0F09856g7.289ON335119970.001
TPHA0A005803.70ON289113960.002
Suva_4.1187.289ON309109960.002
Kpol_1020.163.70ON282105950.002
Suva_16.876.236ON501124960.002
NDAI0A022707.289ON330104960.002
Smik_4.1107.289ON308112950.002
TPHA0P008107.289ON247143930.003
Skud_16.606.236ON500126950.003
Kpol_1020.87.289ON296140930.003
Suva_4.687.289ON305107930.004
YDL179W (PCL9)7.289ON304105930.004
KLTH0A05346g7.289ON301100920.005
TBLA0A078903.70ON361103920.006
AFR159C7.289ON308110910.006
Ecym_80387.289ON314112910.006
NCAS0D040706.236ON473165920.007
Skud_4.1287.289ON308110910.007
KLTH0H03674g6.236ON484105910.009
Smik_6.4246.236ON492124910.010
ZYRO0C02068g3.70ON330113890.012
TBLA0J006507.289ON363151880.017
SAKL0C12100g3.70ON314120880.018
Smik_4.607.289ON305145860.032
TDEL0E007903.70ON254108850.037
KNAG0B029307.289ON312132850.039
KLLA0E13223g3.70ON282100850.041
Skud_4.797.289ON30998840.050
NCAS0A098703.70ON29494830.073
KAFR0A082803.70ON241133800.12
KAFR0C015603.70ON26794800.14
NDAI0A060503.70ON28697800.16
YHR071W (PCL5)5.347ON229155790.16
AEL195W3.70ON237108790.20
KNAG0B044805.370ON116166760.67
Kpol_1005.175.347ON31999750.73
TPHA0A032507.289ON28980750.73
Kwal_23.52313.70ON25696740.78
NDAI0C043005.347ON240129731.0
KLLA0B02024g6.236ON527119741.2
CAGL0J06336g7.289ON314132731.2
KLTH0A01584g3.70ON28188721.6
KLTH0B01232g5.123ON86648713.1
KLLA0F05654g7.289ON311100693.7
Kpol_1048.52.125ON1635115694.7
NDAI0C019805.347ON226145675.3
CAGL0E05918g6.236ON481122685.6
Skud_8.1295.347ON220105675.8
Skud_7.1896.179ON91932686.7
Kpol_262.22.610ON1103100678.9
NCAS0H016505.347ON210108659.0
CAGL0J10846g5.347ON22999659.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G04430
         (347 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.2...   714   0.0  
ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} simila...   336   e-113
KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26...   318   e-107
Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {O...   312   e-104
TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON...   298   5e-99
CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} simila...   297   8e-99
Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W...   295   1e-98
YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cycli...   294   2e-98
Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W...   294   3e-98
SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar...   294   4e-98
KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {O...   293   4e-98
Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W...   293   5e-98
Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W...   292   1e-97
ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON} S...   287   6e-95
KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} simila...   281   2e-92
Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to ...   274   1e-89
TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6....   260   2e-85
NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26     234   8e-74
NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {O...   224   2e-69
Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W (...    79   3e-16
Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W (...    79   4e-16
YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p ...    78   1e-15
Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W (...    77   2e-15
KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.2...    74   7e-14
Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL05...    73   1e-13
KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.24...    70   6e-13
KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} simila...    71   8e-13
KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {...    70   1e-12
TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {O...    69   2e-12
CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa...    69   2e-12
Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}...    69   3e-12
SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} simila...    69   3e-12
NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.2...    69   3e-12
NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa] ...    69   5e-12
NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {O...    67   7e-12
KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.2...    67   8e-12
ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic hom...    65   2e-11
TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {O...    61   8e-10
KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7....    60   2e-09
TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa] ...    60   3e-09
ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} simila...    59   5e-09
Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON} (30454.....    57   1e-08
Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W ...    56   6e-08
Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W ...    56   6e-08
YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p...    55   1e-07
Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W ...    55   1e-07
Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON} (24019.....    53   4e-07
TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa] ...    52   1e-06
NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7....    50   5e-06
Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W (R...    47   2e-05
NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {...    47   3e-05
ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {O...    45   9e-05
TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.28...    45   1e-04
CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} simila...    45   1e-04
Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {...    45   2e-04
KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70 Y...    44   3e-04
Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W (R...    44   3e-04
YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin, ...    44   3e-04
Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W (R...    44   4e-04
CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar...    43   4e-04
YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,...    43   5e-04
YPL219W Chr16 (136750..138228) [1479 bp, 492 aa] {ON}  PCL8Cycli...    43   8e-04
SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {...    42   0.001
TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70...    42   0.002
Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W (...    42   0.002
Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON...    41   0.002
Suva_16.87 Chr16 (146154..147659) [1506 bp, 501 aa] {ON} YPL219W...    42   0.002
NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289      42   0.002
Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W (...    41   0.002
TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {O...    40   0.003
Skud_16.60 Chr16 (110205..111707) [1503 bp, 500 aa] {ON} YPL219W...    41   0.003
Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON} (18215..1...    40   0.003
Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W (R...    40   0.004
YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,...    40   0.004
KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {O...    40   0.005
TBLA0A07890 Chr1 (1943543..1944628) [1086 bp, 361 aa] {ON} Anc_3...    40   0.006
AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON} Sy...    40   0.006
Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON} si...    40   0.006
NCAS0D04070 Chr4 (764711..766132) [1422 bp, 473 aa] {ON} Anc_6.236     40   0.007
Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W (...    40   0.007
KLTH0H03674g Chr8 (333755..335209) [1455 bp, 484 aa] {ON} weakly...    40   0.009
Smik_6.424 Chr6 complement(686097..687575) [1479 bp, 492 aa] {ON...    40   0.010
ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {O...    39   0.012
TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {...    39   0.017
SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa] ...    39   0.018
Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W (R...    38   0.032
TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70...    37   0.037
KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.28...    37   0.039
KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} simil...    37   0.041
Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W (R...    37   0.050
NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {...    37   0.073
KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {...    35   0.12 
KAFR0C01560 Chr3 complement(320148..320951) [804 bp, 267 aa] {ON...    35   0.14 
NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {...    35   0.16 
YHR071W Chr8 (237004..237693) [690 bp, 229 aa] {ON}  PCL5Cyclin,...    35   0.16 
AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic hom...    35   0.20 
KNAG0B04480 Chr2 (861049..864534) [3486 bp, 1161 aa] {ON} Anc_5....    34   0.67 
Kpol_1005.17 s1005 (29070..30029) [960 bp, 319 aa] {ON} (29070.....    33   0.73 
TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.28...    33   0.73 
Kwal_23.5231 s23 complement(1069167..1069937) [771 bp, 256 aa] {...    33   0.78 
NDAI0C04300 Chr3 (981107..981829) [723 bp, 240 aa] {ON}                33   1.0  
KLLA0B02024g Chr2 (176585..178168) [1584 bp, 527 aa] {ON} some s...    33   1.2  
CAGL0J06336g Chr10 complement(602954..603898) [945 bp, 314 aa] {...    33   1.2  
KLTH0A01584g Chr1 (141289..142134) [846 bp, 281 aa] {ON} similar...    32   1.6  
KLTH0B01232g Chr2 complement(108265..110865) [2601 bp, 866 aa] {...    32   3.1  
KLLA0F05654g Chr6 (552056..552991) [936 bp, 311 aa] {ON} weakly ...    31   3.7  
Kpol_1048.5 s1048 complement(22179..27086) [4908 bp, 1635 aa] {O...    31   4.7  
NDAI0C01980 Chr3 complement(445212..445892) [681 bp, 226 aa] {ON...    30   5.3  
CAGL0E05918g Chr5 complement(585960..587405) [1446 bp, 481 aa] {...    31   5.6  
Skud_8.129 Chr8 (210309..210971) [663 bp, 220 aa] {ON} YHR071W (...    30   5.8  
Skud_7.189 Chr7 (338050..340809) [2760 bp, 919 aa] {ON} YGL093W ...    31   6.7  
Kpol_262.2 s262 (3189..6500) [3312 bp, 1103 aa] {ON} (3189..6500...    30   8.9  
NCAS0H01650 Chr8 complement(316598..317230) [633 bp, 210 aa] {ON...    30   9.0  
CAGL0J10846g Chr10 complement(1058824..1059513) [690 bp, 229 aa]...    30   9.5  

>TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.26
           YOL001W
          Length = 347

 Score =  714 bits (1844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/347 (100%), Positives = 347/347 (100%)

Query: 1   MQAIEDAEVTVAARDKPIPSESSKEGTDEISTIYLPRKFSKCSRTDLAVLISRMLTFLIQ 60
           MQAIEDAEVTVAARDKPIPSESSKEGTDEISTIYLPRKFSKCSRTDLAVLISRMLTFLIQ
Sbjct: 1   MQAIEDAEVTVAARDKPIPSESSKEGTDEISTIYLPRKFSKCSRTDLAVLISRMLTFLIQ 60

Query: 61  INDSLALSKPENARGLTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSV 120
           INDSLALSKPENARGLTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSV
Sbjct: 61  INDSLALSKPENARGLTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSV 120

Query: 121 YPVFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNY 180
           YPVFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNY
Sbjct: 121 YPVFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNY 180

Query: 181 RILPRDDNIDWCKLETKLQKFTLYEEPEMGQNSRPQNSLKNSGYNVLDAYFRKIVQLVGS 240
           RILPRDDNIDWCKLETKLQKFTLYEEPEMGQNSRPQNSLKNSGYNVLDAYFRKIVQLVGS
Sbjct: 181 RILPRDDNIDWCKLETKLQKFTLYEEPEMGQNSRPQNSLKNSGYNVLDAYFRKIVQLVGS 240

Query: 241 YASSPDKSKVVNYVLRPSSPIKDGSRDSTHDHALSSQTSLESISTRTINSDSKPKSHEDE 300
           YASSPDKSKVVNYVLRPSSPIKDGSRDSTHDHALSSQTSLESISTRTINSDSKPKSHEDE
Sbjct: 241 YASSPDKSKVVNYVLRPSSPIKDGSRDSTHDHALSSQTSLESISTRTINSDSKPKSHEDE 300

Query: 301 EPSARKRNLDSEAHPNGKDKVPSPGESKLKKMTNNQRTPNINHHSYS 347
           EPSARKRNLDSEAHPNGKDKVPSPGESKLKKMTNNQRTPNINHHSYS
Sbjct: 301 EPSARKRNLDSEAHPNGKDKVPSPGESKLKKMTNNQRTPNINHHSYS 347

>ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 382

 Score =  336 bits (861), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 174/314 (55%), Positives = 227/314 (72%), Gaps = 24/314 (7%)

Query: 25  EGTDEISTIYLPRKFSKCSRTDLAVLISRMLTFLIQINDSLALSKPENARGLTRFHSRVP 84
           +  +++ T+ LP++FS+CSRTDL +LISRMLTFLIQ+NDS + S  ++   LT+FHS+VP
Sbjct: 37  DNVNDVPTVILPKRFSECSRTDLVILISRMLTFLIQMNDSSSTSALDSVTNLTKFHSKVP 96

Query: 85  PGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLTVHRFLLTATTVASK 144
           PGISVYNYL+RLTKYSSL+HCVL+ AVYYIDL+SSVYP FTL+SLTVHRFLLTATTVASK
Sbjct: 97  PGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVHRFLLTATTVASK 156

Query: 145 GLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRILPRDDNIDWCKLETKLQKFTLY 204
           GLCDSFCTNTHYAKVGGVH SELN+LECE L+R+NYRI+PRDDNI WC LE++ + F L 
Sbjct: 157 GLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLESQHRHFVL- 215

Query: 205 EEPEMGQNSRP-----QNSLKNSGYNVLDAYFRKIVQLVGSYASSPDKSKVVNY----VL 255
            + + G +  P       +  NSGYNVLD Y+ KIVQLVGS  S+ DKSK+VNY     L
Sbjct: 216 -DTQDGDDWTPILSNLSGNRNNSGYNVLDTYYNKIVQLVGSLKSTQDKSKLVNYTFANTL 274

Query: 256 RPS----------SPIKDGSRDSTHDHALSSQTSLESISTRTINSDSKPKSHEDEEPSAR 305
           +P+          +P   G+ D       +    +++ +    NS+S  +   ++  S+R
Sbjct: 275 KPTNIHNNEGLNLNPSPSGNNDKM---TTTCNNGIDNDNNDGSNSNSNSQIGLEQGTSSR 331

Query: 306 KRNLDSEAHPNGKD 319
           KRNLD++ + +G +
Sbjct: 332 KRNLDTDVYESGNE 345

>KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26
           YOL001W
          Length = 324

 Score =  318 bits (815), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 157/245 (64%), Positives = 182/245 (74%), Gaps = 18/245 (7%)

Query: 29  EISTIYLPRKFSKCSRTDLAVLISRMLTFLIQINDSLALSK---PENARG---------- 75
           EI T+ LP  FS CSR DL  LISRML FLIQIND  A  K    ++ +G          
Sbjct: 20  EIQTVSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAADTDG 79

Query: 76  -----LTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLT 130
                LTRFHS VPP ISVYNYLIRLTKYS+LE  VLLT++YYIDLLSSVYP FT++SLT
Sbjct: 80  SSETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINSLT 139

Query: 131 VHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRILPRDDNID 190
           VHRFLLTATTVASKGLCDSFCTN HYAKVGGV  SELNILE EFLK++NYR+LPRDDNI 
Sbjct: 140 VHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRDDNIT 199

Query: 191 WCKLETKLQKFTLYEEPEMGQNSRPQNSLKNSGYNVLDAYFRKIVQLVGSYASSPDKSKV 250
           WCK E +  +FT+Y +  +   S+P ++ +NSGYNVL  Y+ KI+QLVG ++SS DKSK 
Sbjct: 200 WCKYEHRAHEFTIYNKAALTNVSKPTHTQRNSGYNVLQMYYHKIIQLVGKFSSSLDKSKK 259

Query: 251 VNYVL 255
            NYV 
Sbjct: 260 ANYVF 264

>Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {ON}
           complement(72024..73127) [1104 nt, 368 aa]
          Length = 367

 Score =  312 bits (799), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 156/244 (63%), Positives = 187/244 (76%), Gaps = 8/244 (3%)

Query: 20  SESSKEGTDEISTIYLPRKFSKCSRTDLAVLISRMLTFLIQIND-----SLALSKPENAR 74
           S  +K   + I TI LP KF  CSR+DL  LI+RML+FLI++ND     +  L++  N R
Sbjct: 33  SNENKIEIENIETITLPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNR 92

Query: 75  ---GLTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLTV 131
               LTRFHSRVPP ISVYNYLIRLTKYSSLEHCVLL+ VYYIDLLSSVYP F ++SLTV
Sbjct: 93  SVMNLTRFHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTV 152

Query: 132 HRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRILPRDDNIDW 191
           HRFLLTATT+ASKGLCDSFCTN+HY+KVGGVH SELNILE EFL+RVNYRI+PRDDNI  
Sbjct: 153 HRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKL 212

Query: 192 CKLETKLQKFTLYEEPEMGQNSRPQNSLKNSGYNVLDAYFRKIVQLVGSYASSPDKSKVV 251
           CK+E +  KFT+            Q++ +NSG+N+LD Y+ KIVQLVGS+++S DKS+  
Sbjct: 213 CKIEHQQNKFTMDFSDLSMVGMTVQSNHQNSGFNILDIYYHKIVQLVGSFSASSDKSRKA 272

Query: 252 NYVL 255
           NY L
Sbjct: 273 NYTL 276

>TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON}
           Anc_6.26 YOL001W
          Length = 356

 Score =  298 bits (763), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 153/244 (62%), Positives = 180/244 (73%), Gaps = 17/244 (6%)

Query: 30  ISTIYLPRKFSKCSRTDLAVLISRMLTFLIQINDSLALSKPENA---------------- 73
           I TI LP  F KCSR+DL VLISRMLTFLIQIND   +    N+                
Sbjct: 32  IETIMLPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVNNKNNNN 91

Query: 74  -RGLTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLTVH 132
              LTRFHSRVPP ISV NYLIRLTKY+SLEH VLL+++YYIDLLSSVYP F ++SLTVH
Sbjct: 92  MINLTRFHSRVPPNISVNNYLIRLTKYASLEHSVLLSSLYYIDLLSSVYPEFKINSLTVH 151

Query: 133 RFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRILPRDDNIDWC 192
           RFLL ATTVASKGL DSFCTN+HYAKVGGV  SELNILE +FL+R+NYRI+PRDDNI  C
Sbjct: 152 RFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLC 211

Query: 193 KLETKLQKFTLYEEPEMGQNSRPQNSLKNSGYNVLDAYFRKIVQLVGSYASSPDKSKVVN 252
           KLE K  +FTL     +  N +P+ +  NSGYNVL+ Y+RK+VQ+VG   +S DKSK VN
Sbjct: 212 KLEKKSSQFTLDLGDLLAANIQPELTHPNSGYNVLNIYYRKMVQIVGLLKNSTDKSKKVN 271

Query: 253 YVLR 256
           Y+++
Sbjct: 272 YIIQ 275

>CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001w PHO80
           cyclin
          Length = 342

 Score =  297 bits (760), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 145/238 (60%), Positives = 183/238 (76%), Gaps = 4/238 (1%)

Query: 19  PSESSKEGTDEISTIYLPRKFSKCSRTDLAVLISRMLTFLIQINDSLALSKPENARGLTR 78
           P ++     +EI TI LPR F KC + DL +LI+RML F+IQINDS  + + E   GLTR
Sbjct: 3   PQDAQINTDEEIPTIKLPRDFLKCPKGDLVILIARMLQFIIQINDS-NIKENERKYGLTR 61

Query: 79  FHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLTVHRFLLTA 138
           FHS++ P ISV+NY  RLTKYS LEH VLL+AVYYIDLLS+VYP F L+SLT HRFLLTA
Sbjct: 62  FHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTA 121

Query: 139 TTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRILPRDDNIDWCKLETKL 198
           TT+ASKGLCDSFCTNTHY+KVGGV  +ELN+LE EFL++VNYRI+PRD+NI +CK+E + 
Sbjct: 122 TTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQK 181

Query: 199 QKFTLYE--EPEMGQNSRP-QNSLKNSGYNVLDAYFRKIVQLVGSYASSPDKSKVVNY 253
             F L E  E ++  + R   +S+ N+GYNVL  Y+ KI+++VG Y+SSPDK+K VNY
Sbjct: 182 NFFILPESIESDLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKTKKVNY 239

>Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W
           (REAL)
          Length = 293

 Score =  295 bits (754), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 153/249 (61%), Positives = 183/249 (73%), Gaps = 16/249 (6%)

Query: 25  EGTDE---ISTIYLPRKFSKCSRTDLAVLISRMLTFLIQINDSLALSKPENARGLTRFHS 81
           EG  E   I  + LP +F KCSRTDL VLISRML  LI IN++    KP++   LTR+HS
Sbjct: 10  EGIHEHQGIPKVILPAEFYKCSRTDLVVLISRMLVSLIAINENSTTKKPDDQITLTRYHS 69

Query: 82  RVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLTVHRFLLTATTV 141
           +VPP IS++NY IRLTK+SSLEHCVL+T++YYIDLL + YP FTL+SLT HRFLLTATTV
Sbjct: 70  KVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTV 129

Query: 142 ASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRILPRDDNIDWCKLETKLQKF 201
           A+KGLCDSF TN HYAKVGGV   ELNILE +FLKRVNYRI+PRD NI  C +E K +KF
Sbjct: 130 AAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKF 189

Query: 202 TL-------YEEPEMGQNSRPQNSLKNSGYNVLDAYFRKIVQLVGSYASSPDKSKVVNYV 254
                    ++       SRP+     SGYNVLD Y+R+IVQLVGS+ +SPDKSK V+YV
Sbjct: 190 VADKNAPGSFDLDSYSYVSRPK-----SGYNVLDKYYRRIVQLVGSFNASPDKSKKVDYV 244

Query: 255 LRPSSPIKD 263
           L PS+  KD
Sbjct: 245 L-PSNIDKD 252

>YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cyclin,
           interacts with cyclin-dependent kinase Pho85p; regulates
           the response to nutrient levels and environmental
           conditions, including the response to phosphate
           limitation and stress-dependent calcium signaling
          Length = 293

 Score =  294 bits (753), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 147/235 (62%), Positives = 180/235 (76%), Gaps = 4/235 (1%)

Query: 30  ISTIYLPRKFSKCSRTDLAVLISRMLTFLIQINDSLALSKPENARGLTRFHSRVPPGISV 89
           I  + LP  F+KCSRTDL VLISRML  LI IN++ A  K ++   LTR+HS++PP IS+
Sbjct: 18  IPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDDQITLTRYHSKIPPNISI 77

Query: 90  YNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLTVHRFLLTATTVASKGLCDS 149
           +NY IRLTK+SSLEHCVL+T++YYIDLL +VYP FTL+SLT HRFLLTATTVA+KGLCDS
Sbjct: 78  FNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAHRFLLTATTVATKGLCDS 137

Query: 150 FCTNTHYAKVGGVHSSELNILECEFLKRVNYRILPRDDNIDWCKLETKLQKFTLYEEPEM 209
           F TN HYAKVGGV   ELNILE +FLKRVNYRI+PRD NI  C +E K +KF + ++  +
Sbjct: 138 FSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVI-DKNAL 196

Query: 210 GQNSRPQNSLKN---SGYNVLDAYFRKIVQLVGSYASSPDKSKVVNYVLRPSSPI 261
           G       S  N   SGYNVLD Y+R+IVQLVGS+ +SPDKS+ V+YVL P+  I
Sbjct: 197 GSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRKVDYVLPPNIDI 251

>Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W
           (REAL)
          Length = 291

 Score =  294 bits (752), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 147/242 (60%), Positives = 179/242 (73%), Gaps = 13/242 (5%)

Query: 30  ISTIYLPRKFSKCSRTDLAVLISRMLTFLIQINDSLALSKPENARGLTRFHSRVPPGISV 89
           I  + LP  F+KCSRTDL VLISRML  LI IN++     PEN   LTR+HS++PP IS+
Sbjct: 18  IQKVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVSKIPENQITLTRYHSKIPPNISI 77

Query: 90  YNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLTVHRFLLTATTVASKGLCDS 149
           +NY IRLTK+SSLEHCVL+T++YYIDLL + YP FTL+SLT HRFLLTATT+A+KGLCDS
Sbjct: 78  FNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTIATKGLCDS 137

Query: 150 FCTNTHYAKVGGVHSSELNILECEFLKRVNYRILPRDDNIDWCKLETKLQKFTL------ 203
           F TN HYAKVGGV   ELNILE +FLKRVNYRI+PRD NI  C +E K +KF +      
Sbjct: 138 FSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCSIEQKQKKFVIDKNALG 197

Query: 204 -YEEPEMGQNSRPQNSLKNSGYNVLDAYFRKIVQLVGSYASSPDKSKVVNYVLRPSSPIK 262
            ++        RP+     SGYNVLD Y+R+IVQLVGS+ +SPDKSK ++YVL PS+  K
Sbjct: 198 SFDLDSYSYTDRPK-----SGYNVLDKYYRRIVQLVGSFNASPDKSKKIDYVL-PSNIDK 251

Query: 263 DG 264
           D 
Sbjct: 252 DN 253

>SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar to
           uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 307

 Score =  294 bits (753), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 156/236 (66%), Positives = 179/236 (75%), Gaps = 10/236 (4%)

Query: 31  STIYLPRKFSKCSRTDLAVLISRMLTFLIQINDSLALSKPENARGLTRFHSRVPPGISVY 90
           S I LP +F KCSRT L VLISRML+ LIQ+NDS+   K +N + LTRFHSRVPPGISVY
Sbjct: 45  SQIMLPDEFLKCSRTALVVLISRMLSSLIQMNDSMC--KDKNLK-LTRFHSRVPPGISVY 101

Query: 91  NYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLTVHRFLLTATTVASKGLCDSF 150
           NYLIRL KYSSLE  VL+ AVYYIDLLSSVYP FTL+SLTVHRFLLTATTVASKGL DSF
Sbjct: 102 NYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGLSDSF 161

Query: 151 CTNTHYAKVGGVHSSELNILECEFLKRVNYRILPRDDNIDWCKLETKLQKFTLYEEPEMG 210
           CTN HYAKVGGV  SELN+LE EFLKRVNYRI+PRDDNI  CK E +   F  +  P   
Sbjct: 162 CTNVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGVFITF--PLAD 219

Query: 211 QNSRPQNSLKNSGYNVLDAYFRKIVQLVGSYASSPDKSKVVNYVLRPSSPIKDGSR 266
           +   P     N+G+NVLD Y++K++QLVG   SSPDK+  V+YVL PS   +  +R
Sbjct: 220 KIKGP-----NNGFNVLDTYYKKMIQLVGPSNSSPDKTSKVSYVLEPSEQQESQTR 270

>KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {ON}
           similar to uniprot|P20052 Saccharomyces cerevisiae
           YOL001W PHO80 Cyclin negatively regulates phosphate
           metabolism Pho80p-Pho85p (cyclin-CDK complex)
           phosphorylates Pho4p and Swi5p deletion of PHO80 leads
           to aminoglycoside supersensitivity truncated form of
           PHO80 affects vacuole inheritance
          Length = 280

 Score =  293 bits (749), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 151/260 (58%), Positives = 191/260 (73%), Gaps = 13/260 (5%)

Query: 4   IEDAEVTVAARDKPIPSESSK--EGTDEISTIYLPRKFSKCSRTDLAVLISRMLTFLIQI 61
           + D E   A+   P  +E +K   G D +  + LP  FS+C RTDL +LISRML+FLI+I
Sbjct: 1   MSDKESGGASAKHPDLTEDTKPDTGEDPVPEVALPNDFSQCPRTDLVILISRMLSFLIRI 60

Query: 62  NDSLALSKPENARGLTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVY 121
           NDS+     +N+  LTRFHSRVPP ISVY+YL+RLT+YSSLE  VL+ +VYYIDLLS++Y
Sbjct: 61  NDSIP---KDNSSELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMY 117

Query: 122 PVFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYR 181
             F+L+SLTVHRFLLTATTV SKGLCDSFCTN+HYAKVGGV  SEL++LE EFLKRVNYR
Sbjct: 118 TAFSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYR 177

Query: 182 ILPRDDNIDWCKLETKLQKFTLYEEPEMGQNSRPQNSLKNSGYNVLDAYFRKIVQLVGSY 241
           ILPRDDNI  CK E +   F       +      +N   N+G+NVLD Y++KI+++VGSY
Sbjct: 178 ILPRDDNILNCKAERREGLF-------VTATYAKENRGPNNGFNVLDTYYQKIIEIVGSY 230

Query: 242 ASSPDKSKVVNYVLR-PSSP 260
            SSPDK+K  +YV++ P +P
Sbjct: 231 DSSPDKTKRAHYVMKTPPAP 250

>Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W
           (PHO80) - The Pho80p Cyclin [contig 185] FULL
          Length = 280

 Score =  293 bits (749), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 152/262 (58%), Positives = 195/262 (74%), Gaps = 12/262 (4%)

Query: 4   IEDAEVTVAARDKPIPSESSKEGTDE--ISTIYLPRKFSKCSRTDLAVLISRMLTFLIQI 61
           + D E    +   P   +S  E  +E  +  + LP  FS+CSRTDL +LISRML+FL +I
Sbjct: 1   MSDKESGCLSAKNPGSPKSPGERLEEAPVPEVALPEDFSQCSRTDLVILISRMLSFLTRI 60

Query: 62  NDSLALSKPENARGLTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVY 121
           NDS+     ++A+ LTRFHSRVPP ISVY+Y++RLT+YSSLE  VL+ +VYYIDLLS++Y
Sbjct: 61  NDSVP---KDDAKELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMY 117

Query: 122 PVFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYR 181
           P F+L+SLTVHRFLLTATTVASKGLCDSFCTN+HYAKVGGV  SEL++LE EFLK+VNYR
Sbjct: 118 PSFSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYR 177

Query: 182 ILPRDDNIDWCKLETKLQKFTLYEEPEMGQNSRPQNSLKNSGYNVLDAYFRKIVQLVGSY 241
           ILPRDDNI  CK E   +K  L+  P   ++ R      N+G+NVLD Y+RKI+++VGS+
Sbjct: 178 ILPRDDNISNCKAE---KKAGLFVTPTYSKSCRGP----NNGFNVLDTYYRKIIEIVGSF 230

Query: 242 ASSPDKSKVVNYVLRPSSPIKD 263
            SSPDK+K  +YV+  S+  KD
Sbjct: 231 DSSPDKTKRAHYVMINSNTRKD 252

>Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W
           (REAL)
          Length = 295

 Score =  292 bits (748), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 146/243 (60%), Positives = 180/243 (74%), Gaps = 7/243 (2%)

Query: 19  PSESSKEGTDE---ISTIYLPRKFSKCSRTDLAVLISRMLTFLIQINDSLALSKPENARG 75
           P+    E T E   I  I LP +F KCSRTDL VLISRML  LI IN++ +  +P++   
Sbjct: 4   PAREHSEDTQEDQSIPKIILPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPDDQIT 63

Query: 76  LTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLTVHRFL 135
           LTR+HS++PP IS++NY IRLTK+SSLEHCVL+T++YYIDLL + YP FTL+SLT HRFL
Sbjct: 64  LTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAHRFL 123

Query: 136 LTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRILPRDDNIDWCKLE 195
           LTATTVA+KGLCDSF TN HY+KVGGV   ELNILE +FLKRVNYRILPRD NI  C +E
Sbjct: 124 LTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLCSIE 183

Query: 196 TKLQKFTLYEEPEMGQNSRPQNSLKN---SGYNVLDAYFRKIVQLVGSYASSPDKSKVVN 252
            K + F + ++  +G       S  N   SGYNVLD Y+++IVQLVGS+ +SPDKS+ VN
Sbjct: 184 QKQKTFVI-DKNALGSVDLGSYSYANRSKSGYNVLDKYYQRIVQLVGSFDASPDKSRRVN 242

Query: 253 YVL 255
           Y L
Sbjct: 243 YAL 245

>ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL001W
           (PHO80)
          Length = 346

 Score =  287 bits (735), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 148/239 (61%), Positives = 182/239 (76%), Gaps = 7/239 (2%)

Query: 21  ESSKEGTDEISTIYLPRKFSKCSRTDLAVLISRMLTFLIQINDSLA-LSKPENARGLTRF 79
           ++S E ++ ++ + LPR+F  CSRT L VLISRMLT LI +ND+    SKP     LTRF
Sbjct: 4   QTSHETSESVTEMELPRQFLSCSRTYLVVLISRMLTSLIGMNDAQGDKSKPIK---LTRF 60

Query: 80  HSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLTVHRFLLTAT 139
           HSRVPP ISVYNYLIRLTKYSSLEHCVLL +VYYIDLL++VYP F L SLTVHRFLLTAT
Sbjct: 61  HSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFLLTAT 120

Query: 140 TVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRILPRDDNIDWCKLETKLQ 199
           TVASKGLCDSFCTNTHYAKVGGV  SELN+LE EFL+RVNYRILPRDDNI  C LE + +
Sbjct: 121 TVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQER 180

Query: 200 KFTLYEEPEMGQNSRPQNSLKNSGYNVLDAYFRKIVQLVGSYASSPDKSKVVNYVLRPS 258
            F+ Y    M ++   Q+  +N+G+ VL+ Y+ +++ L+G +  SPDKS  +++ L  S
Sbjct: 181 IFS-YSNIPMDKDCALQD--RNNGFGVLEKYYHRMIHLIGDFNMSPDKSCNLSFTLAES 236

>KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 345

 Score =  281 bits (718), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 147/241 (60%), Positives = 175/241 (72%), Gaps = 10/241 (4%)

Query: 24  KEGTDEISTIYLPRKFSKCSRTDLAVLISRMLTFLIQINDSLALSKPENARGLTRFHSRV 83
           ++G++    I LP ++ +CSRT L V+ISRML+FLIQIND  A +       LTRFHS+ 
Sbjct: 10  QKGSNIGQIIPLPEEYLRCSRTHLVVIISRMLSFLIQIND--ANNAGNQTMELTRFHSKA 67

Query: 84  PPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLTVHRFLLTATTVAS 143
            P I+VY YLIRLTKYSSLEH VLL+AVYYIDLLS+VYP FTL+SLTVHRFLLTATT+AS
Sbjct: 68  APSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLTATTIAS 127

Query: 144 KGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRILPRDDNIDWCKLETKLQKFTL 203
           KGLCDSFCTNTHY+KVGGV  SELNILE EFL+RV YRI+PRDDNI+ CK+E KL    L
Sbjct: 128 KGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQKLGSNML 187

Query: 204 YEEPEMGQNSRPQNSLKNSGYNVLDAYFRKIVQLVGSYASSPDKSKVVNYVLRPSSPIKD 263
                  Q   P N     G+NVL  Y+RKIVQLVG+  +SPDK+    Y  +   P+  
Sbjct: 188 IPMKNASQRG-PDN-----GFNVLQNYYRKIVQLVGNPLNSPDKTST--YFFKMVDPMNP 239

Query: 264 G 264
           G
Sbjct: 240 G 240

>Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR001C
          Length = 351

 Score =  274 bits (701), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 141/221 (63%), Positives = 168/221 (76%), Gaps = 6/221 (2%)

Query: 35  LPRKFSKCSRTDLAVLISRMLTFLIQINDSLALSKPENARGLTRFHSRVPPGISVYNYLI 94
           LPRKF  CSRT L VLISRML+ LI++ND+   S   N   LTRFHSRVPP ISVY+YLI
Sbjct: 25  LPRKFLDCSRTHLVVLISRMLSSLIRLNDAYTES---NTLQLTRFHSRVPPSISVYDYLI 81

Query: 95  RLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLTVHRFLLTATTVASKGLCDSFCTNT 154
           RLTKYSSLEHCVLL +VYYIDLLSSV+P F L SLTVHRFLLTATTVASKGLCDSFCTNT
Sbjct: 82  RLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRFLLTATTVASKGLCDSFCTNT 141

Query: 155 HYAKVGGVHSSELNILECEFLKRVNYRILPRDDNIDWCKLETKLQKFTLYEEPEMGQNSR 214
           HYAKVGGV  +ELN+LE EFL RVNYRILPRD+NI  C  E +   F+    P   +  +
Sbjct: 142 HYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQEGTFSFANIPADAE--Q 199

Query: 215 PQNSLKNSGYNVLDAYFRKIVQLVGSYASSPDKSKVVNYVL 255
            Q S +N  ++VL+ Y+ +++ L+G+  +SPDKS  +N+ L
Sbjct: 200 DQKSEENR-FDVLENYYHRMIHLIGNLDASPDKSYDLNFTL 239

>TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6.26
           YOL001W
          Length = 268

 Score =  260 bits (665), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 133/233 (57%), Positives = 169/233 (72%), Gaps = 10/233 (4%)

Query: 28  DEISTIYLPRKFSKCSRTDLAVLISRMLTFLIQINDSLAL-SKPENAR----GLTRFHSR 82
           +E   + L + F KCS+ DL  LISRML+F I INDS  +     N R     LTRFHS+
Sbjct: 7   EEAQLVVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTNNRLSPLFLTRFHSK 66

Query: 83  VPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLTVHRFLLTATTVA 142
           VPP IS+++YLIRLTKYSSLE  VL+T+VYYIDLLS+VYP F+L+SLTVHR+LLTATT+A
Sbjct: 67  VPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLTATTIA 126

Query: 143 SKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRILPRDDNIDWCKLETKLQKFT 202
           SKGLCDSFCTN+HYAKVGG+  +ELN+LE EFL+RV YR++PRD+ I  CKLE K     
Sbjct: 127 SKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEYKYSPI- 185

Query: 203 LYEEPEMGQNSRPQNSLKNSGYNVLDAYFRKIVQLVGSYASSPDKSKVVNYVL 255
                ++  +    + L+NSGYNVL  Y+ K+VQLVG+  SS +  + VNY+ 
Sbjct: 186 ----EDINNDIHIPDELQNSGYNVLSTYYNKMVQLVGNCKSSKNSFRNVNYIF 234

>NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26
          Length = 369

 Score =  234 bits (597), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 122/233 (52%), Positives = 160/233 (68%), Gaps = 15/233 (6%)

Query: 21  ESSKEGTDE------ISTIYLPRKFSKCSRTDLAVLISRMLTFLIQIND---SLALSKPE 71
           + SKE T E      I  I +P ++ KCSR+DL VL+SRML  LIQ ND   + + S  +
Sbjct: 11  DGSKESTAESPMTSKIQVIEVPYEYIKCSRSDLVVLVSRMLVLLIQSNDMTSNTSNSSSD 70

Query: 72  NARGLTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLTV 131
           +   LTRFHSR+PP IS++NYL RLTKY  +EHCVLL+ +YYIDL ++ YP FT +SLT 
Sbjct: 71  SNMHLTRFHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTA 130

Query: 132 HRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRILPRDDNIDW 191
           HRFLLTA TVA KGLCDSFCT   YAK+GGV + ELNILE  FL+ VNYRI+PR  N+  
Sbjct: 131 HRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTL 190

Query: 192 CKLETKLQKFTL----YEEPEMGQNSRPQNSLKNSGYNVLDAYFRKIVQLVGS 240
            KLE   Q FTL     ++P++   S   + L ++GY+VL+ Y++ IV++ G+
Sbjct: 191 IKLERGNQVFTLDHLDMKDPKLSFLS--YDYLPDNGYSVLNIYYQNIVRITGA 241

>NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {ON}
           Anc_6.26 YOL001W
          Length = 427

 Score =  224 bits (571), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 119/229 (51%), Positives = 151/229 (65%), Gaps = 4/229 (1%)

Query: 33  IYLPRKFSKCSRTDLAVLISRMLTFLIQINDSLALSKPENARGLTRFHSRVPPGISVYNY 92
           I LP KF +C R DL VLISRML  LI+IND+ A      +   TRFHSRV PGIS+ NY
Sbjct: 57  ITLPIKFMECPRRDLVVLISRMLVTLIKINDTKANDNNLPSNYATRFHSRVIPGISIGNY 116

Query: 93  LIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLTVHRFLLTATTVASKGLCDSFCT 152
           L+RLTK+  L+  VLLTAVYYIDLLS+V+P F+ +SLT HRF+LTA  VASK LCDS  +
Sbjct: 117 LLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIVASKSLCDSCLS 176

Query: 153 NTHYAKVGGVHSSELNILECEFLKRVNYRILPRDDNIDWCKLETKLQKFTLYE-EPEMGQ 211
            THYAK GGV  +EL +LE  FLK + YR+LPRD N D C +E     F L + + +   
Sbjct: 177 ITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHFDTFALNDGQIKESG 236

Query: 212 NSRPQNSLKNSGYNVLDAYFRKIVQLVG---SYASSPDKSKVVNYVLRP 257
            S     L +SGYNVL  Y+R+I+ ++G     + SPD   V  +++RP
Sbjct: 237 TSFSYRQLPHSGYNVLHMYYRRIIDIIGVQRPISPSPDAVTVDYFLMRP 285

>Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 79.3 bits (194), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 81/157 (51%), Gaps = 19/157 (12%)

Query: 46  DLAVLISRMLTFLIQINDS---LALSKPENARG-----LTRFHSRVPPGISVYNYLIRLT 97
           +L +++S +L  +I +ND+   ++   P +        +  F+ +  P I V  YL R+ 
Sbjct: 109 ELIIMVSALLNKIITVNDATTDISQQVPGDTEEKFLTPILAFYGKNVPEIDVVQYLERIQ 168

Query: 98  KYSSLEHCVLLTAVYYIDLLSSVY-----------PVFTLSSLTVHRFLLTATTVASKGL 146
           KY    + + L+ + Y D +S  Y            +F + S  +HR L+T  T+ +K L
Sbjct: 169 KYCPTTNDIFLSLLVYFDRISKNYGHSPEENGHSKQLFVMDSGNIHRLLITGITICTKFL 228

Query: 147 CDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRIL 183
            D F +N+ YAKVGG+   ELN LE +FL   ++++L
Sbjct: 229 SDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 265

>Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 79.3 bits (194), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 52/160 (32%), Positives = 80/160 (50%), Gaps = 19/160 (11%)

Query: 43  SRTDLAVLISRMLTFLIQINDSLA-----LSKPENARGLT---RFHSRVPPGISVYNYLI 94
           S  +L  +IS +L  ++  ND  A     +SK      L     F+ +  P ISV  YL 
Sbjct: 106 STDELIQMISALLNRIVTANDEYAEISQQVSKDNQDELLAPILAFYGKSVPEISVVQYLE 165

Query: 95  RLTKYSSLEHCVLLTAVYYIDLLSSVY-----------PVFTLSSLTVHRFLLTATTVAS 143
           R+ KY    + + L+ + Y D +S  Y            +F + S  +HR L+T  T+ +
Sbjct: 166 RIQKYCPTTNDIFLSLLVYFDRISKKYGHFSDRNAHTKQMFGMDSGNIHRLLITGITICT 225

Query: 144 KGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRIL 183
           K L D F +N+ YAKVGG+   ELN LE +FL   ++++L
Sbjct: 226 KFLSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 265

>YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p
           cyclin of the Pho80p subfamily, forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p; involved in glycogen
           metabolism, expression is cell-cycle regulated
          Length = 285

 Score = 77.8 bits (190), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 80/157 (50%), Gaps = 19/157 (12%)

Query: 46  DLAVLISRMLTFLIQIND-----SLALSKPENARGLT---RFHSRVPPGISVYNYLIRLT 97
           +L ++IS +L  +I  ND     S  +S       LT    F+ +  P I+V  YL R+ 
Sbjct: 109 ELILMISALLNRIITANDETTDVSQQVSDETEDELLTPILAFYGKNVPEIAVVQYLERIQ 168

Query: 98  KYSSLEHCVLLTAVYYIDLLSSVY-----------PVFTLSSLTVHRFLLTATTVASKGL 146
           KY    + + L+ + Y D +S  Y            +F + S  +HR L+T  T+ +K L
Sbjct: 169 KYCPTTNDIFLSLLVYFDRISKNYGHSSERNGCAKQLFVMDSGNIHRLLITGVTICTKFL 228

Query: 147 CDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRIL 183
            D F +N+ YAKVGG+   ELN LE +FL   ++++L
Sbjct: 229 SDFFYSNSRYAKVGGISLQELNHLELQFLILCDFKLL 265

>Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W
           (REAL)
          Length = 286

 Score = 77.0 bits (188), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 80/157 (50%), Gaps = 19/157 (12%)

Query: 46  DLAVLISRMLTFLIQINDS--------LALSKPENARGLTRFHSRVPPGISVYNYLIRLT 97
           +L +++S +L  +++ ND         +   + E    +  F+ +  P I+V  YL R+ 
Sbjct: 110 ELILMVSALLNKIVKANDETTDPSQQVVEDGEDELLAPVLAFYGKNVPEIAVVQYLERIQ 169

Query: 98  KYSSLEHCVLLTAVYYIDLLSSVY-----------PVFTLSSLTVHRFLLTATTVASKGL 146
           KY    + + L+ + Y D +S  Y            +F + S  +HR L+T  T+ +K +
Sbjct: 170 KYCPTTNDIFLSLLVYFDRISKNYGSSPDRNGHVRQIFVMDSGNIHRLLITGITICTKFM 229

Query: 147 CDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRIL 183
            D F +N+ YAKVGG+   ELN LE +FL   ++++L
Sbjct: 230 SDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 266

>KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.240
           YIL050W
          Length = 438

 Score = 73.9 bits (180), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 78/169 (46%), Gaps = 31/169 (18%)

Query: 46  DLAVLISRMLTFLIQINDSLALSKP-----------ENARGLTRFHSRVPPGISVYNYLI 94
           D+  +++ +L  ++  ND L    P           +    +T F+ +  P I++  YL+
Sbjct: 242 DILQMLTALLDKIVSSNDELNNGGPPAGCEDKQQDHDTINAITSFYGKHVPQITIEQYLL 301

Query: 95  RLTKYSSLEHCVLLTAVYYIDLLSSVYPV--------------------FTLSSLTVHRF 134
           R+ KY    + + L+ + + D +S  + +                    F + S  +HR 
Sbjct: 302 RIQKYCPTTNDIFLSLLVFFDRISKKFNIHQQKQQSNVSDSDEQAPHQTFVMDSYNIHRL 361

Query: 135 LLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRIL 183
           L+   TV++K   D F +N  YA+VGG+   E+N LE +FL   ++++L
Sbjct: 362 LIAGVTVSTKFFSDFFYSNARYARVGGISLQEMNHLELQFLILCDFKLL 410

>Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL050W
           (PCL7) - PHO85 cyclin [contig 11] FULL
          Length = 465

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 65/121 (53%), Gaps = 5/121 (4%)

Query: 68  SKPENARGLTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSV-----YP 122
           ++P  A  +  F  +  P I++  Y  R+ KY    + V L+ + Y D ++         
Sbjct: 313 TRPNIASEILSFRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHGKEQ 372

Query: 123 VFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRI 182
           +F + S  +HR +++A TV++K   D F +N+ YA+VGG+   ELN LE +FL   ++ +
Sbjct: 373 LFVMDSYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFEL 432

Query: 183 L 183
           +
Sbjct: 433 I 433

>KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.240
           YIL050W
          Length = 325

 Score = 70.5 bits (171), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 71/146 (48%), Gaps = 11/146 (7%)

Query: 73  ARGLTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSS----------VYP 122
           A  L  FH +  P I++  Y  R+ KY    + V L  +   D ++              
Sbjct: 175 ANSLLCFHGKHVPDITIEKYFNRIQKYCPTTNDVFLLLLIAFDRIAKRCNTDSFGNKSQQ 234

Query: 123 VFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYR- 181
           +F + S  +HRF++   TV +K L D F +N+ YAKVGG+   E+N LE +FL   +++ 
Sbjct: 235 LFVMDSYNIHRFIIAGVTVCTKFLSDFFYSNSRYAKVGGISVHEMNNLELQFLVLCDFKL 294

Query: 182 ILPRDDNIDWCKLETKLQKFTLYEEP 207
           I+P  +   +  L  K  + T++  P
Sbjct: 295 IVPIYEFQRYADLLKKFWEHTMHASP 320

>KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 580

 Score = 70.9 bits (172), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 61/110 (55%), Gaps = 5/110 (4%)

Query: 79  FHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSV-----YPVFTLSSLTVHR 133
           F  +  P I+++ Y  R+ KY    + V L+ + Y D ++         +F + S  +HR
Sbjct: 435 FRGKHVPAITLHQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHAKEQLFVMDSYNIHR 494

Query: 134 FLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRIL 183
            +++A TV++K   D F +N+ YA+VGG+   ELN LE +FL   ++ ++
Sbjct: 495 LIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELI 544

>KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {ON}
           similar to uniprot|P40186 Saccharomyces cerevisiae
           YIL050W PCL7 Pho85p cyclin of the Pho80p subfamily forms
           a functional kinase complex with Pho85p which
           phosphorylates Mmr1p and is regulated by Pho81p involved
           in glycogen metabolism expression is cell-cycle
           regulated and weakly similar to YER059W uniprot|P40038
           Saccharomyces cerevisiae YER059W PCL6 Pho85p cyclin of
           the Pho80p subfamily forms the major Glc8p kinase
           together with Pcl7p and Pho85p involved in the control
           of glycogen storage by Pho85p stabilized by Elongin C
           binding
          Length = 409

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 83/171 (48%), Gaps = 37/171 (21%)

Query: 50  LISRMLTFLIQINDSLA------LSKPEN---ARGLTRFHSRVPPGISVYNYLIRLTKYS 100
           +++ +LT +I+ NDSL        S+ +N    R +  F  +  PGI++  Y  R+ KY 
Sbjct: 202 MLTGLLTKIIKSNDSLGSTPNFETSQGKNIPLMREILSFRGKQVPGITLKQYFQRIQKYC 261

Query: 101 SLEHCVLLTAVYYIDLLS----------------------------SVYPVFTLSSLTVH 132
              + VLL+ + + D ++                            S   +F + S  +H
Sbjct: 262 PTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVSTPDKTTASLAHQSSPQLFVMDSHNIH 321

Query: 133 RFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRIL 183
           R ++ A TV++K + D F +N+ YA+VGG+   ELN LE +FL   ++R++
Sbjct: 322 RLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHLELQFLILCDFRLI 372

>TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {ON}
           Anc_7.240 YIL050W
          Length = 385

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 85/194 (43%), Gaps = 46/194 (23%)

Query: 36  PRKFSKCSRTDLAVLISRMLTFLIQINDSLALSKPENA----------RGLTRFHSRVPP 85
           P   ++     L  ++S +L  ++  ND L ++  +N           + ++ F  +  P
Sbjct: 155 PENIAEFQTDKLLDMLSTLLDKIVLSNDRLHINTMDNTIDEHIDSTIIKPVSCFRGKHVP 214

Query: 86  GISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSS-------------------------- 119
            IS+  Y  R+ KY  + + V L+ + Y D +S                           
Sbjct: 215 QISLEQYFQRIQKYCPITNDVFLSLLVYFDRISKKCNNINLEKENVISNDADESQNNVKQ 274

Query: 120 ---------VYP-VFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNI 169
                    V P VF + S  +HR ++TA TV++K   D F +N+ YA+VGG+   ELN 
Sbjct: 275 MKDENNSSIVKPQVFVMDSFNIHRLIITAVTVSTKFFSDLFYSNSRYARVGGISLQELNH 334

Query: 170 LECEFLKRVNYRIL 183
           LE +FL   +++++
Sbjct: 335 LELQFLILCDFQLM 348

>CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa]
           {ON} weakly similar to uniprot|P40038 Saccharomyces
           cerevisiae YER059w PCL6 cyclin like protein interacting
           with PHO85P
          Length = 457

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 61/124 (49%), Gaps = 14/124 (11%)

Query: 74  RGLTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSS-------------- 119
           + +  F  +  P I++Y Y  R+ KY    + V L+ + Y D +S               
Sbjct: 300 KSILSFKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESADTSP 359

Query: 120 VYPVFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVN 179
              +F + S  +HR ++   TV +K   D F +N+ YA+VGG+  SELN LE +FL   +
Sbjct: 360 ADQLFVMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVLCD 419

Query: 180 YRIL 183
           + +L
Sbjct: 420 FELL 423

>Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}
           similar to Ashbya gossypii ADL075W
          Length = 385

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 12/140 (8%)

Query: 47  LAVLISRMLTFLIQINDSLALSKPE----NARGLTR---FHSRVPPGISVYNYLIRLTKY 99
           L  +++ +L  +I+ ND L   + E    N++ +     F  +  P I++ +Y  R+ KY
Sbjct: 195 LLEMLTSLLYKIIKSNDRLKSFEQEKHDINSKYVAHVLSFRGKHIPAITLGDYFARIQKY 254

Query: 100 SSLEHCVLLTAVYYIDLLS----SVYP-VFTLSSLTVHRFLLTATTVASKGLCDSFCTNT 154
             + + V L+ + Y D ++    ++ P +F + S  +HR ++ A TV++K   D F +N+
Sbjct: 255 CPITNDVFLSLLVYFDRIAKRCNAMDPQLFVMDSYNIHRLIIAAVTVSTKFFSDFFYSNS 314

Query: 155 HYAKVGGVHSSELNILECEF 174
            YA+VGG+   ELN LE +F
Sbjct: 315 RYARVGGISLHELNRLELQF 334

>SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 474

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 75/153 (49%), Gaps = 16/153 (10%)

Query: 47  LAVLISRMLTFLIQINDSLALSKPENA------RGLTRFHSRVPPGISVYNYLIRLTKYS 100
           L  +++ +L  +++ ND L  +  + +        +  F  +  P IS+  Y  R+ KY 
Sbjct: 299 LLNMLTSLLNKIVKSNDQLRNTNVQESAFNDYTSQVLSFRGKHVPAISLDQYFQRIQKYC 358

Query: 101 SLEHCVLLTAVYYIDLLS----------SVYPVFTLSSLTVHRFLLTATTVASKGLCDSF 150
              + V L+ + Y D ++              +F + S  +HR ++ A TV++K   D F
Sbjct: 359 PTTNDVFLSLLVYFDRIAKRCNINEEGEDGQQLFVMDSYNIHRLIIAAVTVSTKFFSDFF 418

Query: 151 CTNTHYAKVGGVHSSELNILECEFLKRVNYRIL 183
            +N+ YA+VGG+   ELN LE +FL   ++ ++
Sbjct: 419 YSNSRYARVGGISLQELNRLELQFLILCDFELI 451

>NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.240
           YER059W
          Length = 503

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 88/189 (46%), Gaps = 33/189 (17%)

Query: 28  DEISTIYLPRKF--SKCSRTDLAVLISRMLTFLIQINDSLALSKPENA------------ 73
           +E+++ ++P  F  ++ S  +L  +++ +L  +++ ND L  S+   +            
Sbjct: 282 NEVNSYHMPDSFNIAEFSTDNLLEMLTALLDKIVKSNDKLNTSQSPTSPPPLNSNSENNN 341

Query: 74  -----RGLTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLS---------- 118
                  +  F  +  P I+++ Y  R+ KY    + V L+ + Y D +S          
Sbjct: 342 KNAYYNSILAFKGKHVPQITLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSTPTTN 401

Query: 119 ----SVYPVFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEF 174
               +   +F + S  +HR ++   TV +K   D F +N+ YA+VGG+   ELN LE +F
Sbjct: 402 SINDNNSQMFVMDSYNIHRLIIAGITVCTKFFSDFFYSNSRYARVGGISLQELNHLELQF 461

Query: 175 LKRVNYRIL 183
           L   ++ ++
Sbjct: 462 LILCDFELM 470

>NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa]
           {ON} Anc_7.240
          Length = 448

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 59/120 (49%), Gaps = 15/120 (12%)

Query: 79  FHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLS---------------SVYPV 123
           F  +  P IS++ Y  R+ KY    + V L+ + Y D +S               +   +
Sbjct: 283 FRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQL 342

Query: 124 FTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRIL 183
           F + S  +HR ++   TV +K   D F +N+ YA+VGGV   ELN LE +FL   ++ ++
Sbjct: 343 FVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELM 402

>NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {ON}
           Anc_7.240
          Length = 341

 Score = 67.4 bits (163), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 52/187 (27%), Positives = 80/187 (42%), Gaps = 42/187 (22%)

Query: 39  FSKCSRTDLAVLISRMLTFLIQINDSLA---------LSKPENA------RGLTRFHSRV 83
            +K S   L  +IS +L  LI+ ND L           +  +N+      R +  F  + 
Sbjct: 129 ITKLSTKKLIKMISTILEKLIKSNDELRERNETSLNDRTDDDNSDESKLVRSIKSFRGKH 188

Query: 84  PPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVY---------------------- 121
            P I +  Y  R+ KY    + VLL  + Y D +S V                       
Sbjct: 189 IPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTHHHLLRNY 248

Query: 122 -----PVFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLK 176
                  F L S  +HR +++A TV++K   D F +N+ YAKVGG+   E+N LE +FL 
Sbjct: 249 DCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLELQFLL 308

Query: 177 RVNYRIL 183
             N+ ++
Sbjct: 309 ISNFDLI 315

>KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.240
           YIL050W
          Length = 313

 Score = 67.0 bits (162), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 84/183 (45%), Gaps = 27/183 (14%)

Query: 28  DEISTIYLPRKFSKCSRTDLAVLISRMLTFLIQINDSLALSKPENAR------------- 74
           DEI  ++ P K +      L  +++ +L  +IQ ND++    P                 
Sbjct: 109 DEIFEVFNPDKIASLPMNKLLEMLTTLLETIIQSNDNINNVHPLKMNEIPKILEHDSTGC 168

Query: 75  --GLTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLL----SSVY------- 121
              +  F  +  P I++  Y  R+ KY    + V L+ + Y D +    +S +       
Sbjct: 169 LNAMLSFKGKHIPQINLEQYFKRIQKYCPTTNDVFLSLLIYFDRIFNKCNSKFDNYGHDN 228

Query: 122 -PVFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNY 180
             +F + S  +HR ++   TV++K L D F +N+ YAKVGG+   ELN LE +FL   ++
Sbjct: 229 PQIFVMDSYNIHRLIIAGVTVSTKFLSDFFYSNSRYAKVGGISLKELNYLELQFLILCDF 288

Query: 181 RIL 183
            +L
Sbjct: 289 NLL 291

>ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL050W (PCL7) and
           YER059W (PCL6)
          Length = 207

 Score = 64.7 bits (156), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 59/101 (58%), Gaps = 5/101 (4%)

Query: 79  FHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLS----SVYP-VFTLSSLTVHR 133
           F  +  P I++ +Y  R+ KY  + + V L+ + Y D ++    ++ P +F + S  +HR
Sbjct: 65  FRGKHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYNIHR 124

Query: 134 FLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEF 174
            ++ A TV++K   D F +N+ YA+VGG+   ELN LE +F
Sbjct: 125 LIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQF 165

>TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {ON}
           Anc_7.240 YIL050W
          Length = 363

 Score = 61.2 bits (147), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 75/181 (41%), Gaps = 44/181 (24%)

Query: 47  LAVLISRMLTFLIQINDSLALSKP--ENARGLTR-----------FHSRVPPGISVYNYL 93
           L  +++ +L  +I+ ND LA S P     R L             F  +  P IS+ +Y 
Sbjct: 151 LLEMLTALLDKIIKSNDRLASSNPTLNQERELMNNNNVYLNSVLSFRGKHIPQISLEHYF 210

Query: 94  IRLTKYSSLEHCVLLTAVYYIDLLS-------------------------------SVYP 122
            R+ KY    + V L+ + Y D +S                                   
Sbjct: 211 QRIQKYCPTTNDVFLSLLVYFDRISKRCNSNNNDTTNDNDLQYDMPAKQQQQTQQTQQQQ 270

Query: 123 VFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRI 182
            F + S  +HR L+   TV++K   D F +N+ YA+VGG+   ELN LE +FL   ++ +
Sbjct: 271 AFVMDSHNIHRLLIAGVTVSTKFFSDFFYSNSRYARVGGISLQELNHLELQFLVLCDFEL 330

Query: 183 L 183
           L
Sbjct: 331 L 331

>KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7.240
           YIL050W
          Length = 354

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 77/171 (45%), Gaps = 34/171 (19%)

Query: 47  LAVLISRMLTFLIQINDSLA-------LSKPENAR-----------GLTRFHSRVPPGIS 88
           L  +++ +L  ++Q ND L        L   ++AR            +  F  +  P I+
Sbjct: 161 LIKMLTALLDKIVQANDRLETPDSATLLKVNDDARDTDGYYESAVNAILSFKGKHIPQIT 220

Query: 89  VYNYLIRLTKYSSLEHCVLLTAVYYIDLLS---SVYP-------------VFTLSSLTVH 132
           +  Y  R+ KY    + V L+ + Y D +S   +  P             +F ++S  +H
Sbjct: 221 LEQYFHRIQKYCPTTNDVFLSLLIYFDRISEKCNSIPRGGDDDKVQDDTLLFVMNSYNIH 280

Query: 133 RFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRIL 183
           R ++    V++K   D F +N  YAKVGG+   E+N LE +FL   ++ +L
Sbjct: 281 RLIIAGVAVSTKFSSDFFYSNARYAKVGGISLREMNYLELQFLVLCDFSLL 331

>TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa]
           {ON} Anc_7.240 YIL050W
          Length = 661

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 38/61 (62%)

Query: 123 VFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRI 182
           VF + S  +HR ++   TVA+K   D F +N  YAKVGG+   ELN LE +FL   ++++
Sbjct: 577 VFVMDSYNIHRLIIAGVTVATKFFSDYFYSNARYAKVGGITLQELNHLELQFLLLCDFKL 636

Query: 183 L 183
           L
Sbjct: 637 L 637

 Score = 33.5 bits (75), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 21/95 (22%)

Query: 45  TDLAVLISRMLTFLIQINDSLALSKPEN-------ARGLTRFHSRVP------------- 84
           T L  +++ +L  +I+ ND LA  +P+         + LT  +  VP             
Sbjct: 389 TKLLEMLTALLNKIIKSNDCLAGIQPDALTNVNTPPQNLTTNNGEVPNYLSSILSFRGKH 448

Query: 85  -PGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLS 118
            P I+++ Y  R+ KY  + + V L+ + Y D +S
Sbjct: 449 IPQITLFQYFQRIQKYCPISNDVFLSLLVYFDRIS 483

>ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 405

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 62/151 (41%), Gaps = 41/151 (27%)

Query: 74  RGLTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLS--------------- 118
           R +  F  +  P IS+ +Y  R+ KY    + V L+ + Y D +S               
Sbjct: 229 RSVLSFRGKHIPQISLEHYFQRIQKYCPTSNDVFLSLLVYFDRISRKCNSSSRLHHENTS 288

Query: 119 --------------------------SVYPVFTLSSLTVHRFLLTATTVASKGLCDSFCT 152
                                     +    F + S  +HR ++  TTV++K   D F +
Sbjct: 289 ANDAGNNNNGHDNVKQQVHNNQQPIPAPQQQFVMDSHNIHRLIIAGTTVSTKFFSDFFYS 348

Query: 153 NTHYAKVGGVHSSELNILECEFLKRVNYRIL 183
           N+ YA+VGG+   ELN LE +FL   ++ +L
Sbjct: 349 NSRYARVGGISLQELNYLELQFLILCDFELL 379

>Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON}
           (30454..31206) [753 nt, 251 aa]
          Length = 250

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 38/61 (62%)

Query: 123 VFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRI 182
           +F + S  +HR ++   TV++K   D F +N+ YA+VGG+   ELN LE +FL   ++ +
Sbjct: 162 IFVMDSYNIHRLIIAGVTVSTKFFSDLFYSNSRYARVGGISLQELNNLELQFLLMCDFHL 221

Query: 183 L 183
           L
Sbjct: 222 L 222

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 12/81 (14%)

Query: 50  LISRMLTFLIQINDSLALSKPEN------------ARGLTRFHSRVPPGISVYNYLIRLT 97
           +++ +L  +I+ ND LAL  P++            A+ +  F  +  P IS+  Y  R+ 
Sbjct: 1   MLTALLDKIIKSNDRLALMGPDSNNDLLMNKDNSMAQSVLSFRGKHIPQISLEQYFQRIQ 60

Query: 98  KYSSLEHCVLLTAVYYIDLLS 118
           KY  + + V ++ + Y D +S
Sbjct: 61  KYCPITNDVFISLLVYFDRIS 81

>Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W
           (REAL)
          Length = 424

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 39/61 (63%)

Query: 123 VFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRI 182
           +F + S  +HR ++   TV++K L D F +N+ Y++VGG+   ELN LE +FL   ++ +
Sbjct: 333 MFVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFEL 392

Query: 183 L 183
           L
Sbjct: 393 L 393

>Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W
           (REAL)
          Length = 415

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 39/61 (63%)

Query: 123 VFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRI 182
           +F + S  +HR ++   TV++K L D F +N+ Y++VGG+   ELN LE +FL   ++ +
Sbjct: 324 MFVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFEL 383

Query: 183 L 183
           L
Sbjct: 384 L 384

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 39/91 (42%), Gaps = 19/91 (20%)

Query: 47  LAVLISRMLTFLIQINDSLALSKP------ENARGLT-------------RFHSRVPPGI 87
           L  +++ +LT +I+ ND  A + P      EN R LT              F  +  P I
Sbjct: 167 LLKMLTALLTKIIKSNDRTAATNPSLTQEIENGRCLTLTDDEKKYLSPVLGFRGKHVPQI 226

Query: 88  SVYNYLIRLTKYSSLEHCVLLTAVYYIDLLS 118
            +  Y  R+ KY    + V L+ + Y D +S
Sbjct: 227 GLDQYFQRIQKYCPTTNDVFLSLLVYFDRIS 257

>YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p
           cyclin of the Pho80p subfamily; forms the major Glc8p
           kinase together with Pcl7p and Pho85p; involved in the
           control of glycogen storage by Pho85p; stabilized by
           Elongin C binding
          Length = 420

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 39/61 (63%)

Query: 123 VFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRI 182
           +F + S  +HR ++   TV++K L D F +N+ Y++VGG+   ELN LE +FL   ++ +
Sbjct: 329 MFVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFEL 388

Query: 183 L 183
           L
Sbjct: 389 L 389

>Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W
           (REAL)
          Length = 420

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 39/61 (63%)

Query: 123 VFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRI 182
           +F + S  +HR ++   TV++K L D F +N+ Y++VGG+   ELN LE +FL   ++ +
Sbjct: 329 MFVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFEL 388

Query: 183 L 183
           L
Sbjct: 389 L 389

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 39/91 (42%), Gaps = 19/91 (20%)

Query: 47  LAVLISRMLTFLIQINDSLALSKP------ENARGLT-------------RFHSRVPPGI 87
           L  +++ +LT +I+ ND  A + P      EN + LT              F  +  P I
Sbjct: 172 LLKMLTALLTKIIKSNDRTAATNPSLTQEIENGKCLTLTDSERKYLSPVLGFRGKHVPQI 231

Query: 88  SVYNYLIRLTKYSSLEHCVLLTAVYYIDLLS 118
            +  Y  R+ KY    + V L+ + Y D +S
Sbjct: 232 GLDQYFQRIQKYCPTTNDVFLSLLVYFDRIS 262

>Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON}
           (24019..24951) [933 nt, 311 aa]
          Length = 310

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 72/143 (50%), Gaps = 14/143 (9%)

Query: 54  MLTFLIQINDSLALSKPENARGLTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYY 113
           M+ FL    DS+   KP +          +P   S++ ++  L K+S+++   L+ +  Y
Sbjct: 19  MICFLASTTDSIIQLKPSSNEA------NIP---SIFEFIKGLIKHSNVQTSTLMASTVY 69

Query: 114 IDLLSSVYP--VFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKV--GGVHSSELNI 169
           +  L S+ P  V+ + S T HR  L    +A+K L DS   N H+ K   G ++ +++N 
Sbjct: 70  LTKLRSILPANVYGIES-TKHRIFLGCLILAAKSLNDSSPLNKHWTKYTNGLLNLADVNT 128

Query: 170 LECEFLKRVNYRILPRDDNIDWC 192
           +E E L  +N+  + + +++  C
Sbjct: 129 IERELLAYLNWDTIIKQEDLIGC 151

>TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa]
           {ON} Anc_7.289 YDL179W
          Length = 368

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 78/174 (44%), Gaps = 20/174 (11%)

Query: 54  MLTFLIQINDSLALSKPENARGLTRFH-SRVPPGISVYNYLIRLTKYSSLEHCVLLTAVY 112
           M+ FL     S    +P +   LT    S +PP   +Y ++  L  +S+++   L+T V 
Sbjct: 20  MIQFLSNCAASAIQIRPTSDSNLTNESISNIPP---LYTFIKNLVAHSNVQTPTLMTTVV 76

Query: 113 YIDLLSSVYP--VFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKV--GGVHSSELN 168
           Y+  L ++ P  V+ + + T HR  L    +A+K L DS   N H+AK   G +   E+N
Sbjct: 77  YLKKLKAIIPSNVYGIET-TRHRMFLGCLIIAAKTLNDSSPLNKHWAKYTNGLLQLREVN 135

Query: 169 ILECEFLKRVNYRILPRDDNIDWC-----------KLETKLQKFTLYEEPEMGQ 211
            +E E L    + +    +++  C           +   K Q F L+  P  GQ
Sbjct: 136 TIEREILTYFKWDLQITVNDLLTCLAPFIKQVKDDEKRQKNQNFLLFNSPTPGQ 189

>NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7.240
           YER059W
          Length = 303

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%)

Query: 126 LSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRI 182
           ++S TVHR +L   TV+SK L D   +N  YA+  G+   ELN LE +FL+  N+ +
Sbjct: 227 VNSCTVHRLILAGITVSSKFLSDFTYSNKRYAQASGLTLEELNYLEFQFLRLTNFNL 283

>Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 59/104 (56%), Gaps = 8/104 (7%)

Query: 81  SRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFTLSSLTVHRFLLTA 138
           +R+P   S+  ++ RL +Y+++    LLTAV Y++ L  + P     L S T+HR  L  
Sbjct: 50  ARLP---SLMTFITRLVRYTNVYTPTLLTAVCYLNKLKRILPKDATGLPS-TIHRIFLAC 105

Query: 139 TTVASKGLCDSFCTNTHYAK-VGGVHSSE-LNILECEFLKRVNY 180
             +++K   DS   N H+AK   G+ + E +N++E + L+ +N+
Sbjct: 106 LILSAKFHNDSSPLNKHWAKYTDGLFTLEDINLMERQLLQLLNW 149

>NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {ON}
           Anc_7.289
          Length = 312

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 69/143 (48%), Gaps = 9/143 (6%)

Query: 54  MLTFLIQINDSLALSKPENARGLTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYY 113
           M+ FL     S+   KP +       H  + P +S  N++  L K+S+++   L+    Y
Sbjct: 19  MIQFLASTTASIIQVKPHSEPKTNTAH--IIPTLS--NFIKALIKHSNVQTPTLMATTVY 74

Query: 114 IDLLSSVYP--VFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKV--GGVHSSELNI 169
           +  L S+ P  V+ + + T HR  L    +A+K L DS   N H+A+   G +   E+N 
Sbjct: 75  LSKLKSIIPCNVYGIET-TRHRIFLGCLILAAKTLNDSSPMNKHWAQYTDGLLQIREVNT 133

Query: 170 LECEFLKRVNYRILPRDDNIDWC 192
           +E E L+  ++ +  +  ++  C
Sbjct: 134 IERELLEYFDWDVTIKTKDLIIC 156

>ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {ON}
           some similarities with uniprot|P25693 Saccharomyces
           cerevisiae YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 54/112 (48%), Gaps = 5/112 (4%)

Query: 85  PGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFTLSSLTVHRFLLTATTVA 142
           P   +  ++  L  YS+++   L+    Y+  L S+ P  VF + + T HR  L    +A
Sbjct: 43  PAPPLMRFIKTLISYSNVQTPTLMATTVYLTKLRSIIPANVFGIET-TRHRIFLGCLILA 101

Query: 143 SKGLCDSFCTNTHYAKV--GGVHSSELNILECEFLKRVNYRILPRDDNIDWC 192
           +K L DS   N H+A    G +H  E+N +E E L+  ++ +    + +  C
Sbjct: 102 AKTLNDSSPLNKHWASYTDGLLHIREVNTIERELLEYFDWNVCITTEELVAC 153

>TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.289
           YDL179W
          Length = 309

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 64/141 (45%), Gaps = 16/141 (11%)

Query: 85  PGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFTLSSLTVHRFLLTATTVA 142
           P  S+ N++  L  +S+++   L+    Y+  L S+ P  V+ + + T HR  L    +A
Sbjct: 45  PAPSLTNFIKGLVLHSNVQTPTLMATAVYLAKLRSIIPGNVYGIET-TRHRIFLGCLILA 103

Query: 143 SKGLCDSFCTNTHYAKV--GGVHSSELNILECEFLKRVNYRILPRDDNIDWCK------- 193
           +K L DS   N H+A    G +H  E+N +E E L+  ++ +     ++  C        
Sbjct: 104 AKTLNDSSPLNKHWALYTDGLLHIHEVNTIERELLEYFDWNVTVTTKDLITCLAPFLQPI 163

Query: 194 ----LETKLQKFTLYEEPEMG 210
               +  K Q + L+  P  G
Sbjct: 164 KEQFIRQKQQNYLLFNAPMQG 184

>CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} similar
           to uniprot|P25693 Saccharomyces cerevisiae YDL127w PCL2
           and similar to uniprot|Q12477 Saccharomyces cerevisiae
           YDL179w PCL9
          Length = 297

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 52/95 (54%), Gaps = 5/95 (5%)

Query: 92  YLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFTLSSLTVHRFLLTATTVASKGLCDS 149
           ++ +L KYS+++   L+    ++  L S+ P  V+ + + T HR  L    +++K L DS
Sbjct: 52  FIKKLVKYSNVQTPTLMATTVFLTKLRSIIPANVYGIET-TRHRIFLGCLILSAKTLNDS 110

Query: 150 FCTNTHYAKV--GGVHSSELNILECEFLKRVNYRI 182
              N H+A+   G +H  E+N +E E L+  ++ +
Sbjct: 111 SPLNKHWAQYTDGLLHLKEVNTIERELLEYFDWNL 145

>Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {ON}
           YDL127W (PCL2) - G1 cyclin [contig 12] FULL
          Length = 304

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 60/138 (43%), Gaps = 13/138 (9%)

Query: 87  ISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLS-SLTVHRFLLTATTVASKG 145
           +S+ N++  L   S+++   L++   Y+  L S+ P   L    T HR  L    +A+K 
Sbjct: 45  VSLENFIKGLVVQSNVQTPTLMSTAVYLAKLRSIIPANVLGIETTRHRMFLGCLIIAAKN 104

Query: 146 LCDSFCTNTHYAKV--GGVHSSELNILECEFLKRVNYRILPRDDNIDWC----------K 193
           L DS   N H+A    G + + E+N +E E L+  ++ +      +  C          +
Sbjct: 105 LNDSSPMNKHWASYTNGLLDTREVNTIERELLEYFDWNLQFSTQELAICLAPFLAPIKDQ 164

Query: 194 LETKLQKFTLYEEPEMGQ 211
           L  K Q+      P  GQ
Sbjct: 165 LLAKKQELLFLHSPLAGQ 182

>KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70
           YNL289W
          Length = 262

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 61/117 (52%), Gaps = 8/117 (6%)

Query: 68  SKPENARGLTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFT 125
           S P +   L+    R+P   S+  ++ +L +Y+++    LLT V Y++ L  + P     
Sbjct: 42  SPPSSPTELSGKEPRLP---SLRTFITKLVRYTNVYTPTLLTTVCYLNKLKRILPKDAKG 98

Query: 126 LSSLTVHRFLLTATTVASKGLCDSFCTNTHYAK-VGGVHSSE-LNILECEFLKRVNY 180
           L S T+HR  L    +++K   DS   N H+AK   G+ S E +N++E + L  +N+
Sbjct: 99  LPS-TIHRLFLACLILSAKYHNDSSPLNKHWAKYTDGLFSLEDINLMERQLLNLLNW 154

>Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 59/106 (55%), Gaps = 8/106 (7%)

Query: 81  SRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFTLSSLTVHRFLLTA 138
           +R+P   S+  ++ RL +Y+++    LLTA  Y++ L  + P     L S T+HR  L  
Sbjct: 50  ARLP---SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPKDATGLPS-TIHRIFLAC 105

Query: 139 TTVASKGLCDSFCTNTHYAK-VGGVHSSE-LNILECEFLKRVNYRI 182
             +++K   DS   N H+A+   G+ + E +N++E + L+ +N+ +
Sbjct: 106 LILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNWDL 151

>YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 279

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 58/104 (55%), Gaps = 8/104 (7%)

Query: 81  SRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFTLSSLTVHRFLLTA 138
           +R+P   S+  ++ RL +Y+++    LLTA  Y++ L  + P     L S T+HR  L  
Sbjct: 50  TRLP---SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPRDATGLPS-TIHRIFLAC 105

Query: 139 TTVASKGLCDSFCTNTHYAK-VGGVHSSE-LNILECEFLKRVNY 180
             +++K   DS   N H+A+   G+ + E +N++E + L+ +N+
Sbjct: 106 LILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 58/104 (55%), Gaps = 8/104 (7%)

Query: 81  SRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFTLSSLTVHRFLLTA 138
           +R+P   S+  ++ RL +Y+++    LLTA  Y++ L  + P     L S T+HR  L  
Sbjct: 50  ARLP---SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPKDATGLPS-TIHRIFLAC 105

Query: 139 TTVASKGLCDSFCTNTHYAK-VGGVHSSE-LNILECEFLKRVNY 180
             +++K   DS   N H+A+   G+ + E +N++E + L+ +N+
Sbjct: 106 LILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar to
           uniprot|P24867 Saccharomyces cerevisiae YNL289w PCL1
           cyclin
          Length = 266

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 58/106 (54%), Gaps = 5/106 (4%)

Query: 88  SVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFTLSSLTVHRFLLTATTVASKG 145
           S+  ++ RL +Y+++    LL  V Y++ L  + P     L S T+HR  L    ++SK 
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLATVCYLNKLKRILPKDATGLPS-TIHRLFLACLILSSKC 112

Query: 146 LCDSFCTNTHYAK-VGGVHSSE-LNILECEFLKRVNYRILPRDDNI 189
             DS   N H+A+   G+ S E +N++E + L+ +N+ I   +D++
Sbjct: 113 HNDSSPKNVHWARYTDGLFSLEDINLMERQLLQLLNWDINVSEDDL 158

>YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 308

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 5/112 (4%)

Query: 85  PGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFTLSSLTVHRFLLTATTVA 142
           P   +  ++ RL K+S+++   L+    Y+  L S+ P  V+ + + T HR  L    +A
Sbjct: 45  PAPPLTKFINRLIKHSNVQTPTLMATSVYLAKLRSIIPSNVYGIET-TRHRIFLGCLILA 103

Query: 143 SKGLCDSFCTNTHYAKV--GGVHSSELNILECEFLKRVNYRILPRDDNIDWC 192
           +K L DS   N H+A+   G +   E+N +E E L+  ++ +    D++  C
Sbjct: 104 AKTLNDSSPLNKHWAEYTDGLLILREVNTIERELLEYFDWDVTISTDDLITC 155

>YPL219W Chr16 (136750..138228) [1479 bp, 492 aa] {ON}  PCL8Cyclin,
           interacts with Pho85p cyclin-dependent kinase (Cdk) to
           phosphorylate and regulate glycogen synthase, also
           activates Pho85p for Glc8p phosphorylation
          Length = 492

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 60/141 (42%), Gaps = 12/141 (8%)

Query: 51  ISRMLTFLIQIND---SLALSKPENARGLTRFHSRVPPGISVYNYLIRLTKYSSLEHCVL 107
           I  +L    +IND   +LA+S  E+ +    F  + PP +S  +++ R+         V 
Sbjct: 326 IELILQLSKKINDNANTLAISS-EDPQKFVNFVMKNPPSLSFRDFIDRIQNKCMFGAVVY 384

Query: 108 LTAVYYIDLL--------SSVYPVFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKV 159
           L A Y + L+          +     L     HR +++   +A+K L D   +  +  KV
Sbjct: 385 LGATYLLQLVFLTRDEMDGPIKLKAKLQEDQAHRIIISTIRIATKLLEDFVHSQNYICKV 444

Query: 160 GGVHSSELNILECEFLKRVNY 180
            G+    L  LE  F+  VN+
Sbjct: 445 FGISKRLLTKLEISFMASVNF 465

>SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 335

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 62/119 (52%), Gaps = 10/119 (8%)

Query: 87  ISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFTLSSLTVHRFLLTATTVASK 144
           +S+ +++  L  +S+++   L++ V Y+  L S+ P  V+ + + T HR  L    +A+K
Sbjct: 42  VSLVDFIKGLITHSNVQTPTLMSTVVYLTRLRSIIPATVYGIET-TRHRIFLGCLILAAK 100

Query: 145 GLCDSFCTNTHYAKV--GGVHSSELNILECEFLKRVNYRILPRDDNIDWCKLETKLQKF 201
            L DS   N H+++   G +   E+N +E E L+  ++++      ID   L T L  F
Sbjct: 101 NLNDSSPLNKHWSRYTNGLLDIREVNTIERELLEYFDWKL-----RIDTQDLITCLSSF 154

>TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70
           YNL289W
          Length = 289

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 61/113 (53%), Gaps = 8/113 (7%)

Query: 81  SRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFTLSSLTVHRFLLTA 138
           S++P   S+  ++ +L +Y+++    LLT   Y+  L  + P     L S T+HR  L  
Sbjct: 53  SKLP---SLKTFITKLVRYTNVYTSTLLTTACYLKKLQRILPKDANGLPS-TIHRIFLAC 108

Query: 139 TTVASKGLCDSFCTNTHYAK-VGGVHSSE-LNILECEFLKRVNYRILPRDDNI 189
             +++K   DS   N H+A+   G+ S E +N++E + L  +N+ I  +++++
Sbjct: 109 LILSAKFHNDSSPLNKHWAEYTDGLFSLEDVNLMEVQLLALLNWDIRIKEEDL 161

>Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W
           (REAL)
          Length = 309

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 55/109 (50%), Gaps = 5/109 (4%)

Query: 85  PGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFTLSSLTVHRFLLTATTVA 142
           P   +  ++ RL K+S+++   L+    Y+  L S+ P  V+ + + T HR  L    +A
Sbjct: 45  PAPPLVKFINRLIKHSNVQTPTLMATSVYLVKLRSIIPSNVYGIET-TRHRIFLGCLILA 103

Query: 143 SKGLCDSFCTNTHYAKV--GGVHSSELNILECEFLKRVNYRILPRDDNI 189
           +K L DS   N H+A+   G +   E+N +E E L   ++ +    D++
Sbjct: 104 AKTLNDSSPLNKHWAEYTDGLLLLREVNTIERELLGYFDWDVTISTDDL 152

>Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON}
           complement(33477..34325) [849 nt, 283 aa]
          Length = 282

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 54/105 (51%), Gaps = 8/105 (7%)

Query: 80  HSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFTLSSLTVHRFLLT 137
             R+P   S+  ++ +L +Y+++    LLT   Y+  L  + P     L S T+HR  L 
Sbjct: 49  QQRLP---SLMTFITKLVRYTNVYTSTLLTTTCYLKKLQRILPKDATGLPS-TIHRMFLA 104

Query: 138 ATTVASKGLCDSFCTNTHYAK-VGGVHSSE-LNILECEFLKRVNY 180
              +++K   DS   N H+A+   G+ S E +N++E + L  +N+
Sbjct: 105 CLIISAKYHNDSSPLNKHWAEYTDGLFSLEDVNLMEMQLLALLNW 149

>Suva_16.87 Chr16 (146154..147659) [1506 bp, 501 aa] {ON} YPL219W
           (REAL)
          Length = 501

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 52/124 (41%), Gaps = 9/124 (7%)

Query: 65  LALSKPENARGLTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLL------- 117
           LA+S  E+ +    F  + PP +S  +++ R+         V L A Y + L+       
Sbjct: 352 LAIS-AEDPQKFVNFTMKNPPSLSFKDFIDRIQNKCMFGAIVYLGATYLLQLVFLTRDEL 410

Query: 118 -SSVYPVFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLK 176
              +     L     HR +++   +A+K L D   +  +  KV G+    L  LE  FL 
Sbjct: 411 DGPIKLKAKLQEDQTHRIIISTIRIATKLLEDFVHSQNYICKVFGISKRLLTKLEISFLA 470

Query: 177 RVNY 180
            VN+
Sbjct: 471 SVNF 474

>NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289
          Length = 330

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 52/104 (50%), Gaps = 8/104 (7%)

Query: 83  VPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFTLSSLTVHRFLLTATT 140
           +PP   + N++  L  +S+++   L+    Y+  L  + P  V+ + + T HR  L    
Sbjct: 50  IPP---LSNFIKNLVMHSNVQTPTLMATSVYLSKLRLIIPKNVYGMET-TRHRIFLGCLI 105

Query: 141 VASKGLCDSFCTNTHYAKV--GGVHSSELNILECEFLKRVNYRI 182
           +A+K L DS   N H+ K   G +H  E+N +E E L+   + +
Sbjct: 106 LAAKTLNDSSPLNKHWTKYTDGLLHIREVNTIERELLEYFEWNV 149

>Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 57/112 (50%), Gaps = 5/112 (4%)

Query: 85  PGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFTLSSLTVHRFLLTATTVA 142
           P   +  ++ RL K+S+++   L+    Y+  L S+ P  V+ + + T HR  L    +A
Sbjct: 45  PAPPLTEFINRLIKHSNVQTPTLMATSVYLAKLRSLIPSKVYGIET-TRHRIFLGCLILA 103

Query: 143 SKGLCDSFCTNTHYAKV--GGVHSSELNILECEFLKRVNYRILPRDDNIDWC 192
           +K L DS   N H+A+   G +   E+N +E E L+  ++ +    +++  C
Sbjct: 104 AKTLNDSSPLNKHWAEYTDGLLLLREVNTIERELLEYFDWDVTISTEDLITC 155

>TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {ON}
           Anc_7.289 YDL179W
          Length = 247

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 67/143 (46%), Gaps = 17/143 (11%)

Query: 65  LALSKPENARGLTRF----HSRVPPGI---------SVYNYLIRLTKYSSLEHCVLLTAV 111
           L LSK   +R + +F       + P I         S+ +++  + KYS ++   L+ + 
Sbjct: 8   LYLSKQPVSRDMVKFLVSSTEAIIPNIQQSGSLAIPSLTSFICDVVKYSKVKTPTLMAST 67

Query: 112 YYIDLLSSVYPVFTLSSLTV-HRFLLTATTVASKGLCDSFCTNTHYAKV--GGVHSSELN 168
            +++ L  + P +     T  HR  L    +ASK L DS   N H+ K   G +   E+N
Sbjct: 68  VFLNRLRCIIPGYVEGIATATHRLFLGCLILASKTLNDSSPFNKHWEKYCRGLLSLMEIN 127

Query: 169 ILECEFLKRVNYRI-LPRDDNID 190
            +E E L+ +++ + +  +D ID
Sbjct: 128 TIERELLEYMSWNVRISTEDLID 150

>Skud_16.60 Chr16 (110205..111707) [1503 bp, 500 aa] {ON} YPL219W
           (REAL)
          Length = 500

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 54/126 (42%), Gaps = 9/126 (7%)

Query: 63  DSLALSKPENARGLTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLL----- 117
           ++LA+S  E+ +    F  + PP +S  +++ R+         V L A Y + L+     
Sbjct: 349 NTLAVSS-EDPQKFVNFIMKNPPSLSFKDFIDRIQNKCMFGSVVYLGATYLLQLVFLTRD 407

Query: 118 ---SSVYPVFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEF 174
                V     L     HR +++A  + +K L D   +  +  KV G+    L  LE  F
Sbjct: 408 EMNGPVKLKAKLQEDQAHRVIISAIRITTKLLEDFVHSQNYICKVFGISKRLLTKLEISF 467

Query: 175 LKRVNY 180
           +  VN+
Sbjct: 468 MASVNF 473

>Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON}
           (18215..19105) [891 nt, 297 aa]
          Length = 296

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 66/140 (47%), Gaps = 10/140 (7%)

Query: 54  MLTFLIQINDSLALSKPENARGLTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYY 113
           M+ +L  I +S+   +  N+         +PP   +  ++  L   S+++   L+    Y
Sbjct: 19  MIAYLSNITESIIQVRRSNSM----ISIALPPP-PLVKFITNLCLKSNVQTPTLMATTVY 73

Query: 114 IDLLSSVYP--VFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKV--GGVHSSELNI 169
           +  L ++ P  V+ + S T HR  L    +ASK L DS   N H+A+   G +   E+N 
Sbjct: 74  LKKLKNIIPPNVYGIES-TRHRIFLGCLILASKTLNDSSPLNKHWARYTSGILQLREVNT 132

Query: 170 LECEFLKRVNYRILPRDDNI 189
           +E E L+  ++ I    D++
Sbjct: 133 IERELLEYFDWNIQITTDDL 152

>Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 54/107 (50%), Gaps = 7/107 (6%)

Query: 80  HSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFTLSSLTVHRFLLT 137
           H   PP +S++  + ++   S+++   L+    Y++ L S+ P  V+ + + T HR  L 
Sbjct: 41  HGCPPPELSIF--IKKVVVQSNVQTPTLMATTVYLNKLKSIIPKNVYGIET-TRHRIFLG 97

Query: 138 ATTVASKGLCDSFCTNTHYAKV--GGVHSSELNILECEFLKRVNYRI 182
              +A+K L DS   N H+     G +   E+N +E E L+  N+ +
Sbjct: 98  CLILAAKTLNDSSPWNKHWTTYTEGLLKVREVNTIERELLEYFNWDV 144

>YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,
           forms a functional kinase complex with Pho85p
           cyclin-dependent kinase (Cdk), expressed in late M/early
           G1 phase, activated by Swi5p
          Length = 304

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 56/105 (53%), Gaps = 11/105 (10%)

Query: 84  PPGISVY--NYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFTLSSLTVHRFLLTAT 139
           PP +S++  N +I+    S+++   L+    Y++ L SV P  V+ +++ T HR  L   
Sbjct: 46  PPDLSIFIKNVVIQ----SNVQTPTLMATSVYLNKLKSVIPKNVYGINT-TRHRIFLGCL 100

Query: 140 TVASKGLCDSFCTNTHYAKV--GGVHSSELNILECEFLKRVNYRI 182
            +A+K L DS   N H+     G +   E+N +E E L+ +N+ +
Sbjct: 101 ILAAKTLNDSSPWNKHWTTYTEGLLRIREVNTIERELLEYLNWDV 145

>KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 301

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 53/100 (53%), Gaps = 5/100 (5%)

Query: 87  ISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFTLSSLTVHRFLLTATTVASK 144
           +S+ +++  L   S+++   L++   Y+  L S+ P  V  + + T HR  L    +A+K
Sbjct: 43  VSLVDFIKGLVVQSNVQTPTLMSTAVYLSKLRSIIPANVHGMET-TRHRVFLGCLIIAAK 101

Query: 145 GLCDSFCTNTHYAKV--GGVHSSELNILECEFLKRVNYRI 182
            L DS   N H+A    G +++ E+N +E E L+  ++ +
Sbjct: 102 NLNDSSPMNKHWASYTNGLLNTREVNTIERELLEYFDWNL 141

>TBLA0A07890 Chr1 (1943543..1944628) [1086 bp, 361 aa] {ON} Anc_3.70
           YNL289W
          Length = 361

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 54/103 (52%), Gaps = 3/103 (2%)

Query: 83  VPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLS-SLTVHRFLLTATTV 141
           +P   S+  ++ R+ +Y++++   LL  V Y++ L  + P   +    T+HR  L    +
Sbjct: 55  IPKLPSLMTFITRIVRYTNVQVSTLLMTVCYLNKLKKLLPADAVGIPSTIHRLFLACLIL 114

Query: 142 ASKGLCDSFCTNTHYAK-VGGVHS-SELNILECEFLKRVNYRI 182
           ++K   DS   N H+A    G+ S  ++N++E + L  +++ +
Sbjct: 115 SAKFHNDSSPLNVHWANYTNGLFSVKDVNLMERQLLSLLDWNL 157

>AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL127W
           (PCL2) and YDL179W (PCL9)
          Length = 308

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 58/110 (52%), Gaps = 5/110 (4%)

Query: 87  ISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFTLSSLTVHRFLLTATTVASK 144
           +S+ +++  L K S+++   L++ V Y+  L S+ P  V+ + + + HR  L    +A+K
Sbjct: 43  LSLVDFIKGLVKRSNVQTPTLMSTVVYLARLRSIIPANVYGIET-SRHRMFLGCLILAAK 101

Query: 145 GLCDSFCTNTHYAKV--GGVHSSELNILECEFLKRVNYRILPRDDNIDWC 192
            L DS   N H+ +   G +   E+N +E E L+  N+ +   + ++  C
Sbjct: 102 NLNDSSPMNKHWCRYTDGLLSLREVNTIERELLEYFNWNLRITNQDLISC 151

>Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON}
           similar to Ashbya gossypii AFR159C
          Length = 314

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 5/112 (4%)

Query: 85  PGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFTLSSLTVHRFLLTATTVA 142
           P +S+ +++  L   S+++   L++ V Y+  L S+ P  V  + + T HR  L    +A
Sbjct: 41  PILSLVDFIKGLINKSNVQTPTLMSTVVYLTRLRSIIPPNVHGIET-TRHRIFLGCLILA 99

Query: 143 SKGLCDSFCTNTHYAKVGG--VHSSELNILECEFLKRVNYRILPRDDNIDWC 192
           SK L DS   N H+ +     +   E+N +E E L+  N+ +L  + ++  C
Sbjct: 100 SKNLNDSSPMNKHWCQYTNSLLSLREVNTVERELLEYFNWDLLITNKDLITC 151

>NCAS0D04070 Chr4 (764711..766132) [1422 bp, 473 aa] {ON} Anc_6.236
          Length = 473

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 69/165 (41%), Gaps = 17/165 (10%)

Query: 28  DEISTIYLPRKFSKCSR------TDLAVLISR--MLTFLIQINDSLALSKP-ENARGLTR 78
           +E +++  P++  + S       TD A+   R  +   L   N  L++ +P +     + 
Sbjct: 280 EEYTSLLTPKEIDEASEKFQELNTDEAITNMRESIEEILQMSNRELSIDEPLDEMIAFSN 339

Query: 79  FHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPV--------FTLSSLT 130
           F  + PP +S  +++ R+      +  V L A Y +  L  +           F      
Sbjct: 340 FKMKSPPSLSYADFIQRIQNKCEYDPHVYLIATYLLQTLLLIREEHSRKLKLRFKFEKSD 399

Query: 131 VHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFL 175
           VHR ++    +A+K L D   ++ ++ KV G+    L+ LE   L
Sbjct: 400 VHRLIIATVRIATKLLEDHVHSHEYFCKVSGISKKLLSKLEVSLL 444

>Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 55/110 (50%), Gaps = 8/110 (7%)

Query: 84  PPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFTLSSLTVHRFLLTATTV 141
           PP     N LI   K+S+++   L+    Y+  L S+ P  V+ + + T HR  L    +
Sbjct: 47  PPLTKFINGLI---KHSNVQTPTLMATSVYLAKLRSIIPSNVYGIET-TRHRIFLGCLIL 102

Query: 142 ASKGLCDSFCTNTHYAKV--GGVHSSELNILECEFLKRVNYRILPRDDNI 189
           A+K L DS   N H+A+   G +   E+N +E E L+  ++ +    D++
Sbjct: 103 AAKTLNDSSPLNKHWAEYTDGLLVLREVNTIERELLEYFDWDVTISTDDL 152

>KLTH0H03674g Chr8 (333755..335209) [1455 bp, 484 aa] {ON} weakly
           similar to uniprot|P53124 Saccharomyces cerevisiae
           YGL134W PCL10 Pho85p cyclin recruits activates and
           targets Pho85p cyclin-dependent protein kinase to its
           substrate
          Length = 484

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 51/105 (48%), Gaps = 6/105 (5%)

Query: 85  PGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLL------SSVYPVFTLSSLTVHRFLLTA 138
           P ++  +YL RL    S    V LTA + +  L        ++    L    VHR ++ +
Sbjct: 358 PTLAYEDYLKRLHCKFSFAPIVYLTAAHLLQTLFLTRVDEELHCKHHLDPRQVHRLVIAS 417

Query: 139 TTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRIL 183
             +A+K L D   ++++++++ G+    L  LE  FL+ +N+  L
Sbjct: 418 IRLATKLLEDCVHSHSYFSRICGISKKLLTKLEVAFLECLNFEGL 462

>Smik_6.424 Chr6 complement(686097..687575) [1479 bp, 492 aa] {ON}
           YPL219W (REAL)
          Length = 492

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 52/124 (41%), Gaps = 9/124 (7%)

Query: 65  LALSKPENARGLTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLL------- 117
           LA+S  E+ +    F  + PP +S  +++ R+         V L A Y + L+       
Sbjct: 343 LAISS-EDPQKFVNFVMKNPPSLSFRDFIDRIQNKCMFGAVVYLGATYLLQLVFLTRDEM 401

Query: 118 -SSVYPVFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLK 176
              +     L     HR +++   +A+K L D   +  +  KV G+    L  LE  F+ 
Sbjct: 402 NGPIKLKTKLQEDQAHRIIISTIRIATKLLEDFVHSQNYICKVFGISKRLLTKLEISFMA 461

Query: 177 RVNY 180
            VN+
Sbjct: 462 CVNF 465

>ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {ON}
           similar to uniprot|P24867 Saccharomyces cerevisiae
           YNL289W PCL1 Pho85 cyclin of the Pcl1 2-like subfamily
           involved in entry into the mitotic cell cycle and
           regulation of morphogenesis localizes to sites of
           polarized cell growth
          Length = 330

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 62/113 (54%), Gaps = 8/113 (7%)

Query: 81  SRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFTLSSLTVHRFLLTA 138
           S++P   S+ +++ RL +++++    LL    Y++ L  + P     L S T+HR  L  
Sbjct: 83  SKLP---SLMSFISRLVRHTNVYTSTLLVTACYLNRLKCILPKDASGLPS-TIHRMFLAC 138

Query: 139 TTVASKGLCDSFCTNTHYAK-VGGVHSSE-LNILECEFLKRVNYRILPRDDNI 189
             +++K   DS   N H+AK   G+ S E +N++E + ++ +N+ +   +D++
Sbjct: 139 LILSAKFHNDSSPLNKHWAKYTDGLFSVEDVNLMERQLVQLLNWDLRVTNDDL 191

>TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {ON}
           Anc_7.289 YDL179W
          Length = 363

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 68/151 (45%), Gaps = 15/151 (9%)

Query: 54  MLTFLIQINDSLALSKPENARGLTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYY 113
           M+ FL+   +S+   + E     T   S+  P ++++  + RL  +S+++   L++ + Y
Sbjct: 19  MIDFLVSTTNSIIQIESE-----TSSTSQQIPSLALF--IKRLIVHSNVQTPTLMSTLVY 71

Query: 114 IDLLSSVYPVFTLS-SLTVHRFLLTATTVASKGLCDSFCTNTHYAKV--GGVHSSELNIL 170
           +  L  + P   +    T HR  +    +A+K L DS   N H+ +   G     E+N +
Sbjct: 72  LTKLREIIPSDVVGIETTRHRIFIGCLILAAKSLNDSSPLNRHWTQYTNGLFKIQEINTI 131

Query: 171 ECEFLKRVNYRILPRDDNIDWCKLETKLQKF 201
           E E L+  N+     D  I    L T L  F
Sbjct: 132 ERELLEYFNW-----DVTIKLPDLYTSLSAF 157

>SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa]
           {ON} similar to gnl|GLV|CAGL0E02233g Candida glabrata
           CAGL0E02233g and some similarites with YNL289W
           uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 314

 Score = 38.5 bits (88), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 60/120 (50%), Gaps = 13/120 (10%)

Query: 88  SVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFTLSSLTVHRFLLTATTVASKG 145
           S+  ++ +L +Y+++    LLT V Y+  L ++ P     L S T HR  L    +++K 
Sbjct: 55  SLMTFITKLVRYTNVYTSTLLTTVCYLSKLKTILPRDATGLPS-TTHRIFLACLILSAKF 113

Query: 146 LCDSFCTNTHYAK-VGGVHSSE-LNILECEFLK------RVNYRILPRDDNIDWCKLETK 197
             DS   N H+++   G+ S E +N++E + L+      R+N   L +D  + W  L  K
Sbjct: 114 HNDSSPLNAHWSRYTDGLFSLEDVNLMERQLLQLLHWDLRINQDALAQD--LQWLLLPIK 171

>Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 37.7 bits (86), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 67/145 (46%), Gaps = 22/145 (15%)

Query: 84  PPGISVY--NYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFTLSSLTVHRFLLTAT 139
           PP +S +  N +I+    S+++   L+    Y++ L ++ P  V+ + + T HR  L   
Sbjct: 47  PPDLSTFIKNVVIQ----SNVQTPTLMATSVYLNKLRNIIPRNVYGIET-TRHRIFLGCL 101

Query: 140 TVASKGLCDSFCTNTHYAKV--GGVHSSELNILECEFLKRVNY--RILPRD--DNIDWCK 193
            +A+K L DS   N H+     G +   E+N +E E L+  N+  RI   D  D + +  
Sbjct: 102 ILAAKTLNDSSPWNKHWTTYTEGLLRVREVNTIERELLEYFNWDVRITTHDLVDALSYFL 161

Query: 194 LETKLQKF-------TLYEEPEMGQ 211
           +  K Q F        L+  P  GQ
Sbjct: 162 VPIKEQLFRQKRQELLLFNAPSPGQ 186

>TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70
           YNL289W
          Length = 254

 Score = 37.4 bits (85), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 54/108 (50%), Gaps = 12/108 (11%)

Query: 84  PPGI-------SVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFTLSSLTVHRF 134
           PPG        S+ +++ RL +++++    LLT   Y++ L  + P     L S TVHR 
Sbjct: 40  PPGSPKGNKLPSLMSFISRLVRHTNVYTSTLLTTACYLNKLKCILPKDASGLPS-TVHRI 98

Query: 135 LLTATTVASKGLCDSFCTNTHYAKVGG--VHSSELNILECEFLKRVNY 180
            L    +++K   DS   N H+AK         ++N++E + ++ +N+
Sbjct: 99  FLACLILSAKFHNDSSPLNRHWAKYTDELFTLEDINLMERQLIQLLNW 146

>KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.289
           YDL179W
          Length = 312

 Score = 37.4 bits (85), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 59/132 (44%), Gaps = 8/132 (6%)

Query: 54  MLTFLIQINDSLALSKPENARGLTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYY 113
           M+ +L ++ +S+        R      S  PP  ++  ++  L   S +    L+ +  Y
Sbjct: 19  MIKYLAKVTESIVTHLRPEVRS-----SDKPPIPTLVEFIAGLVTNSKVGTPTLMASTVY 73

Query: 114 IDLLSSVYPVFTLS-SLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGG--VHSSELNIL 170
           +  L  + P   +    T HR  L    +A+K L D+   N H++K     + + E+NI+
Sbjct: 74  LVRLKDILPPNIIGIETTRHRLFLGCLIIAAKTLNDNSPLNKHWSKHTNNLLPNREINII 133

Query: 171 ECEFLKRVNYRI 182
           E E L  + +R+
Sbjct: 134 ERELLSYLRWRV 145

>KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} similar
           to uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 282

 Score = 37.4 bits (85), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 49/100 (49%), Gaps = 6/100 (6%)

Query: 80  HSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLS-SLTVHRFLLTA 138
           H+ VP   S+  ++ RL +Y+++    LLT V Y++ L  + P        T HR  L  
Sbjct: 53  HNGVP---SLMTFISRLVRYTNVYTSTLLTTVVYLNRLRELLPSDAAGLPTTCHRIFLAC 109

Query: 139 TTVASKGLCDSFCTNTHYAKV--GGVHSSELNILECEFLK 176
             +++K   DS   N H+ K   G     ++N++E + L+
Sbjct: 110 LILSAKYHNDSSPLNKHWTKYTDGMFTLRDVNLMERQLLQ 149

>Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W
           (REAL)
          Length = 309

 Score = 37.0 bits (84), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 51/98 (52%), Gaps = 5/98 (5%)

Query: 89  VYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFTLSSLTVHRFLLTATTVASKGL 146
           ++ ++ ++   S+++   L+    Y++ L ++ P  V+ + + T HR  L    +A+K L
Sbjct: 48  LFTFIKKVVIQSNVQTPTLMATTVYLNKLKNIIPTNVYGIET-TRHRIFLGCLILAAKTL 106

Query: 147 CDSFCTNTHYAKV--GGVHSSELNILECEFLKRVNYRI 182
            DS   N H++    G +   E+N +E E L+  N+ +
Sbjct: 107 NDSSPWNKHWSTYTEGLLKVREVNTIERELLEYFNWDV 144

>NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {ON}
           Anc_3.70
          Length = 294

 Score = 36.6 bits (83), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 50/94 (53%), Gaps = 8/94 (8%)

Query: 82  RVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFTLSSLTVHRFLLTAT 139
           R+P   S+  ++ RL +Y+++    LLT V Y++ L  + P     L S T+HR  L   
Sbjct: 51  RLP---SLMTFITRLVRYTNVYTPTLLTTVCYLNKLKRILPKDATGLPS-TIHRIFLACL 106

Query: 140 TVASKGLCDSFCTNTHYAK-VGGVHSSE-LNILE 171
            +++K   DS   N H+ K   G+ + E +N++E
Sbjct: 107 ILSAKFHNDSSPLNKHWVKYTDGLFTLEDVNLME 140

>KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {ON}
           Anc_3.70 YNL289W
          Length = 241

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 62/133 (46%), Gaps = 16/133 (12%)

Query: 64  SLALSKPENARGLTRFHSRVPPGISVYN----------YLIRLTKYSSLEHCVLLTAVYY 113
           +L ++  EN   L R +   PP   +Y+          ++ +L +Y+ +    LL  + Y
Sbjct: 22  TLLVTTTENVMDLKRTYP-TPPSSPLYDEEDELPTLREFICKLVEYTHVYTPTLLMTISY 80

Query: 114 IDLLSSVYP--VFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAK-VGGVHSSE-LNI 169
           ++ L  + P     + S T+HR  L    +++K   DS   N H+ K   G+ + E +N+
Sbjct: 81  LNRLRRILPKGAAGIPS-TLHRIFLACLIISAKNHNDSSPLNRHWTKYTDGLFTLEDVNL 139

Query: 170 LECEFLKRVNYRI 182
           +E   L  +N+ +
Sbjct: 140 MERHLLDLLNWNL 152

>KAFR0C01560 Chr3 complement(320148..320951) [804 bp, 267 aa] {ON}
           Anc_3.70 YNL289W
          Length = 267

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 50/94 (53%), Gaps = 8/94 (8%)

Query: 82  RVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFTLSSLTVHRFLLTAT 139
           R+P   S+  ++ RL +Y+++    LLT V Y++ L  + P     L S T+HR  L   
Sbjct: 56  RLP---SLRTFITRLVRYTNVYTPTLLTTVCYLNKLKRILPKDAKGLPS-TIHRLFLACL 111

Query: 140 TVASKGLCDSFCTNTHYAK-VGGVHSSE-LNILE 171
            +++K   DS   N H+ +   G+ S E +N++E
Sbjct: 112 IISAKFHNDSSPLNKHWTRYTDGLFSLEDINLME 145

>NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {ON}
           Anc_3.70
          Length = 286

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 50/97 (51%), Gaps = 8/97 (8%)

Query: 79  FHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFTLSSLTVHRFLL 136
           +  R+P   S+  ++  L +Y+++    LLT V Y++ L  + P     L S T+HR  L
Sbjct: 48  YQPRLP---SLMTFITNLVRYTNVYTPTLLTTVCYLNKLKRLLPKDATGLPS-TIHRIFL 103

Query: 137 TATTVASKGLCDSFCTNTHYAK-VGGVHSSE-LNILE 171
               +++K   DS   N H+ K   G+ + E +N++E
Sbjct: 104 ACLILSAKFHNDSSPLNKHWVKYTDGLFTLEDVNLME 140

>YHR071W Chr8 (237004..237693) [690 bp, 229 aa] {ON}  PCL5Cyclin,
           interacts with and phosphorylated by Pho85p
           cyclin-dependent kinase (Cdk), induced by Gcn4p at level
           of transcription, specifically required for Gcn4p
           degradation, may be sensor of cellular protein
           biosynthetic capacity
          Length = 229

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 75/155 (48%), Gaps = 23/155 (14%)

Query: 44  RTDLAVLISRMLTFLIQINDSLALSKPENA-RGLTRFHSRVPPGISVYNYLIRLTKYSSL 102
           +T+LA++IS    FL +I+  L+  K  N+   + +F           N +++ +K S  
Sbjct: 50  KTNLAIIIS---NFLSEISRPLSNGKINNSTHNILKF----------LNEVLKRSKCSK- 95

Query: 103 EHCVLLTAVYYIDLLSSVYPVFTLSSL-----TVHRFLLTATTVASKGLCDSFCTNTHYA 157
           E+ VL  A +Y   +     V   SSL        R  L    ++ K L D+  +  ++ 
Sbjct: 96  ENAVL--ATFYFQKIHQSRGVRDESSLPEFSHCSRRIFLCCLILSHKFLNDNTYSMKNWQ 153

Query: 158 KVGGVHSSELNILECEFLKRVNYRI-LPRDDNIDW 191
            + G+H+ +L+++E   L ++NY + +P D+ + W
Sbjct: 154 IISGLHAKDLSLMERWCLGKLNYELAIPYDEFLLW 188

>AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL289W (PCL1)
          Length = 237

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 53/108 (49%), Gaps = 9/108 (8%)

Query: 88  SVYNYLIRLTKYSSLEHCVLL-TAVYYIDLLSSVYPVFTLSSLTVHRFLLTATTVASKGL 146
           S++ ++ RL +Y+++    LL TAVY   L   +    T    T HR  L    +++K  
Sbjct: 53  SIHMFITRLVRYTNVYTATLLTTAVYLERLRLLLPRDATGIPSTAHRIFLACLILSAKFH 112

Query: 147 CDSFCTNTHYAKV--GGVHSSELNILECEFLK------RVNYRILPRD 186
            DS   N H+ K   G   + ++N++E + L+      RV +R L RD
Sbjct: 113 NDSSPLNKHWTKYTDGLFTTQDVNLMERQLLRLFDWNVRVGHRDLCRD 160

>KNAG0B04480 Chr2 (861049..864534) [3486 bp, 1161 aa] {ON} Anc_5.370
           YHR080C
          Length = 1161

 Score = 33.9 bits (76), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 8/66 (12%)

Query: 226 VLDAYFRKIVQLVGSYASSPDKSKVVNYVLRPSSPIKDGSRDSTHDHALSSQTSLESIST 285
           +L A F  I Q  G +  S      V+ ++ P++P +DGSR S HD    S    E+I T
Sbjct: 168 ILGALFPDIDQSAGRFLKS------VDNIINPNTPPRDGSRKSVHDEG--STVVDENIRT 219

Query: 286 RTINSD 291
              N+D
Sbjct: 220 PEGNAD 225

>Kpol_1005.17 s1005 (29070..30029) [960 bp, 319 aa] {ON}
           (29070..30029) [960 nt, 320 aa]
          Length = 319

 Score = 33.5 bits (75), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 45/99 (45%), Gaps = 8/99 (8%)

Query: 92  YLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLT--------VHRFLLTATTVAS 143
           +++ +   S     VLL A YY   + S+ P+ T +S +          R  L    ++ 
Sbjct: 154 FIVEIIDRSKCNKNVLLLATYYFKQIYSLNPISTKNSKSPLPTFSHCAKRIFLCCLIISH 213

Query: 144 KGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRI 182
           K L D+  T   +  + G+  + L+++E   L R+NY +
Sbjct: 214 KFLNDNTFTMKSWHCISGLPQTHLSLMERWCLTRLNYNL 252

>TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.289
           YDL179W
          Length = 289

 Score = 33.5 bits (75), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 39/80 (48%), Gaps = 5/80 (6%)

Query: 107 LLTAVYYIDLLSSVYP--VFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKV--GGV 162
           L+     ++ L  + P  V+ + S T HR  L    +++K L DS   N H+AK     +
Sbjct: 67  LMATTVLLEKLKKIIPSNVYGIES-TRHRIFLGCLILSAKSLNDSSPLNKHWAKYTESYI 125

Query: 163 HSSELNILECEFLKRVNYRI 182
           H  E+N +E E L   ++ +
Sbjct: 126 HLREVNTIERELLNYFDWNV 145

>Kwal_23.5231 s23 complement(1069167..1069937) [771 bp, 256 aa] {ON}
           YNL289W (PCL1) - G(sub)1 cyclin that associates with
           PHO85 [contig 8] FULL
          Length = 256

 Score = 33.1 bits (74), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 47/96 (48%), Gaps = 7/96 (7%)

Query: 80  HSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFTLSSLTVHRFLLT 137
           H R  P  S+  ++ RL +Y+++    LLTA  Y++ L  + P     L S T HR  L 
Sbjct: 53  HKRTLP--SLMTFVTRLVRYTNVYTSTLLTATCYLEKLRRLLPRDAHGLPS-TSHRIFLA 109

Query: 138 ATTVASKGLCDSFCTNTHYAKV--GGVHSSELNILE 171
              +++K   DS   N H+A    G     ++N++E
Sbjct: 110 CLILSAKFHNDSSPQNKHWAAYTDGLFCLEDVNLME 145

>NDAI0C04300 Chr3 (981107..981829) [723 bp, 240 aa] {ON} 
          Length = 240

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 58/129 (44%), Gaps = 13/129 (10%)

Query: 88  SVYNYLIRLTKYSSLEHCVLLTAVYYIDLLS---SVYPVFTL--SSLTVHRFLLTATTVA 142
           S+ +++  +TK S  +  +LL A YY   L    S  PV T+   +    R  LT   +A
Sbjct: 94  SLKSFINEITKRSKSKRNILLLATYYFQKLYTSLSTCPVSTIPEFAFCAKRSFLTCIIIA 153

Query: 143 SKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRILPRDDNI-DWCKLETKLQKF 201
            K L DS  +   ++ + G++   L+ +E   L +++Y +   D     W       Q+ 
Sbjct: 154 HKYLNDSTFSMESWSLISGLNKKALSTIERWCLGKLDYNLFVDDLQFGSW-------QRK 206

Query: 202 TLYEEPEMG 210
            L++ P+  
Sbjct: 207 CLFQLPQTA 215

>KLLA0B02024g Chr2 (176585..178168) [1584 bp, 527 aa] {ON} some
           similarities with uniprot|P53124 Saccharomyces
           cerevisiae YGL134W PCL10 Pho85p cyclin recruits
           activates and targets Pho85p cyclin-dependent protein
           kinase to its substrate
          Length = 527

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 55/119 (46%), Gaps = 13/119 (10%)

Query: 67  LSKPENARGLTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTA----VYYIDL-LSSVY 121
           L +  N R +  F  +  P +S+  YL R+    S    + LTA    V Y D+   +  
Sbjct: 382 LEETSNIRAI--FQMKSAPTLSISQYLDRIESKCSFPPIIYLTASFLLVTYCDIKFDTGS 439

Query: 122 PVFTL-----SSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFL 175
             F L      S+T HR L+    +A+K L D   ++++++KV G+    L+ LE   +
Sbjct: 440 GKFHLENPITESMT-HRLLIAFIRLAAKLLEDHVHSHSYFSKVCGISKKLLSKLELNLV 497

>CAGL0J06336g Chr10 complement(602954..603898) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12477 Saccharomyces cerevisiae
           YDL179w PCL9 or uniprot|P25693 Saccharomyces cerevisiae
           YDL127w
          Length = 314

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 57/132 (43%), Gaps = 13/132 (9%)

Query: 54  MLTFLIQINDSLALSKPENARGLTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYY 113
           MLTFLI   +S+   K  N+          P  + +  ++  L   S ++   L+    Y
Sbjct: 30  MLTFLISKTNSMIKIKKTNS----------PKPVELSLFVEELVASSKVQASTLMATAVY 79

Query: 114 IDLLSSVYPVFTLS-SLTVHRFLLTATTVASKGLCDSFCTNTHYAKV--GGVHSSELNIL 170
           +D LS + P        T HR  L    ++SK L DS   N H+ K   G +   E+N +
Sbjct: 80  LDRLSRIIPSNVCGIETTKHRMFLGCLILSSKSLDDSSLFNKHWTKYCNGLLTLKEVNSI 139

Query: 171 ECEFLKRVNYRI 182
           E E L   N+ I
Sbjct: 140 ERELLSYFNWDI 151

>KLTH0A01584g Chr1 (141289..142134) [846 bp, 281 aa] {ON} similar to
           uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 281

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 5/88 (5%)

Query: 88  SVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFTLSSLTVHRFLLTATTVASKG 145
           S+  ++ RL +Y+++    LLTA  Y++ L  + P     L S T HR  L    +++K 
Sbjct: 87  SLMTFITRLVRYTNVYTSTLLTATCYLEKLRRLLPRDAHGLPS-TGHRIFLACLILSAKY 145

Query: 146 LCDSFCTNTHYAKV--GGVHSSELNILE 171
             DS   N H+A    G     ++N++E
Sbjct: 146 HNDSSPQNKHWAAYTDGLFCLDDVNLME 173

>KLTH0B01232g Chr2 complement(108265..110865) [2601 bp, 866 aa] {ON}
           similar to uniprot|P46675 Saccharomyces cerevisiae
           YLR045C STU2 Microtubule-associated protein (MAP) of the
           XMAP215/Dis1 family regulates microtubule dynamics
           during spindle orientation and metaphase chromosome
           alignment interacts with spindle pole body component
           Spc72p
          Length = 866

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 257 PSSPIKDGSRDSTHDHALSSQTSLESISTRTINSDSKPKSHEDEEPSA 304
           PSSP+K G+R  T+    SS  S   ++ R++ +DS P S     P A
Sbjct: 606 PSSPLKTGTRVETYQDGASSMKS--RLTARSLTTDSAPASKPQAAPHA 651

>KLLA0F05654g Chr6 (552056..552991) [936 bp, 311 aa] {ON} weakly
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 51/100 (51%), Gaps = 5/100 (5%)

Query: 87  ISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP--VFTLSSLTVHRFLLTATTVASK 144
           +S+ +++  L ++S+++   L+    Y+  L S+ P  V  + + T HR  +    +A+K
Sbjct: 44  VSLVDFIKSLIRHSNVQTPTLMATTVYLTKLRSILPHDVCGIET-TRHRIFIGCLILAAK 102

Query: 145 GLCDSFCTNTHYAK-VGGVHSSE-LNILECEFLKRVNYRI 182
            L DS   N H+     G+ + E +N +E E L   ++ +
Sbjct: 103 NLNDSSPLNKHWTNYTDGLFTLEDVNTIERELLSLFSWNL 142

>Kpol_1048.5 s1048 complement(22179..27086) [4908 bp, 1635 aa] {ON}
            complement(22179..27086) [4908 nt, 1636 aa]
          Length = 1635

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 51/115 (44%), Gaps = 20/115 (17%)

Query: 196  TKLQKFTLYEEPEMGQNSRPQNSLKNSGYNVLDAYFRKIVQ--LVGSYASSPDKSKVVNY 253
             KL+KF        G+  +P    +N+ Y VL  YF++I    L   +  S    K +  
Sbjct: 1395 AKLKKF--------GEQEQPLADFRNNIYRVLQGYFKQIADDPLNEDFIQSLQDLKTIMQ 1446

Query: 254  VLRPSSPIKDGSRDSTHDHALSSQTSLESISTRTINSDSKPKSHEDEEPSARKRN 308
             +   + IK  SR+S  D + S Q      S+R    +S PKS +  E S  +RN
Sbjct: 1447 RVSQKNIIK--SRESKSDQSSSIQP-----SSRY---NSNPKSEKQLEVSQNQRN 1491

>NDAI0C01980 Chr3 complement(445212..445892) [681 bp, 226 aa] {ON}
           Anc_5.347 YHR071W
          Length = 226

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 69/145 (47%), Gaps = 13/145 (8%)

Query: 47  LAVLISRMLTFLIQINDSLALSKPENARGLTRFHSRVP-PGISVYNYLIRLTKYS-SLEH 104
           + +L +  L + + + D++A    E  + L+    +VP    S+  YL+ + K S S  +
Sbjct: 47  ITILSNSKLEYNMSLVDTIAEFLSETVKYLST--KKVPNEKSSIKTYLMEILKRSQSSRN 104

Query: 105 CVLLTAVYYIDLLSSVY------PVFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAK 158
            V++ + Y+  L +SV       P F   S    R  L+   ++ K L D   +   ++ 
Sbjct: 105 NVIVASFYFQKLYNSVQLNQDPNPEFVHCS---KRIFLSCLILSHKFLNDKTFSMKAWSL 161

Query: 159 VGGVHSSELNILECEFLKRVNYRIL 183
           + G+   +L+ILE   L R+NY ++
Sbjct: 162 ISGISKRDLSILERWCLMRLNYHLV 186

>CAGL0E05918g Chr5 complement(585960..587405) [1446 bp, 481 aa] {ON}
           similar to uniprot|Q08966 Saccharomyces cerevisiae
           YPL219w PCL8
          Length = 481

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 25/122 (20%), Positives = 49/122 (40%), Gaps = 8/122 (6%)

Query: 62  NDSLALSKPENARGLTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLL---- 117
           N+++   K +N      F  +  P IS ++++ R+         + L A Y + +L    
Sbjct: 329 NENMISEKADNNENYHYFSMKSAPSISHHDFIQRIQNKCMFGSIIYLGATYLLQILFLTR 388

Query: 118 ----SSVYPVFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECE 173
                 +     L    VHR ++    +A+K L D   ++ +  KV G+    +  LE  
Sbjct: 389 EYNDGPLRLKHKLQQNEVHRVIVGTIRIATKLLEDFVHSHQYICKVCGISKKLMTKLELA 448

Query: 174 FL 175
            +
Sbjct: 449 LI 450

>Skud_8.129 Chr8 (210309..210971) [663 bp, 220 aa] {ON} YHR071W
           (REAL)
          Length = 220

 Score = 30.4 bits (67), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 53/105 (50%), Gaps = 15/105 (14%)

Query: 133 RFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRI-LPRDDNIDW 191
           R  L    ++ K L D+  +  ++  + G+H+ +L+++E   L ++NY + +P  D + W
Sbjct: 128 RIFLCCLILSHKFLNDNTYSMKNWQIISGLHAKDLSLMERWCLGKLNYELAIPCSDLLLW 187

Query: 192 CKLETKLQKFTLYEEPEMGQNSRPQNSLKNSGYNVLDAYFRKIVQ 236
              ET     TL +   M +  RP ++  +      DA+ RK+++
Sbjct: 188 ---ETN----TLMKRASMAK--RPGDADHD-----FDAHPRKLIK 218

>Skud_7.189 Chr7 (338050..340809) [2760 bp, 919 aa] {ON} YGL093W
           (REAL)
          Length = 919

 Score = 30.8 bits (68), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 20/32 (62%)

Query: 308 NLDSEAHPNGKDKVPSPGESKLKKMTNNQRTP 339
           NLD E   +GK+K   PG+  LK+  ++Q TP
Sbjct: 2   NLDEEGRSSGKEKDAGPGKGILKQNQSSQMTP 33

>Kpol_262.2 s262 (3189..6500) [3312 bp, 1103 aa] {ON} (3189..6500)
           [3312 nt, 1104 aa]
          Length = 1103

 Score = 30.4 bits (67), Expect = 8.9,   Method: Composition-based stats.
 Identities = 25/100 (25%), Positives = 45/100 (45%), Gaps = 7/100 (7%)

Query: 237 LVGSYASSPDKS-KVVNYVLRPSSPIKDGSRDSTHDHALSSQTSLESISTRTINSDSKPK 295
           L+   ++SPDK  K + +  +     +D  R S  D+ L + T+ E+  +   + D    
Sbjct: 867 LLNEKSTSPDKDIKRITFNEKSLLKDEDSVRSSIFDNVLETPTNTENKLSEASSVD---- 922

Query: 296 SHE-DEEPSARKRNLDSEAHPNGKDKVPSPGESKLKKMTN 334
            H+ +E     + +L  +  PNG  K+P    S   +M N
Sbjct: 923 -HDFNERQEVSRPDLKGDLMPNGISKLPGVKGSDFTQMEN 961

>NCAS0H01650 Chr8 complement(316598..317230) [633 bp, 210 aa] {ON}
           Anc_5.347 YHR071W
          Length = 210

 Score = 29.6 bits (65), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 47/108 (43%), Gaps = 11/108 (10%)

Query: 92  YLIRLTKYSSLEHCVLLTAVYYIDLLSSVY-------PVFTLSSLTVHRFLLTATTVASK 144
           YL  + K S     V+  A  Y+D + S +       P F   +  V R  L+   +A K
Sbjct: 81  YLKEVCKRSRSTKTVVFLAAIYLDKIYSNWEPMLGDIPKF---ARCVKRVFLSCLIIAHK 137

Query: 145 GLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRI-LPRDDNIDW 191
              D   +   ++ + G+   EL I+E + L  +NY + + + + + W
Sbjct: 138 FANDKTFSMRSWSSISGLGRKELTIMEKKCLLEINYELTVDKAELLSW 185

>CAGL0J10846g Chr10 complement(1058824..1059513) [690 bp, 229 aa]
           {ON} similar to uniprot|P38794 Saccharomyces cerevisiae
           YHR071w PCL5 cyclin like protein interacting with PHO85P
          Length = 229

 Score = 29.6 bits (65), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 44/99 (44%), Gaps = 9/99 (9%)

Query: 88  SVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVY------PVFTLSSLTVHRFLLTATTV 141
           S+ N+L  +TK + +   +LL A  Y D L   +      P F        R LL    +
Sbjct: 72  SIANFLKEVTKRAHISRDILLLASIYFDKLIKSHEGAINVPEFAYCG---KRLLLVCIIL 128

Query: 142 ASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNY 180
           A K   D   +   + +V G+ +  + I+E   LK++NY
Sbjct: 129 AHKFSNDITFSMRVWTQVSGLPTRSIAIMERWCLKQLNY 167

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.129    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,548,070
Number of extensions: 1665130
Number of successful extensions: 6639
Number of sequences better than 10.0: 221
Number of HSP's gapped: 6827
Number of HSP's successfully gapped: 233
Length of query: 347
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 237
Effective length of database: 40,868,139
Effective search space: 9685748943
Effective search space used: 9685748943
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 66 (30.0 bits)