Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G044206.27ON32232216740.0
KNAG0M012406.27ON31430910271e-140
SAKL0E01474g6.27ON31130310231e-139
NDAI0F017406.27ON31331710101e-137
NCAS0H015106.27ON31328410041e-136
CAGL0E02519g6.27ON3153199991e-136
KAFR0G026506.27ON3213159891e-134
KLTH0C11044g6.27ON3152919841e-133
Smik_15.1686.27ON3273169771e-132
YOL002C (IZH2)6.27ON3173069761e-132
Kwal_56.224546.27ON3153169691e-131
Skud_15.1606.27ON3273169641e-130
Kpol_1032.96.27ON3182799401e-127
Suva_15.1736.27ON3273169331e-125
TBLA0E030606.27ON3192909311e-125
ZYRO0C07612g6.27ON3192979281e-125
ACL002C6.27ON3293219131e-122
TPHA0M002906.27ON3273219101e-122
KLLA0D01331g6.27ON3083169021e-121
Ecym_30316.27ON3282898571e-114
SAKL0C09218g3.90ON3143017236e-94
KLTH0C09504g3.90ON3192967053e-91
TPHA0A006403.90ON3273126933e-89
Kwal_56.227043.90ON3203136923e-89
Skud_4.7663.90ON3163116881e-88
AFR337W3.90ON3172916854e-88
Smik_4.7693.90ON3163116837e-88
TDEL0D053403.90ON3163026811e-87
YDR492W (IZH1)3.90ON3163116812e-87
Suva_2.6683.90ON3153016802e-87
NDAI0A071603.90ON3303166622e-84
KLLA0C12441g3.90ON3153036472e-82
CAGL0G04631g3.90ON3163046472e-82
Ecym_35883.90ON3052886332e-80
ZYRO0B06556g3.90ON3182896332e-80
NCAS0I025703.90ON3143126314e-80
KAFR0A081303.90ON3193156299e-80
Kpol_1053.263.90ON3243076263e-79
TBLA0B022903.90ON3263186082e-76
KNAG0K021603.90ON3233235839e-73
TBLA0B082553.90ON2962964087e-47
NCAS0C049203.90ON3263133051e-31
NDAI0G043003.90ON3183072867e-29
CAGL0I07491g3.90ON3012932411e-22
Skud_15.533.90ON3123262023e-17
Smik_15.563.90ON3123251971e-16
Suva_15.643.90ON3123141919e-16
YOL101C (IZH4)3.90ON3123251821e-14
KAFR0J006705.197ON5092341823e-14
TPHA0E031205.197ON5692471682e-12
AAL153C5.197ON4192571672e-12
TBLA0C060505.197ON4372381575e-11
Kpol_2002.945.197ON5772391522e-10
Kwal_33.151225.197ON5662451523e-10
Ecym_71095.197ON5682361443e-09
KLLA0F15510g5.197ON6222751443e-09
KNAG0B051005.197ON5382481433e-09
KLTH0B03498g5.197ON5462491433e-09
NDAI0I023305.197ON5782391372e-08
SAKL0G12980g5.197ON5632511372e-08
YLR023C (IZH3)5.197ON5432381344e-08
Skud_12.915.197ON5422381318e-08
TDEL0E043205.197ON4502421282e-07
NCAS0D026005.197ON5432461247e-07
Suva_10.1045.197ON5412381184e-06
Smik_12.865.197ON5422371184e-06
CAGL0D03322g5.197ON5452431158e-06
ZYRO0B10538g5.197ON5312361006e-04
KLTH0C10208g6.57ON30353750.57
Kwal_55.201715.379ON69863722.0
YKL071Wna 1ON25693693.1
NDAI0E038407.57ON138934703.4
KLTH0E03586g5.379ON70163703.6
KNAG0K006703.90ON321125684.8
Kwal_26.89828.722ON43164685.0
ZYRO0G16742gna 2ON54332668.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G04420
         (322 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON...   649   0.0  
KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.2...   400   e-140
SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar...   398   e-139
NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27      393   e-137
NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON...   391   e-136
CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {O...   389   e-136
KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON...   385   e-134
KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {O...   383   e-133
Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {O...   380   e-132
YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}  ...   380   e-132
Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C...   377   e-131
Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {O...   375   e-130
Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON} (22700..2...   366   e-127
Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {O...   363   e-125
TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27...   363   e-125
ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {O...   362   e-125
ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON} Sy...   356   e-122
TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27 ...   355   e-122
KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar...   352   e-121
Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to A...   334   e-114
SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar...   283   6e-94
KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {O...   276   3e-91
TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON...   271   3e-89
Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W...   271   3e-89
Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W...   269   1e-88
AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic h...   268   4e-88
Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W...   267   7e-88
TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90...   266   1e-87
YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membr...   266   2e-87
Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W...   266   2e-87
NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {...   259   2e-84
KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa] ...   253   2e-82
CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar...   253   2e-82
Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar ...   248   2e-80
ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar...   248   2e-80
NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON...   247   4e-80
KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3....   246   9e-80
Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON...   245   3e-79
TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON...   238   2e-76
KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.9...   229   9e-73
TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}             161   7e-47
NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {...   122   1e-31
NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90    114   7e-29
CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {O...    97   1e-22
Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON} ...    82   3e-17
Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON} ...    80   1e-16
Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON...    78   9e-16
YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}  ...    75   1e-14
KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5....    75   3e-14
TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {O...    69   2e-12
AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON} Syn...    69   2e-12
TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON} Anc_5...    65   5e-11
Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON} (2295...    63   2e-10
Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023...    63   3e-10
Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}...    60   3e-09
KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some...    60   3e-09
KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.1...    60   3e-09
KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {...    60   3e-09
NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197     57   2e-08
SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]...    57   2e-08
YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON} ...    56   4e-08
Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {O...    55   8e-08
TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {O...    54   2e-07
NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.1...    52   7e-07
Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {...    50   4e-06
Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {O...    50   4e-06
CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {...    49   8e-06
ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {...    43   6e-04
KLTH0C10208g Chr3 complement(846933..847844) [912 bp, 303 aa] {O...    33   0.57 
Kwal_55.20171 s55 complement(281102..283198) [2097 bp, 698 aa] {...    32   2.0  
YKL071W Chr11 (305114..305884) [771 bp, 256 aa] {ON} Putative pr...    31   3.1  
NDAI0E03840 Chr5 (841914..846083) [4170 bp, 1389 aa] {ON} Anc_7....    32   3.4  
KLTH0E03586g Chr5 complement(323231..325336) [2106 bp, 701 aa] {...    32   3.6  
KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {O...    31   4.8  
Kwal_26.8982 s26 complement(1028091..1029386) [1296 bp, 431 aa] ...    31   5.0  
ZYRO0G16742g Chr7 (1373818..1375449) [1632 bp, 543 aa] {ON} weak...    30   8.6  

>TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON}
           Anc_6.27 YOL002C
          Length = 322

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/322 (97%), Positives = 314/322 (97%)

Query: 1   MSDSLKKRSQCSLTTDQTSTVTKEETSGPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEH 60
           MSDSLKKRSQCSLTTDQTSTVTKEETSGPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEH
Sbjct: 1   MSDSLKKRSQCSLTTDQTSTVTKEETSGPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEH 60

Query: 61  ILSGYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFDKFAVTQFETTTLID 120
           ILSGYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFDKFAVTQFETTTLID
Sbjct: 61  ILSGYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFDKFAVTQFETTTLID 120

Query: 121 YVMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFF 180
           YVMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFF
Sbjct: 121 YVMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFF 180

Query: 181 ETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYY 240
           ETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYY
Sbjct: 181 ETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYY 240

Query: 241 GFSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXX 300
           GFSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFH        
Sbjct: 241 GFSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHVLVVVAAL 300

Query: 301 CHLYGLIKSYNLVHLKMAIAQL 322
           CHLYGLIKSYNLVHLKMAIAQL
Sbjct: 301 CHLYGLIKSYNLVHLKMAIAQL 322

>KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.27
           YOL002C
          Length = 314

 Score =  400 bits (1027), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 184/309 (59%), Positives = 232/309 (75%)

Query: 12  SLTTDQTSTVTKEETSGPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEHILSGYVGETRS 71
           S    QT T+T+        G+      K  +++YTW+EIP WQ+DNEHI+ GYV ET S
Sbjct: 3   SRVQRQTVTITEPVVYEDDGGEMKTATKKITKRIYTWNEIPEWQKDNEHIIDGYVRETNS 62

Query: 72  MFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFDKFAVTQFETTTLIDYVMIDLFSLVS 131
             +C  SLFYLHNESVN+Y+HL+P + F  VL  +K+ V  FETT+L+DY+ IDLF L +
Sbjct: 63  FLKCVHSLFYLHNESVNVYSHLIPALCFFSVLFLNKYCVKSFETTSLVDYLFIDLFFLGA 122

Query: 132 FTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLFSF 191
           FTCL LSS FHC K+HS  VATFGNKLDYLGIVVL+VTSM+SI+YYGF+++  +FY FSF
Sbjct: 123 FTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSF 182

Query: 192 ITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQV 251
           +T +FG AC VVSLK+ FR+REWRPYRA +FVAFGLSA+LPI++G+F YG  E + RIQ+
Sbjct: 183 VTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQI 242

Query: 252 KWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXXCHLYGLIKSYN 311
           KW++L G+FYI GA LYG+RFPEK +PGKYDIWGHSHQ+FH        CHL GL+ SY 
Sbjct: 243 KWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYE 302

Query: 312 LVHLKMAIA 320
           LVH  ++ A
Sbjct: 303 LVHKGLSSA 311

>SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 311

 Score =  398 bits (1023), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 184/303 (60%), Positives = 230/303 (75%), Gaps = 7/303 (2%)

Query: 17  QTSTVTKEETSGPVKGQKTDKMSKKK-RKLYTWDEIPHWQRDNEHILSGYVGETRSMFQC 75
           + + + KEET        T  ++KK+ R+LY+W+EIP WQ+DNEHI  GYV ET S   C
Sbjct: 13  KRANIVKEET------MSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGC 66

Query: 76  FLSLFYLHNESVNIYTHLLPGIAFLFVLCFDKFAVTQFETTTLIDYVMIDLFSLVSFTCL 135
           F SLFY+HNESVNIYTHLLPG+ F FV+ FDK A+  F+TTT +DY+M+DLF L +FTCL
Sbjct: 67  FDSLFYMHNESVNIYTHLLPGLCFFFVVLFDKVAIKVFDTTTFLDYIMVDLFFLGAFTCL 126

Query: 136 TLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLFSFITCT 195
            LSS FHCLK HS  +A  GNKLDYLGIV L+V+SM+SIMYYGFF++   FY FS +T  
Sbjct: 127 ILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLV 186

Query: 196 FGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQVKWVL 255
           FG ACA+ SL + FR+REWRPYRAA+FVAFGLSAVLPI +G+  YGF E ++++QVKWVL
Sbjct: 187 FGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKWVL 246

Query: 256 LGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXXCHLYGLIKSYNLVHL 315
           LGG+FYI GA+LY +R PE+ +PGK+DIWGHSHQ+FH        CHL  ++ SY LVH 
Sbjct: 247 LGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSYELVHK 306

Query: 316 KMA 318
           K+A
Sbjct: 307 KLA 309

>NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27
          Length = 313

 Score =  393 bits (1010), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 181/317 (57%), Positives = 228/317 (71%), Gaps = 4/317 (1%)

Query: 1   MSDSLKKRSQCSLTTDQTSTVTKEETSGPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEH 60
           M  +++KR   S TT     +   +    ++  K     K   KLY WDEIP WQ+DNEH
Sbjct: 1   MPKTIQKRGNTSTTTVVEGIINNTDNGDSIEQVK----RKVVYKLYRWDEIPEWQKDNEH 56

Query: 61  ILSGYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFDKFAVTQFETTTLID 120
           I+SGYV ET S   C  SLFY+HNES N+Y+HLLPG+ F F +  +K+ +T + TT+++D
Sbjct: 57  IISGYVRETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVD 116

Query: 121 YVMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFF 180
           Y+MIDLF   +F CL LSS+FHC K+HS  VAT GNKLDYLGIV+L+VTSM+SIMY+GFF
Sbjct: 117 YLMIDLFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFF 176

Query: 181 ETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYY 240
           + P  FY FS +T  FG ACA VSLK+ FR+REWRPYRA +FVAFGLSA+LPI+ G FYY
Sbjct: 177 DNPLFFYFFSSLTFLFGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYY 236

Query: 241 GFSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXX 300
           G  E ++RIQ+KW++L G FYI GA LYGVRFPEKY PG +DIWGHSHQ+FH        
Sbjct: 237 GIEETFIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAF 296

Query: 301 CHLYGLIKSYNLVHLKM 317
           CHL GL+ SY +VH ++
Sbjct: 297 CHLRGLLSSYEIVHSRL 313

>NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON}
           Anc_6.27
          Length = 313

 Score =  391 bits (1004), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 177/284 (62%), Positives = 222/284 (78%)

Query: 34  KTDKMSKKKRKLYTWDEIPHWQRDNEHILSGYVGETRSMFQCFLSLFYLHNESVNIYTHL 93
           K  K +   RKLYTWDEIP WQ+DNEHI++GYV ET S  +CF SLFY+HNE+ N+Y+HL
Sbjct: 30  KHTKKTTTIRKLYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHL 89

Query: 94  LPGIAFLFVLCFDKFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSIFHCLKNHSRSVAT 153
           +PG+ F   + FDK+A+  FETTT  DY++I+LF L +FTCL LSS FHC K+HS  +AT
Sbjct: 90  VPGVVFFLTMLFDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIAT 149

Query: 154 FGNKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAACAVVSLKEGFRTRE 213
           FGNKLDYLGIVVL+VTSM+SI++YGF++    FY FS +T +FG+ACA+VSLK+ FR+RE
Sbjct: 150 FGNKLDYLGIVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSRE 209

Query: 214 WRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQVKWVLLGGIFYITGAVLYGVRFP 273
           WRPYRA +FVAFGLSAVLPI+TG+ YYG  E + RIQ+KWV+L G+FYI GA LYG+RFP
Sbjct: 210 WRPYRAGLFVAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFP 269

Query: 274 EKYAPGKYDIWGHSHQLFHXXXXXXXXCHLYGLIKSYNLVHLKM 317
           EKY  G +DIWGHSHQ+FH        CHL  L+ SY LVH+ +
Sbjct: 270 EKYVNGTFDIWGHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313

>CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002c
          Length = 315

 Score =  389 bits (999), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 187/319 (58%), Positives = 236/319 (73%), Gaps = 7/319 (2%)

Query: 1   MSDSLKKRSQCSLTTDQTSTVTKEETSGPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEH 60
           M D  +++    +TT++   +    T G +K +K   +    RKLYTW+EIP WQ+DNEH
Sbjct: 1   MGDVHQRKVATMVTTEEQPLIG---TDGQIKLRKKTVV----RKLYTWEEIPEWQKDNEH 53

Query: 61  ILSGYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFDKFAVTQFETTTLID 120
           I +GYV ET S+ +C  SLFYLHNE+VNIY+HL+P IAF   + F+K+ V  + TTTLID
Sbjct: 54  IHTGYVRETSSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTIFFNKYVVPTYSTTTLID 113

Query: 121 YVMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFF 180
           Y++ID+F L +F+CL LSS FHCLK+HS  VA FGNKLDYLGIV L+V SMVSI+YYGF 
Sbjct: 114 YLIIDIFFLGAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFH 173

Query: 181 ETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYY 240
             P  F +FS IT TFGAACAVVSLK+ FR+REWRPYRAA+FV FGLSAVLPI+ G+F Y
Sbjct: 174 GNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKY 233

Query: 241 GFSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXX 300
           G +E + RIQ+KWV+L G+FYI GA LYG+RFPEK +PG +D+WGHSHQ+FH        
Sbjct: 234 GPTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAAL 293

Query: 301 CHLYGLIKSYNLVHLKMAI 319
           CHL  L+ SY+LVH +  I
Sbjct: 294 CHLKALLGSYSLVHYRFMI 312

>KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON}
           Anc_6.27 YOL002C
          Length = 321

 Score =  385 bits (989), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 184/315 (58%), Positives = 229/315 (72%), Gaps = 5/315 (1%)

Query: 1   MSDSLKKRSQCSLTTDQTSTVTKEETSGPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEH 60
           M  S  KRS   +T D       E+  G     +T +  +K  +LY W+EIP WQ+DNEH
Sbjct: 1   MISSRPKRSTRKVTIDTAFQDVVEQNKG-----ETIRSLEKIIQLYNWNEIPDWQKDNEH 55

Query: 61  ILSGYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFDKFAVTQFETTTLID 120
           I+SGYV ET S F C  SLFYLHNESVN+Y+HL+P + FL     +K  V +F TTT++D
Sbjct: 56  IISGYVKETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLMTSLLNKTIVPKFRTTTVLD 115

Query: 121 YVMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFF 180
           Y+ IDLF L +FTCL LSS FHC K+HS  +ATFGNKLDYLGIVVL+ TSM+S++YYGF+
Sbjct: 116 YLYIDLFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFY 175

Query: 181 ETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYY 240
           +TP+LFY+F+FIT +FG ACA VSLK+ FR+RE R YRA +FV FGLSAVLP++ G+++Y
Sbjct: 176 DTPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHY 235

Query: 241 GFSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXX 300
           GF   + RIQ+KWVLL G+FYI GA LYG+RFPEKY PGKYDIWGHSHQLFH        
Sbjct: 236 GFYNTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAAL 295

Query: 301 CHLYGLIKSYNLVHL 315
           CH   L+ SY  VH+
Sbjct: 296 CHFKALMCSYEHVHM 310

>KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  383 bits (984), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 180/291 (61%), Positives = 217/291 (74%), Gaps = 2/291 (0%)

Query: 24  EETSGPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEHILSGYVGETRSMFQCFLSLFYLH 83
           EE S  +K     +  + KR+LYTWDEIP WQRDNEHI+ GY+ ET+S ++C  SL YLH
Sbjct: 22  EENSSLLKDSNLKQ--RTKRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLH 79

Query: 84  NESVNIYTHLLPGIAFLFVLCFDKFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSIFHC 143
           NESVNIYTHLLPG  FL V  F++  + +FETT LIDYVMIDLF L  FTCL +SS+FHC
Sbjct: 80  NESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHC 139

Query: 144 LKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAACAVV 203
            K HS  VA  GNKLDYLGIV LVVTS+VSI++YGF +    F+LFS +T  FG ACA V
Sbjct: 140 FKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATV 199

Query: 204 SLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQVKWVLLGGIFYIT 263
           SL   FR+REWRPYRA++FVAFGLSA+LP++ G  +YG  E + RIQ++WVLLGG+FYI 
Sbjct: 200 SLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYIL 259

Query: 264 GAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXXCHLYGLIKSYNLVH 314
           GAVLYG+RFPE+ APG +DIWGHSHQLFH        CHL  L+ +Y L H
Sbjct: 260 GAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFH 310

>Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  380 bits (977), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 182/316 (57%), Positives = 230/316 (72%), Gaps = 4/316 (1%)

Query: 6   KKRSQCSLTTDQTSTVT--KEETSGPVKGQKTDKMSKKK--RKLYTWDEIPHWQRDNEHI 61
           K+  Q S   ++T +V   K+  +G       +    KK  ++LY+WDEIP WQRDN+ I
Sbjct: 6   KESFQMSTLLERTKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQRDNDFI 65

Query: 62  LSGYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFDKFAVTQFETTTLIDY 121
           L GYV ET S  + F SLFYLHNESVNIY+HL+P + F  VL  DK  +  FETTT  D+
Sbjct: 66  LHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLLDKSTIKVFETTTWKDH 125

Query: 122 VMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFE 181
           V+IDLF   +F CL LSS FHCLK+HS  +AT GNKLDYLGI +L+VTSMVSI++YG++E
Sbjct: 126 VVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYGYYE 185

Query: 182 TPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYG 241
             +LF LF+ IT +FG AC++VSLK+ FR REWRPYRA +FV FGLS+++PI +G++ Y 
Sbjct: 186 KFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYS 245

Query: 242 FSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXXC 301
           FSEI+ +IQ+ WVLLGG+ YI GAVLYG+RFPEK  PGK+DIWGHSHQLFH        C
Sbjct: 246 FSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLC 305

Query: 302 HLYGLIKSYNLVHLKM 317
           HL GL+ SY LVH+KM
Sbjct: 306 HLRGLLNSYELVHIKM 321

>YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}
           IZH2Plasma membrane protein involved in zinc homeostasis
           and osmotin-induced apoptosis; transcription regulated
           by Zap1p, zinc and fatty acid levels; similar to
           mammalian adiponectins; deletion increases sensitivity
           to elevated zinc
          Length = 317

 Score =  380 bits (976), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 180/306 (58%), Positives = 226/306 (73%), Gaps = 4/306 (1%)

Query: 16  DQTSTVT--KEETSGPVKGQKTDKMSKKK--RKLYTWDEIPHWQRDNEHILSGYVGETRS 71
           ++T +V   K+  +G       +    KK  R+LY+WDEIP WQRDN+ IL GYV ET S
Sbjct: 6   ERTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYVKETSS 65

Query: 72  MFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFDKFAVTQFETTTLIDYVMIDLFSLVS 131
             + F SLFYLHNESVNIY+HL+P + F  VL  DK  +  F TTT +D+++IDLF   +
Sbjct: 66  FIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDKSTIKVFATTTWLDHMVIDLFYSGA 125

Query: 132 FTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLFSF 191
           F CL LSS FHCLK+HS  +AT GNKLDYLGI +L+VTSMVSI+YYG+FE  +LF LF+ 
Sbjct: 126 FACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLFCLFAL 185

Query: 192 ITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQV 251
           IT +FG AC++VSLK+ FR REWRPYRA +FV FGLS+++PI +G++ Y FSEI+ +IQ+
Sbjct: 186 ITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQL 245

Query: 252 KWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXXCHLYGLIKSYN 311
            WVLLGG+ YI GAVLYG+RFPEK  PGK+DIWGHSHQLFH        CHL GL+ SY 
Sbjct: 246 FWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGLLNSYE 305

Query: 312 LVHLKM 317
           LVH+KM
Sbjct: 306 LVHIKM 311

>Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C -
           Hypothetical ORF [contig 185] FULL
          Length = 315

 Score =  377 bits (969), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 178/316 (56%), Positives = 226/316 (71%), Gaps = 5/316 (1%)

Query: 4   SLKKRSQCSLTTDQTSTVTKEETSGPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEHILS 63
            L KR    +   +   V  EET+  + G + ++  + +R+LY WDEIP WQ+DNEHIL+
Sbjct: 5   GLTKRKAVGI---EPEGVMTEETTTLLNGSRIEE--RTRRRLYKWDEIPEWQKDNEHILN 59

Query: 64  GYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFDKFAVTQFETTTLIDYVM 123
           GY+ ET+S+  C  SL YLHNESVNIYTHL+PG  FL +  F++ A+ ++ETT +IDY+M
Sbjct: 60  GYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIM 119

Query: 124 IDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFETP 183
           IDLF L  FTCL +SS FHC K HS  VA  GNKLDYLGIV LVVTSMVSI++YGF +  
Sbjct: 120 IDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNN 179

Query: 184 ALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGFS 243
             FY+FS +T  FG AC +VSL + FR+R+WRPYRAA+FVAFGLSA+ P++ GI +YGF 
Sbjct: 180 LYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFK 239

Query: 244 EIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXXCHL 303
             + RIQ+KWV L G+FYI GA+LYGVRFPE+ APG +DIWG SHQLFH        CHL
Sbjct: 240 VTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHL 299

Query: 304 YGLIKSYNLVHLKMAI 319
             L+ +Y  VH +M I
Sbjct: 300 RALLGAYKWVHSQMLI 315

>Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  375 bits (964), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 180/316 (56%), Positives = 230/316 (72%), Gaps = 4/316 (1%)

Query: 6   KKRSQCSLTTDQTSTVT--KEETSGPVKGQKTDKMSKKK--RKLYTWDEIPHWQRDNEHI 61
           K+  Q S   ++T +V   K+  +G       +    KK  ++LY+WDEIP WQRDN++I
Sbjct: 6   KEPFQMSTLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYI 65

Query: 62  LSGYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFDKFAVTQFETTTLIDY 121
           L GYV ET S  + F SLFY+HNESVNIY+HL+P + F  VL  DK  +  FETTT  D+
Sbjct: 66  LHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETTTWKDH 125

Query: 122 VMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFE 181
           ++IDLF   +F CL LSS FHCLK+HS  +AT GNKLDYLGI +L+VTSM SI+YYG++E
Sbjct: 126 MIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYE 185

Query: 182 TPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYG 241
             +LF LF+ IT +FG AC++V+LK+ FR REWRPYRA +FV FGLS+++PI +G++ Y 
Sbjct: 186 KFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYT 245

Query: 242 FSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXXC 301
           FSEI+ +IQ+ WVLLGG+ YI GAVLYG+RFPEK  PGK+DIWGHSHQLFH        C
Sbjct: 246 FSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFC 305

Query: 302 HLYGLIKSYNLVHLKM 317
           HL GL+ SY LVHLKM
Sbjct: 306 HLRGLLNSYELVHLKM 321

>Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON}
           (22700..23656) [957 nt, 319 aa]
          Length = 318

 Score =  366 bits (940), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 169/279 (60%), Positives = 213/279 (76%)

Query: 40  KKKRKLYTWDEIPHWQRDNEHILSGYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAF 99
           K+  +L TW+ +P WQ+DNEHILSGYV ET S+  C  SL ++HNESVNI++HL+P   F
Sbjct: 36  KRGVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCF 95

Query: 100 LFVLCFDKFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLD 159
           +  + FDK+ V ++ TTTL DY+M+DLF   +FTCL +SS FHCLK HS  V++FGNKLD
Sbjct: 96  MTTIIFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLD 155

Query: 160 YLGIVVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRA 219
           YLGIVVL+V+SM SI+YYGF++   L++ FS IT TFG +CAVVSL E FR REWRPYRA
Sbjct: 156 YLGIVVLIVSSMSSILYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRA 215

Query: 220 AMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPG 279
           AMFVAFGLSA+LPI  G  YYG  E  +R+Q+KWV+L G+FYI GA+LYGVRFPE+  PG
Sbjct: 216 AMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPG 275

Query: 280 KYDIWGHSHQLFHXXXXXXXXCHLYGLIKSYNLVHLKMA 318
            +DIWGHSHQLFH        CHL GL+ SY +VH +++
Sbjct: 276 MFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLS 314

>Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  363 bits (933), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 177/316 (56%), Positives = 231/316 (73%), Gaps = 4/316 (1%)

Query: 6   KKRSQCSLTTDQTSTVT--KEETSGPVKGQKTDKMSKKK--RKLYTWDEIPHWQRDNEHI 61
           K+  + S   ++T++V   K+  +G       +    KK  +++Y+WDEIP WQRDN++I
Sbjct: 6   KEAFEMSTLLERTNSVQELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQRDNDYI 65

Query: 62  LSGYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFDKFAVTQFETTTLIDY 121
           L GYV ET S    F SLFY+HNESVNIY+HL+P + FL VL  DK  +T FETTT +D+
Sbjct: 66  LHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLLDKTTITVFETTTWLDH 125

Query: 122 VMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFE 181
           +MIDLF   +F CL LSS FHC K+HS  +AT GNKLDYLGI +L+VTSMVSI+YYG+++
Sbjct: 126 MMIDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYGYYD 185

Query: 182 TPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYG 241
               F LF+ IT +FG AC++VSLK+ FR REWRPYRA +FV FGLS+++PI +G++YY 
Sbjct: 186 KFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYS 245

Query: 242 FSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXXC 301
           FSEI+ +IQ+ WVLLGG  YI GAVLYG+RFPEK  PG++DIWGHSHQLFH        C
Sbjct: 246 FSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLC 305

Query: 302 HLYGLIKSYNLVHLKM 317
           H+ G++ SY LVH+KM
Sbjct: 306 HMRGVLNSYELVHIKM 321

>TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27
           YOL002C
          Length = 319

 Score =  363 bits (931), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 170/290 (58%), Positives = 212/290 (73%), Gaps = 1/290 (0%)

Query: 33  QKTDKMSKKKRKLYTWDEIPHWQRDNEHILSGYVGETRSMFQCFLSLFYLHNESVNIYTH 92
           Q+ +      ++LYTWDEIP WQ DNE+I +GYV ET SM + FLSLFY+HNESVNIYTH
Sbjct: 27  QQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYVRETNSMKESFLSLFYIHNESVNIYTH 86

Query: 93  LLPGIAFLFVLCFDKFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSIFHCLKNHSRSVA 152
           L+P   FL +L F+ + V    TTT  DYV IDLF + +FTCL LSS FHC K+HS  ++
Sbjct: 87  LIPAFCFLSMLLFNTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFKSHSLKIS 146

Query: 153 TFGNKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAACAVVSLKEGFRTR 212
            FGNKLDYLGIV+L+ TS++S++Y+G+ + P +FY+FS IT  FG AC + SLK+ FRTR
Sbjct: 147 VFGNKLDYLGIVILISTSLISVLYFGYHDDPFIFYIFSGITLCFGIACGIASLKDKFRTR 206

Query: 213 EWRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQVKWVLLGGIFYITGAVLYGVRF 272
           EWRPYRAA+FV FGLS VLPI+ GI  YG  E++ R+Q+KW++  G+ YI GA LYG RF
Sbjct: 207 EWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVFERVQLKWIIWEGVLYIFGAFLYGARF 266

Query: 273 PEKYAPGKYDIWGHSHQLFHXXXXXXXXCHLYGLIKSYNLVHLKMAIAQL 322
           PEK+ PGK DIWG SHQ+FH        CHL GLI SY LVH K+  AQL
Sbjct: 267 PEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGLIGSYELVHQKLD-AQL 315

>ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  362 bits (928), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 168/297 (56%), Positives = 213/297 (71%), Gaps = 5/297 (1%)

Query: 21  VTKEETSGPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEHILSGYVGETRSMFQCFLSLF 80
           V +E+T+      K + ++ +K+ LYTW+EIP WQ+DNEHI+ GYV ET S+ +C  SL 
Sbjct: 23  VNQEQTT-----IKIEPVNTQKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLL 77

Query: 81  YLHNESVNIYTHLLPGIAFLFVLCFDKFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSI 140
           YLHNES+NIYTH LPG+ FL    FDKFA+  F+TTT IDY+ ID F   +F+CL LSS 
Sbjct: 78  YLHNESINIYTHFLPGLCFLATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSST 137

Query: 141 FHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAAC 200
           FHC K+HS  V+ FGNKLDYLGIV+L+V SM+SI+YY F ++  LFY F+ I   FG +C
Sbjct: 138 FHCFKSHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSC 197

Query: 201 AVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQVKWVLLGGIF 260
            + S  + FR+REWRPYRA +FVAFGLSA+LPI+ GI  YGF E + RIQ+KWV+L GIF
Sbjct: 198 TIASFDDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIF 257

Query: 261 YITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXXCHLYGLIKSYNLVHLKM 317
           YI GA LY +RFPE+ APG +D  GHSHQ+FH        CHL  L+ SY LVH  +
Sbjct: 258 YIFGAFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNL 314

>ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL002C
          Length = 329

 Score =  356 bits (913), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 174/321 (54%), Positives = 224/321 (69%), Gaps = 7/321 (2%)

Query: 1   MSDS-LKKRSQ-CSLTTDQTSTVTKEETSGPVKGQ-----KTDKMSKKKRKLYTWDEIPH 53
           M+DS LK+R +  +   D  S+ + +ET+    G         +  ++   L +WD++P 
Sbjct: 1   MNDSDLKQRVKFVAPENDTASSYSTKETTFLQDGTVAAAITATRAIREVSSLCSWDDLPD 60

Query: 54  WQRDNEHILSGYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFDKFAVTQF 113
           WQ+DNEHILSGYV ET S  + F SLFYLHNESVNIY+HL+PGI FLF+  F+K+ V  +
Sbjct: 61  WQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIALFNKYVVADY 120

Query: 114 ETTTLIDYVMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVS 173
            TTT  DY+MID+F L +  CLTLS ++HC+K+HS  V+ FGNKLDY+GIV L+  SM+S
Sbjct: 121 STTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIVALISCSMIS 180

Query: 174 IMYYGFFETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPI 233
            MYYGF+++ A+F LFS +T +   ACAVVSL   FR+REWR YRAA+F AFGLS +LP+
Sbjct: 181 QMYYGFYDSTAMFSLFSTVTLSLALACAVVSLSPHFRSREWRKYRAAIFTAFGLSGLLPV 240

Query: 234 VTGIFYYGFSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHX 293
           +T  FYYG  E Y RIQ+KW+ L G+ YI+GAVLYGVRFPEK  PG +DIWGHSHQLFH 
Sbjct: 241 ITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIWGHSHQLFHV 300

Query: 294 XXXXXXXCHLYGLIKSYNLVH 314
                  CHL  L+  Y  VH
Sbjct: 301 LVVIAALCHLRALLSCYKNVH 321

>TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27
           YOL002C
          Length = 327

 Score =  355 bits (910), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 170/321 (52%), Positives = 225/321 (70%), Gaps = 10/321 (3%)

Query: 2   SDSLKKRSQCSLTTDQTSTVTKEETSGPVKGQKTDK-----MSKKKRKLYT---WDEIPH 53
           S  L+KR+  ++ +  +S VT+EE +    G K++K     + +  R+L T   WD++P 
Sbjct: 4   SSRLQKRNGETIVS--SSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPD 61

Query: 54  WQRDNEHILSGYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFDKFAVTQF 113
           WQ+DNEHI  GYV ET S   CF SLF+LHNESVNIY+H++PG+  LF+L  D   + +F
Sbjct: 62  WQKDNEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDINIIKKF 121

Query: 114 ETTTLIDYVMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVS 173
            TTT +DY MIDLF   +F+CL LSS FH LK+HS  VA +GNKLDYLGIV+L+VTSM+S
Sbjct: 122 PTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMIS 181

Query: 174 IMYYGFFETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPI 233
           I+YYGF++TP  F+LFS IT  FG AC  VSL   FR+REWRPYRA +FV FGLSAV P+
Sbjct: 182 ILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPV 241

Query: 234 VTGIFYYGFSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHX 293
           +TGI+YYG  + + RIQ+KW++  G FYI GA LY +R+PE+  PG +D+WGHSHQ+FH 
Sbjct: 242 LTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHV 301

Query: 294 XXXXXXXCHLYGLIKSYNLVH 314
                   H +GL+ +Y   H
Sbjct: 302 FVVIAAYSHFHGLLSAYEYAH 322

>KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 308

 Score =  352 bits (902), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 174/316 (55%), Positives = 222/316 (70%), Gaps = 11/316 (3%)

Query: 4   SLKKRSQCSLTTDQTSTVTKEETSGPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEHILS 63
           S +KRS   + T++T+ +  EET G  K  +       +R++Y+WDEIP WQ+DNEHIL 
Sbjct: 2   STRKRS---VVTEETALI--EETPGTKKTVRV-----YERRVYSWDEIPDWQKDNEHILH 51

Query: 64  GYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCF-DKFAVTQFETTTLIDYV 122
           GYV ET+S  + F SLFYLHNESVNIYTHL+P +A  F++ F     + ++ TT+ IDY 
Sbjct: 52  GYVRETQSWKELFHSLFYLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYF 111

Query: 123 MIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFET 182
           MI+LF     TCLT+SS+FH +K HS  +ATFGNKLDYLGIVVL+ TSM+SI++YGF ++
Sbjct: 112 MINLFFFGCATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDS 171

Query: 183 PALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGF 242
             LFY F+ +T  FG  C  +SLK+ FR+REWRPYRA MFV FGLSAV PIV G   YG 
Sbjct: 172 SLLFYPFAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGK 231

Query: 243 SEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXXCH 302
            E + R+Q+ WV+  G+ YI GA LYGVRFPE+ APGK+DIWGHSHQLFH        CH
Sbjct: 232 DETWKRVQLTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHSHQLFHVLVVVAALCH 291

Query: 303 LYGLIKSYNLVHLKMA 318
           L  L+ SY LVH  ++
Sbjct: 292 LKALVVSYGLVHQALS 307

>Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to
           Ashbya gossypii ACL002C
          Length = 328

 Score =  334 bits (857), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 152/289 (52%), Positives = 200/289 (69%)

Query: 32  GQKTDKMSKKKRKLYTWDEIPHWQRDNEHILSGYVGETRSMFQCFLSLFYLHNESVNIYT 91
            Q T    K   KL++W EIP WQRDNEHIL GYV ET S  +   SL YLHNESVNIYT
Sbjct: 35  NQATTIPLKPASKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIYT 94

Query: 92  HLLPGIAFLFVLCFDKFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSIFHCLKNHSRSV 151
           HL+PG+ F  VL  +K+ +++F+TTT  DY +ID F + +F CL +S  +HCLK+HS  V
Sbjct: 95  HLIPGVCFFCVLFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPV 154

Query: 152 ATFGNKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAACAVVSLKEGFRT 211
           +  GN+LDY+GIV+L+ TSM S++YYGF+ +  +FY FS +T   G  C VV+L   FR+
Sbjct: 155 SIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRS 214

Query: 212 REWRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQVKWVLLGGIFYITGAVLYGVR 271
           R WRPYRA++FVAFGLS++LPI+  I YYG  E +  +Q+ W++L G+ YI GA +YG+R
Sbjct: 215 RLWRPYRASIFVAFGLSSILPILASILYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIR 274

Query: 272 FPEKYAPGKYDIWGHSHQLFHXXXXXXXXCHLYGLIKSYNLVHLKMAIA 320
           FPE  APG +DIWGHSHQLFH        CH   + +SY LVH ++  A
Sbjct: 275 FPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVHFRLNEA 323

>SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 314

 Score =  283 bits (723), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 133/301 (44%), Positives = 197/301 (65%), Gaps = 2/301 (0%)

Query: 16  DQTSTVTKEETSGPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEHILSGYVGETRSMFQC 75
             T+TV +   +      ++   +K +++L T++E+P WQ+DNE IL GYV ETRS+ +C
Sbjct: 2   SSTTTVRQRRKTTQKASAESIATAKGRKRLCTFEELPDWQKDNELILDGYVRETRSVSEC 61

Query: 76  FLSLFYLHNESVNIYTHLLPGIAFLFVLCF--DKFAVTQFETTTLIDYVMIDLFSLVSFT 133
           F SL Y HNE+VNIYTHL+PG+ +L +L F  D   + +F ++T+ DY++I+ F L +F 
Sbjct: 62  FKSLLYFHNETVNIYTHLVPGVTYLLMLMFLTDFILIPKFPSSTMTDYIIINFFLLGAFV 121

Query: 134 CLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLFSFIT 193
           CL  SS FHCLK HS   +   +K+DY+GI+VL+  SMVSI+YYGF +    F +F+ +T
Sbjct: 122 CLMCSSCFHCLKQHSEEHSDIWSKVDYMGIIVLISCSMVSILYYGFHDHLFHFKIFTVVT 181

Query: 194 CTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQVKW 253
              G+ CA   L + F ++ +R +RA+ FV+FG S ++PI+ G+  +G SE   R+Q+K+
Sbjct: 182 VILGSCCAAFVLNDRFNSKNFRVFRASFFVSFGFSGLVPIIFGLVKFGISESVHRVQLKY 241

Query: 254 VLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXXCHLYGLIKSYNLV 313
           V L  +FYI GAV YG R PE + PGK+D+ GHSHQ+FH        CHL  ++ SY  +
Sbjct: 242 VGLEAVFYIGGAVFYGFRIPENFGPGKFDLVGHSHQIFHVMVVLGSLCHLRAVVGSYIFM 301

Query: 314 H 314
           H
Sbjct: 302 H 302

>KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {ON}
           similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  276 bits (705), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 133/296 (44%), Positives = 186/296 (62%), Gaps = 4/296 (1%)

Query: 23  KEETSGPVKGQK--TDKMSKKKRKLYTWDEIPHWQRDNEHILSGYVGETRSMFQCFLSLF 80
           + +   P KG+   +   +  K  L  ++E+P WQRDN+ IL+GYV ET SM +CF SL 
Sbjct: 10  RRQQCAPNKGKAGTSGATAPGKNGLCCFEELPDWQRDNDKILAGYVRETNSMKKCFESLT 69

Query: 81  YLHNESVNIYTHLLPGIAFLFVLCF--DKFAVTQFETTTLIDYVMIDLFSLVSFTCLTLS 138
           Y HNE+VNIYTHL+P   +L +L F  D F + QF TTT+ DY+MI+ F L +F CL  S
Sbjct: 70  YFHNETVNIYTHLIPSGTYLVMLMFFTDLFLIPQFPTTTMSDYIMINFFLLGAFLCLMCS 129

Query: 139 SIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGA 198
           + FHCLK HS + +   +K+DY+GI+VL+  S VS++YYGF++    F +F+      G+
Sbjct: 130 TCFHCLKQHSEAQSNIWSKVDYMGIIVLISCSTVSLLYYGFYDYLFHFKMFTIAVVVLGS 189

Query: 199 ACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQVKWVLLGG 258
            CA   L + F  + WR  RA  FV FG S ++PIV G+  +G +E   R+Q+++VLL  
Sbjct: 190 CCAAFVLNDRFNAKNWRACRAGFFVTFGFSGIVPIVVGLVKFGIAESSKRVQLRFVLLEA 249

Query: 259 IFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXXCHLYGLIKSYNLVH 314
           +FYI+GAV+YG R PE   PGK+D  GHSHQ+FH        CH   L+ SY  +H
Sbjct: 250 LFYISGAVIYGFRIPETLLPGKFDFVGHSHQIFHILVVLGSLCHFRALLGSYFFMH 305

>TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON}
           Anc_3.90 YOL101C
          Length = 327

 Score =  271 bits (693), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 132/312 (42%), Positives = 195/312 (62%), Gaps = 6/312 (1%)

Query: 16  DQTSTVTKEETS----GPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEHILSGYVGETRS 71
           +Q+S +++   S    G V  + T+ +    +KLY++ E+P WQ+DNE I+ GYV ET S
Sbjct: 12  EQSSKLSRRRFSVSKNGTVLLESTEIVETYSKKLYSFHELPEWQKDNELIIQGYVRETNS 71

Query: 72  MFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCF--DKFAVTQFETTTLIDYVMIDLFSL 129
            F+CF SL Y HNES+NIYTHL+PG+ +  +L F  D   V  F +TT++DY++ID + L
Sbjct: 72  WFKCFHSLSYFHNESINIYTHLIPGLVYFIMLLFYTDLLVVPSFPSTTIMDYIVIDFYLL 131

Query: 130 VSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLF 189
            +F CL  SS FHCLK HS   + F +K+DY+GI+ L+  S++S++YYG+F+    F +F
Sbjct: 132 GAFICLVGSSCFHCLKQHSEDQSNFWSKIDYVGIICLISCSLISLLYYGYFDHFIYFKVF 191

Query: 190 SFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYLRI 249
           + IT      C V  L E F  + +RP RA  FV F  SAV+PI TG+  + + E+  RI
Sbjct: 192 TLITLILATICTVCVLDERFNAKNFRPIRAGFFVVFATSAVIPICTGLIKFDYVEVINRI 251

Query: 250 QVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXXCHLYGLIKS 309
           Q+++V     FY+ GA+LYG R PE +APG++D+ G SHQ+FH         HL  +I S
Sbjct: 252 QLRFVGWETFFYVVGALLYGYRIPEIFAPGRFDLVGSSHQIFHVMVVIGSLFHLKAVIGS 311

Query: 310 YNLVHLKMAIAQ 321
           Y  +H  + + +
Sbjct: 312 YEFMHKSLNVIE 323

>Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W -
           Hypothetical ORF [contig 184] FULL
          Length = 320

 Score =  271 bits (692), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 136/313 (43%), Positives = 191/313 (61%), Gaps = 8/313 (2%)

Query: 18  TSTVTKEETSGPVKGQ-KTDKMSK-----KKRKLYTWDEIPHWQRDNEHILSGYVGETRS 71
           +ST T ++     K + K  K SK     KK  L  ++E+P WQRDNE IL+GYV ETRS
Sbjct: 2   SSTCTLKQRRSACKNELKNGKNSKSAEQTKKSALCRFEELPEWQRDNEKILAGYVRETRS 61

Query: 72  MFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCF--DKFAVTQFETTTLIDYVMIDLFSL 129
           M +C  SL Y HNE++NIYTHL+P   +L +L F  D F +  F +TT+ DY+MI+ + L
Sbjct: 62  MRKCLESLTYFHNETLNIYTHLIPSGTYLVLLMFFTDVFLIPHFPSTTMSDYIMINFYLL 121

Query: 130 VSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLF 189
            +F CL  S+ FHCLK HS + +   +K+DY+GI+VL+  S VS++YYGF +    F +F
Sbjct: 122 GAFLCLLCSTCFHCLKQHSEAQSNIWSKVDYMGIIVLISCSTVSLLYYGFHDYLFHFKIF 181

Query: 190 SFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYLRI 249
           +      G+ CA   L + F  + WR  RA  FV FG S ++PI+ G+  +G +E   R+
Sbjct: 182 TIAVVVLGSCCAAFVLNDRFNAKNWRACRAGFFVTFGFSGIVPIIMGLVKFGVAESSKRV 241

Query: 250 QVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXXCHLYGLIKS 309
           Q+++VLL   FYI GA++YG R PE   PGK+D  GHSHQ+FH        CH   LI S
Sbjct: 242 QLRFVLLEAFFYIGGAIIYGFRIPETLIPGKFDFVGHSHQIFHILVVLGSLCHFRALIGS 301

Query: 310 YNLVHLKMAIAQL 322
           Y  +H  ++ + L
Sbjct: 302 YFFMHTGISSSSL 314

>Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  269 bits (688), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 135/311 (43%), Positives = 195/311 (62%), Gaps = 8/311 (2%)

Query: 6   KKRSQCSLTTDQTSTVTKEETSGPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEHILSGY 65
           ++R+Q S+    T+   K      V+  ++   S+K++ L+ +DE+P WQ+DN+ IL+GY
Sbjct: 7   RRRNQESVCCKATTASIK------VEAVQSKTASEKEKLLHNFDELPEWQKDNDKILTGY 60

Query: 66  VGETRSMFQCFLSLFYLHNESVNIYTHLLPGIA-FLFVLCF-DKFAVTQFETTTLIDYVM 123
           V ET S  +C  SLFY +NE+VNIYTHL+P I  FLF +   + F +  F +T+  DY +
Sbjct: 61  VRETLSWKKCLRSLFYWNNETVNIYTHLVPAIIYFLFAITLTNYFLIPVFPSTSWSDYTV 120

Query: 124 IDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFETP 183
           I++F + +F+CL  SS FHCLK HS   + F +KLDYLGI+ L+  SM+ I+Y+G+F+  
Sbjct: 121 INIFLMGAFSCLMCSSCFHCLKQHSEEQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHV 180

Query: 184 ALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGFS 243
           + F LF+ +T      C V  L E F T  +RP+RA  F+ FG S +LP+ TG F +G  
Sbjct: 181 SYFSLFTTVTLVLATFCTVCVLHEKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQ 240

Query: 244 EIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXXCHL 303
            +  RI+V +V    +FYI+GAV+YG R PE  APGK+D  G SHQ+FH        CHL
Sbjct: 241 GVLNRIKVSFVFWEALFYISGAVIYGFRIPETIAPGKFDFLGSSHQIFHIMVVLGSLCHL 300

Query: 304 YGLIKSYNLVH 314
             +I SY L+H
Sbjct: 301 KAIIDSYKLMH 311

>AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR492W (IZH1) and
           YOL101C (IZH4)
          Length = 317

 Score =  268 bits (685), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 130/291 (44%), Positives = 189/291 (64%), Gaps = 2/291 (0%)

Query: 22  TKEETSGPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEHILSGYVGETRSMFQCFLSLFY 81
           T  E +  +    ++ + K+ RKLYT+DE+P WQ+DNE ILSGYV ET S+ +C  ++ Y
Sbjct: 11  TISEMAQEMAHTTSEGLKKRIRKLYTFDELPAWQKDNELILSGYVRETNSVKECLRAMTY 70

Query: 82  LHNESVNIYTHLLPGIAFLFV-LCFDKFAVTQF-ETTTLIDYVMIDLFSLVSFTCLTLSS 139
            +NES+NIYTHL+PG+A+L + L F    + Q        ++ M+  + L +FTCL  SS
Sbjct: 71  FNNESINIYTHLIPGVAYLVLFLIFADLVLAQLLPGLDAGEHRMLRFYLLGAFTCLACSS 130

Query: 140 IFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAA 199
            FHCLK HS   +   +K+DYLGI+  +  S +S++YYG+   P+ F  FS +T    +A
Sbjct: 131 CFHCLKQHSEPHSRLWSKVDYLGILAQITCSTISLLYYGYHSYPSHFVFFSTLTVALCSA 190

Query: 200 CAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQVKWVLLGGI 259
           CAV+ L + F T  +RP RA +F+AFGLS V+P++ G + +GF+E   RIQ+K+VL   +
Sbjct: 191 CAVLVLNDSFNTVAFRPLRAFLFMAFGLSGVIPVLAGSYQFGFAEWAARIQLKYVLYEAV 250

Query: 260 FYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXXCHLYGLIKSY 310
           FYITGA++YG R PE++APGK+D+ GHSHQ+FH        CH   +  SY
Sbjct: 251 FYITGALVYGFRIPERFAPGKFDMVGHSHQIFHLLVVLGTLCHFRAVTGSY 301

>Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  267 bits (683), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 134/311 (43%), Positives = 195/311 (62%), Gaps = 8/311 (2%)

Query: 6   KKRSQCSLTTDQTSTVTKEETSGPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEHILSGY 65
           ++R+Q S+    T+   K      V+   +  +S+KK+ L+ +DE+P WQ+DN+ IL+GY
Sbjct: 7   RRRNQESVCCSVTTGSIK------VEAVSSTTVSEKKKLLHNFDELPEWQKDNDKILTGY 60

Query: 66  VGETRSMFQCFLSLFYLHNESVNIYTHLLPG-IAFLFVLCF-DKFAVTQFETTTLIDYVM 123
           V ET S  +C  SLFY +NE+VNIYTHL+P  I F+F +   + F +  F +T+  DY +
Sbjct: 61  VRETLSWKKCLYSLFYWNNETVNIYTHLVPAVIYFVFAITLTNYFLIPVFPSTSWSDYTV 120

Query: 124 IDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFETP 183
           I++F + +F+CL  SS FHC+K HS   + F +KLDYLGI+ L+  SM+ I+Y+G+F+  
Sbjct: 121 INIFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHI 180

Query: 184 ALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGFS 243
           + F LF+ +T      C V  L E F T  +RP+RA  F+ FG S +LP+ TG F +G  
Sbjct: 181 SYFSLFTIVTLVLATFCTVCVLHEKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQ 240

Query: 244 EIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXXCHL 303
            +  RI+V +V    +FYI+GAV+YG R PE  APGK+D  G SHQ+FH        CHL
Sbjct: 241 GVLNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFLGSSHQIFHIMVVLGSICHL 300

Query: 304 YGLIKSYNLVH 314
             +I SY L+H
Sbjct: 301 KAIIGSYKLMH 311

>TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90
           YOL101C
          Length = 316

 Score =  266 bits (681), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 131/302 (43%), Positives = 194/302 (64%), Gaps = 5/302 (1%)

Query: 18  TSTVTKEETSGPVKGQKTDKMSKKK---RKLYTWDEIPHWQRDNEHILSGYVGETRSMFQ 74
           +ST T  +    V+  +  + SK     +KLY ++E+P WQ+DN+ IL+GYV ET+S+ +
Sbjct: 2   SSTTTIRQRKTTVQETQKARDSKDGIMGKKLYHFNELPEWQQDNDKILTGYVRETKSVLR 61

Query: 75  CFLSLFYLHNESVNIYTHLLPGIAFLFVLCF--DKFAVTQFETTTLIDYVMIDLFSLVSF 132
           C  SL Y +NESVNIYTHLL  +A+  +L F  D   +  F +TT+ DY++I+ + L +F
Sbjct: 62  CLDSLSYWNNESVNIYTHLLSAVAYFVLLLFFTDILLIPSFPSTTMTDYIIINFYLLGAF 121

Query: 133 TCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLFSFI 192
            CL  SS FHC K HS S +   +K+DY+GI+ L+  S++S++YYG+F+    F LFS I
Sbjct: 122 VCLMCSSCFHCFKQHSNSQSDAWSKVDYMGIIGLISCSVISLLYYGYFDHVFYFKLFSVI 181

Query: 193 TCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQVK 252
           T     AC+V  L + F T + RP RA+ F+ F  S+V+PI TG+F +G++E++ R+Q++
Sbjct: 182 TVVLAMACSVCVLSDRFNTSDMRPLRASFFITFAFSSVIPIATGMFKFGWTEVFHRVQLR 241

Query: 253 WVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXXCHLYGLIKSYNL 312
           +V     FY++GA+LYG R PE  APGK+D  G SHQLFH        CHL  ++ SY  
Sbjct: 242 FVGWEAFFYLSGALLYGYRIPETIAPGKFDFIGSSHQLFHVLVVLGSFCHLRAVMGSYMF 301

Query: 313 VH 314
           +H
Sbjct: 302 MH 303

>YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membrane
           protein involved in zinc ion homeostasis, member of the
           four-protein IZH family; transcription is regulated
           directly by Zap1p, expression induced by zinc deficiency
           and fatty acids; deletion increases sensitivity to
           elevated zinc
          Length = 316

 Score =  266 bits (681), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 134/311 (43%), Positives = 195/311 (62%), Gaps = 8/311 (2%)

Query: 6   KKRSQCSLTTDQTSTVTKEETSGPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEHILSGY 65
           ++R+Q S+    T    K E    V GQ    + +K++ L+ +DE+P WQ+DN+ IL+GY
Sbjct: 7   RRRNQDSVCCKATRASIKVEA---VSGQT---VFEKQKLLHNFDELPEWQKDNDKILTGY 60

Query: 66  VGETRSMFQCFLSLFYLHNESVNIYTHLLPGIA-FLFVLCF-DKFAVTQFETTTLIDYVM 123
           V ET S  +C  SLFY +NE+VNIYTHL+P I  F+F +   + F +  F +T+  DY +
Sbjct: 61  VRETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFAITLTNYFLIPVFPSTSWSDYTV 120

Query: 124 IDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFETP 183
           I++F + +F+CL  SS FHC+K HS   + F +KLDYLGI+ L+  SM+ I+Y+G+F+  
Sbjct: 121 INIFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHI 180

Query: 184 ALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGFS 243
           + F LF+ +T      C V  L + F T  +RP+RA  F+ FG S +LP+ TG F +G  
Sbjct: 181 SYFSLFTIVTLVLATFCTVCVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQ 240

Query: 244 EIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXXCHL 303
            +  RI+V +V    +FYI+GAV+YG R PE  APGK+D +G SHQ+FH        CHL
Sbjct: 241 GVLNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHL 300

Query: 304 YGLIKSYNLVH 314
             +I SY L+H
Sbjct: 301 KAIIDSYKLMH 311

>Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W
           (REAL)
          Length = 315

 Score =  266 bits (680), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 129/301 (42%), Positives = 188/301 (62%), Gaps = 2/301 (0%)

Query: 16  DQTSTVTKEETSGPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEHILSGYVGETRSMFQC 75
           +Q +   K  TS  V+  K+    +K++ L+ + E+P WQRDN+ IL+GYV ET S  +C
Sbjct: 10  NQENVCCKTSTSIKVEALKSKVTLRKEKLLHDFHELPDWQRDNDKILTGYVRETLSWKKC 69

Query: 76  FLSLFYLHNESVNIYTHLLPGIAFLF--VLCFDKFAVTQFETTTLIDYVMIDLFSLVSFT 133
             SLFY +NE+VNIYTHL+P I +    V   + F +  F +TT  DY +I++F + +F 
Sbjct: 70  LYSLFYWNNETVNIYTHLVPAIVYFVFGVTLTNYFLIPVFPSTTWSDYTVINIFLMGAFL 129

Query: 134 CLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLFSFIT 193
           CL  SS FHC+K HS   + F +KLDYLGI+ L+  SM+ I+Y+G+F+  + F LF+ +T
Sbjct: 130 CLMCSSCFHCMKQHSEKQSDFWSKLDYLGIISLISCSMIPIIYFGYFDHASYFSLFTIVT 189

Query: 194 CTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQVKW 253
                 C +  L + F T  +RP+RA  F+ FG S +LP+ TG+F +G   +  RI+V +
Sbjct: 190 LVLATFCTICVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGLFKFGLQGVLNRIRVSF 249

Query: 254 VLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXXCHLYGLIKSYNLV 313
           V    +FYI+GA++YG R PE  APGK+D +G SHQ+FH        CHL  +I SY L+
Sbjct: 250 VFWEALFYISGALIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKAIIDSYKLM 309

Query: 314 H 314
           H
Sbjct: 310 H 310

>NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {ON}
           Anc_3.90
          Length = 330

 Score =  259 bits (662), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 134/316 (42%), Positives = 204/316 (64%), Gaps = 12/316 (3%)

Query: 5   LKKRSQCSLTTDQTSTVTKEETSGPVKGQKTDKMSKKKRKLY--TWDEIPHWQRDNEHIL 62
           L+ RS       +T+ +   +TS      +  K +++KRK++   +DE+P WQ+DN+ IL
Sbjct: 17  LRSRSNSVGGIFETNHLEDNDTS------QKPKTNRRKRKIHLSKFDELPEWQKDNDKIL 70

Query: 63  SGYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFV---LCFDKF-AVTQFETTTL 118
           +GYV ET S   CF SLFYL+NE++NIYTHL+P I +L V     F  F A+ +F TT++
Sbjct: 71  TGYVRETNSFIHCFQSLFYLNNETINIYTHLIPSIIYLIVSLTFIFINFIAIPKFPTTSV 130

Query: 119 IDYVMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYG 178
           IDY++I++F L +FTCL LSS FHCLK HS    T  +KLDY+GI++L+  S++ I+Y+G
Sbjct: 131 IDYIVINIFILGAFTCLLLSSCFHCLKQHSFKQCTLWSKLDYIGIIILISCSIIPILYFG 190

Query: 179 FFETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIF 238
           +F+  + F  F+ +T +F   C+++ L E F    +RP RA +F+ F  + ++P++TG +
Sbjct: 191 YFDRLSYFKFFTILTFSFAIVCSIIVLNEKFDLPSYRPLRAGLFMLFSFTGLIPMITGFY 250

Query: 239 YYGFSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXX 298
            +G+  +  RI + +VLL  IFYI G +LYG R PE + PG +D++G SHQ+FH      
Sbjct: 251 IFGYKGVMERISLNFVLLEAIFYIIGTLLYGFRIPETFKPGNFDMFGSSHQIFHIFVVLG 310

Query: 299 XXCHLYGLIKSYNLVH 314
             CH   +IKSY L+H
Sbjct: 311 SICHFGAVIKSYCLMH 326

>KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa]
           {ON} similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  253 bits (647), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 131/303 (43%), Positives = 189/303 (62%), Gaps = 3/303 (0%)

Query: 18  TSTVTKEETSGPVKGQKTD-KMSKKKRKLYTWDEIPHWQRDNEHILSGYVGETRSMFQCF 76
           T+T+    +      Q T   +S   ++LY + E+P WQ+DN+ I++GY+ ET+S+ +C 
Sbjct: 4   TTTIRHRRSISEKLEQLTPVAISSTIKRLYRYSELPEWQQDNDKIITGYIRETKSVKECV 63

Query: 77  LSLFYLHNESVNIYTHLLPGIAFLFVLC--FDKFAVTQFETTTLIDYVMIDLFSLVSFTC 134
            SLF  HNES+NIY+HL+P I +L +L    D F V QF  +T++  VMI  F L S  C
Sbjct: 64  KSLFLFHNESINIYSHLVPTITYLVLLVGLADMFLVPQFPNSTMMQSVMIHFFLLGSVLC 123

Query: 135 LTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLFSFITC 194
           L  SS FHCLK HS S     +K+DY+GI++++  S++S++YYGF +    F  F+  T 
Sbjct: 124 LGCSSFFHCLKQHSESHCHIWSKVDYMGIIIMITCSIISLLYYGFHDHIFHFKCFTVFTV 183

Query: 195 TFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQVKWV 254
             G  C V +L + F ++ +RP+RA  +V FGLS ++PIVTG + +G  E   R+Q+K+V
Sbjct: 184 ILGTICTVFALHDKFNSKTFRPFRAMFYVTFGLSGIVPIVTGFWKFGAYEAIRRVQLKYV 243

Query: 255 LLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXXCHLYGLIKSYNLVH 314
           LL  +FYI GAV+YG RFPE  APGK+D  GHSHQ+FH        CH   ++ SY  +H
Sbjct: 244 LLEAMFYIAGAVIYGFRFPEVLAPGKFDFVGHSHQIFHIMVVLGSICHFRAILGSYVFMH 303

Query: 315 LKM 317
             M
Sbjct: 304 TGM 306

>CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar to
           uniprot|Q03419 Saccharomyces cerevisiae YDR492w
          Length = 316

 Score =  253 bits (647), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 124/304 (40%), Positives = 190/304 (62%), Gaps = 3/304 (0%)

Query: 14  TTDQTSTVTKEETSGPVKGQKTDKMSKKKRKL-YTWDEIPHWQRDNEHILSGYVGETRSM 72
           T  + ++ +  E+ G   G       +K  KL + ++E+P WQ+DN+ IL GYV ET S 
Sbjct: 6   TLRKRASKSVGESGGRNDGSIHAHGEEKSEKLLWHFNELPEWQKDNDKILRGYVRETNSF 65

Query: 73  FQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCF--DKFAVTQFETTTLIDYVMIDLFSLV 130
            +C  SL YL+NESVNIYTHL+P + ++ +  +  + F +  + +T+ +DYV+I++F L 
Sbjct: 66  KRCLQSLLYLNNESVNIYTHLIPAVFYISLSLYLANVFLIPVYPSTSSVDYVIINVFFLG 125

Query: 131 SFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLFS 190
           +F CL  SS FHC+K HS S     +KLDYLGI+ L+  S V ++YYG+F+  + F +F+
Sbjct: 126 AFFCLLCSSCFHCMKQHSESQCNVWSKLDYLGIICLISCSTVPMIYYGYFDHISEFTIFT 185

Query: 191 FITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQ 250
            IT      C+V  L + F T E+RP RA+ F  FG S ++P+  G   +G   +  RI 
Sbjct: 186 GITLLLAIGCSVFVLTDKFNTTEYRPIRASFFTLFGFSGIIPLGAGFLKFGAEGVLQRIS 245

Query: 251 VKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXXCHLYGLIKSY 310
           + ++ L  +FYI+GA++YG RFPE  APGK+D +G SHQ+FH        CHL+ +++SY
Sbjct: 246 LPFIGLEALFYISGAIIYGFRFPETIAPGKFDFFGSSHQIFHIMVVLGSICHLFAMVESY 305

Query: 311 NLVH 314
           +L+H
Sbjct: 306 HLIH 309

>Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR337W
          Length = 305

 Score =  248 bits (633), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 125/288 (43%), Positives = 173/288 (60%), Gaps = 2/288 (0%)

Query: 25  ETSGPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEHILSGYVGETRSMFQCFLSLFYLHN 84
           +TSG V+ ++        R+LY++DE+P WQ+DNE I  GYV ET S  +C  S+ Y +N
Sbjct: 2   KTSGFVESRRCGHKKNFNRRLYSFDELPEWQKDNELIRMGYVRETNSFLECLKSMTYFNN 61

Query: 85  ESVNIYTHLLPGIAFLFVLCFDKFA--VTQFETTTLIDYVMIDLFSLVSFTCLTLSSIFH 142
           ESVNIYTHL+P + +  +L           F  TT+ +Y+MID +    F CL  S+ FH
Sbjct: 62  ESVNIYTHLVPSVTYFILLLLFVDLVVTPMFPGTTMREYIMIDFYLFGVFVCLMCSTCFH 121

Query: 143 CLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAACAV 202
           CLK HS S     +K+DY+GI+V + +S+VSI+YYGF++  +     S +T T G  C  
Sbjct: 122 CLKQHSESHNRIWSKVDYIGIIVQITSSIVSILYYGFYDHISHIKWLSVLTLTLGVCCVT 181

Query: 203 VSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQVKWVLLGGIFYI 262
             L + F   ++R  RA  F  FG S V+P++ GI+ +G  E   RIQ+K+VL G IFYI
Sbjct: 182 FVLNDRFNAIDYRLLRAIFFTVFGFSGVVPVLIGIYQFGLIEWLARIQLKFVLAGTIFYI 241

Query: 263 TGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXXCHLYGLIKSY 310
            GA++YG R PE  APGK+D  GHSHQ+FH        CH   +I SY
Sbjct: 242 FGALIYGFRIPEALAPGKFDFIGHSHQIFHLLVVLGSICHFRAVIGSY 289

>ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 318

 Score =  248 bits (633), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 121/289 (41%), Positives = 177/289 (61%), Gaps = 2/289 (0%)

Query: 28  GPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEHILSGYVGETRSMFQCFLSLFYLHNESV 87
           G   G+   K   +++ LY + E+P WQ+DN+ IL+GY+ ET+S+ +C  SLF  +NE+V
Sbjct: 15  GNGNGEGLYKEVLEEKTLYDFHELPEWQQDNDKILTGYIRETKSVLKCVRSLFIWNNETV 74

Query: 88  NIYTHLLPGIAFLFVL--CFDKFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSIFHCLK 145
           NIYTHL+  +++  ++    D   V  F T+T  DY +I+ + L +F CL  SS FH  K
Sbjct: 75  NIYTHLVSAVSYFLLMLGITDLVMVPHFPTSTFTDYSVINFYLLGAFGCLMCSSCFHTFK 134

Query: 146 NHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAACAVVSL 205
            HS   +   +K+DY+GI+VL+  SM+S++YYGFF+    F LF+ +T T   AC V  L
Sbjct: 135 QHSGPHSDAWSKVDYMGIIVLITCSMISLIYYGFFDHMEYFRLFTVLTLTLATACTVCVL 194

Query: 206 KEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQVKWVLLGGIFYITGA 265
            + F  +++RP RA  F+AFGLS V P+  GI  +G      R+Q+K++ L  IFYI GA
Sbjct: 195 SDKFNHKDFRPLRAGFFIAFGLSGVFPVAAGIIKFGIQGGVQRVQLKYLGLEAIFYIAGA 254

Query: 266 VLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXXCHLYGLIKSYNLVH 314
           ++YG R PE   PG++D WGHSHQ+FH         HL  ++ SY   H
Sbjct: 255 LIYGFRIPETMFPGRFDFWGHSHQIFHVLVVIASFLHLKAVMGSYIFKH 303

>NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON}
           Anc_3.90 YDR492W
          Length = 314

 Score =  247 bits (631), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 126/312 (40%), Positives = 189/312 (60%), Gaps = 3/312 (0%)

Query: 9   SQCSLTTDQTSTVTKEETSGPVKGQKTDKMSKK-KRKLYTWDEIPHWQRDNEHILSGYVG 67
           S+ + T  + + V         K    DK  +  KR+L+ ++E+P WQRDN+ IL+GYV 
Sbjct: 2   SRVTTTRRKPTKVQAVAVGSSNKHADGDKTKRNWKRRLFNFNELPEWQRDNDKILTGYVR 61

Query: 68  ETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLF--VLCFDKFAVTQFETTTLIDYVMID 125
           ET+S  QC  SL Y +NE++NIYTHL+P + +L   V   +   V  F TT+++DY +I+
Sbjct: 62  ETKSFKQCLQSLLYWNNETINIYTHLIPALFYLTISVTLINYVVVPHFPTTSIMDYFVIN 121

Query: 126 LFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFETPAL 185
           +F + +F CL LSS FHCLK HS    T  +KLDY+GI++L+  S++ ++Y+G+F+    
Sbjct: 122 VFLMGAFVCLILSSCFHCLKQHSSRQCTLWSKLDYMGIIILISCSLIPMIYFGYFDHLYY 181

Query: 186 FYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEI 245
              F  +T +F   C++  L E F    +RP+RA +F+ F  S  +PI+TG + +GF  +
Sbjct: 182 VNFFIILTFSFATLCSICVLNEKFNVPHYRPFRAIVFMLFSFSGFIPILTGFYLFGFHGV 241

Query: 246 YLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXXCHLYG 305
           + R+ +K+V    +FYITGA LYG R PE + PG +D  G SHQ+FH        CH   
Sbjct: 242 FERVALKFVAWEALFYITGATLYGFRIPECFKPGDFDFLGSSHQIFHILVVLGSICHFRA 301

Query: 306 LIKSYNLVHLKM 317
           +IKSY L+H  M
Sbjct: 302 VIKSYILMHSSM 313

>KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3.90
           YOL101C
          Length = 319

 Score =  246 bits (629), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 125/315 (39%), Positives = 191/315 (60%), Gaps = 16/315 (5%)

Query: 6   KKRSQCSLTTDQTSTVTKEETSGPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEHILSGY 65
           +KRS+   +   T T T+ ++S  ++          KR LY + E+P WQ+DN+ IL GY
Sbjct: 10  RKRSKSFRSAKSTITRTRSDSSIKIE----------KRILYHFHELPTWQQDNDKILGGY 59

Query: 66  VGETRSMFQCFLSLFYLHNESVNIYTHLLPG-----IAFLFVLCFDKF-AVTQFETTTLI 119
           V ET S  +C  SLFYL+NES+NIY+HL+P      IA + ++  D+F  +  + TTT  
Sbjct: 60  VRETNSFTKCIESLFYLNNESINIYSHLIPSLIYLTIAVMLLIEIDQFLNIPIYPTTTKY 119

Query: 120 DYVMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGF 179
           D++ I++F + +F CL  S  FH LK HS     F +++DY+GI+VL+  SM+ ++YYGF
Sbjct: 120 DFIFINIFLVGAFLCLLGSGCFHLLKQHSELQCNFWSRIDYMGIIVLISCSMMPVLYYGF 179

Query: 180 FETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFY 239
           F+   LFY F  +T  F + C+++ + E F   ++R  RA +F AFG S ++P++ G   
Sbjct: 180 FDHIVLFYCFITLTLAFASVCSIIVMSETFNLSKYRLLRACVFAAFGFSGLIPMIVGFSK 239

Query: 240 YGFSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXX 299
           +G S ++ RI +K++    +FY+ GA LYG R PE   PGK+D++G SHQLFH       
Sbjct: 240 FGLSGVFQRISLKFIFWESVFYLVGATLYGFRIPESILPGKFDLFGSSHQLFHCFVVIGS 299

Query: 300 XCHLYGLIKSYNLVH 314
             H   +I+SY L+H
Sbjct: 300 VLHFKAVIESYILMH 314

>Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON}
           complement(40099..41073) [975 nt, 325 aa]
          Length = 324

 Score =  245 bits (626), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 123/307 (40%), Positives = 190/307 (61%), Gaps = 5/307 (1%)

Query: 17  QTSTVTKEETSGPVKGQKTDKMSKKKR---KLYTWDEIPHWQRDNEHILSGYVGETRSMF 73
           + S+V+K  TS    G  T ++ +++    KL  + E+P WQ+DNE IL+GYV ET S+ 
Sbjct: 10  EYSSVSKRRTSKSANGTVTIEVEREEHEEIKLCHFHELPDWQKDNEFILTGYVRETNSIK 69

Query: 74  QCFLSLFYLHNESVNIYTHLLPGIAFLFVLCF--DKFAVTQFETTTLIDYVMIDLFSLVS 131
           +C  SL   +NES+NIY+HL+  I++  VL F  D   +  F +TT +DY++IDL+ L +
Sbjct: 70  KCLRSLGCFNNESINIYSHLIAAISYFVVLLFYTDILCIPSFPSTTFVDYMVIDLYLLGA 129

Query: 132 FTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLFSF 191
           FTCL  SS+FHC+K HS S +   +K+DY+GI+ L+  S++S++YYG+ +    F +F+ 
Sbjct: 130 FTCLIGSSLFHCMKQHSESHSDMWSKVDYIGIICLITCSLISLLYYGYMDHFIYFKVFTV 189

Query: 192 ITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQV 251
           IT      C +  L + F ++ +RP RA  F+ F +SAV+PI  G   +GF+E+  RIQ+
Sbjct: 190 ITLVLATICTICVLDQRFNSKNFRPIRAGFFILFSMSAVIPIGAGFSKFGFTEVLQRIQL 249

Query: 252 KWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXXCHLYGLIKSYN 311
           ++V     FY+ GA+LYG R PE   PG +D+ G SHQ+FH         HL  ++ SY 
Sbjct: 250 RFVAWETFFYVVGALLYGFRIPETLYPGNFDLVGSSHQIFHIMVILGSVFHLKAVLGSYT 309

Query: 312 LVHLKMA 318
            +H  ++
Sbjct: 310 FMHSNIS 316

>TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON}
           Anc_3.90 YOL101C
          Length = 326

 Score =  238 bits (608), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 125/318 (39%), Positives = 189/318 (59%), Gaps = 11/318 (3%)

Query: 2   SDSLKKRSQCSLTTDQTSTVTK--EETSGPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNE 59
           S      S   LT  ++ +++    + +  VK + TD +      LYT++E+P WQ+DNE
Sbjct: 4   STGANAHSSSPLTHHRSKSISSILSQAAEDVKQKITDTL------LYTYEELPSWQQDNE 57

Query: 60  HILSGYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCF---DKFAVTQFETT 116
            IL+GY+ ET S   C  SL + HNE++NIY+H +    +L +L F   +   +  F TT
Sbjct: 58  MILTGYIRETNSWKLCLRSLTFFHNETINIYSHGISAAIYLLLLVFFFTNLIYLPSFPTT 117

Query: 117 TLIDYVMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMY 176
           TL DY+++D++ L + TCLTLSS FHCLK HS+S +   +K+DY+GI+ L+  S +S++Y
Sbjct: 118 TLHDYLVLDIYLLGAATCLTLSSCFHCLKQHSQSQSDIWSKMDYIGIICLITCSTISLLY 177

Query: 177 YGFFETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTG 236
           +G+ +    F  F+  T      C V    E F TR+W+  RA  F+AF  S ++P++TG
Sbjct: 178 FGYRDHFNYFKFFAISTFILAITCTVFVTMEKFNTRDWKHVRALFFIAFAGSGLIPLITG 237

Query: 237 IFYYGFSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXX 296
           I  +GF E++ R+Q+  + L  I Y+ GA+LYG R PE +APGK+D  G+SHQ FH    
Sbjct: 238 INIFGFPEVWQRVQLPSLTLELICYVIGALLYGYRIPEVFAPGKFDNIGNSHQWFHIFVV 297

Query: 297 XXXXCHLYGLIKSYNLVH 314
                HL  L+ SY  +H
Sbjct: 298 LGSLLHLRALVGSYYFMH 315

>KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.90
           YOL101C
          Length = 323

 Score =  229 bits (583), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 122/323 (37%), Positives = 197/323 (60%), Gaps = 5/323 (1%)

Query: 1   MSDSLKKRS-QCSLTTDQTSTVTKEETSGP-VKGQKTDKMSKKKRKLYTWDEIPHWQRDN 58
           MS  L+KR+     T  +T+TV++       V G  +   S ++ +L  ++E+P WQ+DN
Sbjct: 1   MSSELRKRAVSLGETAIETATVSRGSRGKLLVTGTSSGAPSGQRGRLCRYEELPAWQQDN 60

Query: 59  EHILSGYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLF--VLCFDKFAVTQFETT 116
           + I +GYV ET S+ +C  SL Y +NESVN+Y+HL+P + ++    L   ++ V +F TT
Sbjct: 61  DCIRTGYVRETLSVRRCLGSLLYWNNESVNMYSHLVPAVLYIAGATLALSQWGVPRFPTT 120

Query: 117 TLIDYVMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMY 176
           T  DY++I+ F + +  CL  SS+FHCLK HS       +++DY+GI++L+  S + ++Y
Sbjct: 121 TWSDYLIINTFLVGAGACLLCSSLFHCLKQHSERHCEAWSRMDYMGIILLIACSTIPMIY 180

Query: 177 YGFFETPALFYLFSFITCTFGAACA-VVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVT 235
           +G+F+      LF+ +T   G AC+ VV   + F +  ++  RAA F+AF  + ++P+ T
Sbjct: 181 FGYFDYMGHCLLFTAVTVALGVACSGVVLFNKQFNSSSFKLVRAAFFIAFAFNGLIPMAT 240

Query: 236 GIFYYGFSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXX 295
           G   +G   +  RI +K+V    +FYI GA+LYG R PE + PGK D+WG+SHQ+FH   
Sbjct: 241 GFVKFGIPGVLDRISLKYVWFEAVFYIAGAMLYGFRVPEIWIPGKVDLWGNSHQMFHVMV 300

Query: 296 XXXXXCHLYGLIKSYNLVHLKMA 318
                CHL  +++SY+L+H  +A
Sbjct: 301 VFGSLCHLKAVLESYSLMHRHLA 323

>TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}
          Length = 296

 Score =  161 bits (408), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 97/296 (32%), Positives = 154/296 (52%), Gaps = 30/296 (10%)

Query: 38  MSKKKRKLYTWDEIPHWQRDNEHILSGYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGI 97
           MSK   +L  ++++P WQ+DN  I++ YV ET S+F+   S+F  H+ES+NI+THL+P  
Sbjct: 1   MSKHSLQLCNFNDLPDWQKDNPLIVNYYVRETNSLFKSLCSIFLFHSESMNIFTHLIPA- 59

Query: 98  AFLFVLCFDKFAVTQFETTTLIDYVMIDLFSLVS-FTCLTLSSIFHCLKNHSRSVATFGN 156
                L + KF      T   + Y ++  F L+S   C  LSS+FH  K  S     F  
Sbjct: 60  -----LLYAKFTYNAITTLEQVSYPIV--FYLISVIICFLLSSLFHLFKCTSVQSNEFWG 112

Query: 157 KLDYLGIVVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAACAVVSL------KEGFR 210
           KLDY+GI +L+  ++VS+   GF E+       +F+T T      V+ L      K+G  
Sbjct: 113 KLDYVGISLLINATIVSMALLGFNESRYTIMKNTFVTQTSCLTAYVIILAIKSHPKQGEN 172

Query: 211 TRE---------------WRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQVKWVL 255
             +                +  RA +F + GLS ++P++TG++ YG   +Y +I +  V+
Sbjct: 173 EDDNDGTLSEDDDCCCDDHKGTRAKLFASLGLSGLIPVITGLYIYGPKVVYYKINIPMVI 232

Query: 256 LGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXXCHLYGLIKSYN 311
              + YI G ++Y  + PEK+ PG++D+ G SHQLFH        CH + +  + N
Sbjct: 233 ASVLCYIVGTLIYVFKIPEKFYPGRFDLVGSSHQLFHIFIVFGTVCHYHAIQTAKN 288

>NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {ON}
           Anc_3.90
          Length = 326

 Score =  122 bits (305), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 83/313 (26%), Positives = 156/313 (49%), Gaps = 21/313 (6%)

Query: 19  STVTKEETSGPVKGQKTDKMS------------KKKRKLYTWDEIPHWQRD--NEHILSG 64
           ++ TK++T+  +  Q  DK++            ++ + L    E+P WQ+   N  I++G
Sbjct: 5   TSTTKKQTATEI--QDADKLTPFNAPKYSVTFPRRPKVLPILKELPQWQKQYSNSKIING 62

Query: 65  YVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCF--DKFAVTQFETTTLIDYV 122
           YV ET S+ +C  ++ Y +N++VNI  + +    +  +L F  D + +     TT+ DY+
Sbjct: 63  YVRETNSLIKCLHTVTYWNNQTVNIILNTVFSTVYFTLLLFFTDLYLIPSSPATTMSDYI 122

Query: 123 MIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFET 182
           M++ +   +F    L+SIF+ L++HS +      KL +L  +  + TS+++ +YY FF+ 
Sbjct: 123 MVNFYLFGAFQYFALNSIFYLLESHSLAKCHLWFKLSHLAFINYISTSIITQLYYTFFDN 182

Query: 183 PALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLS-AVLPIVTGIFYYG 241
              F   +  T    +  A+ +L E F  R+ R  R  + + F +S  +LP  + +F + 
Sbjct: 183 VFYFKFLTISTLLISSIFAIFTLSEQF-LRKNRSQRNMVSITFIVSLLILPTASLMFKFN 241

Query: 242 FSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXXC 301
              I  R++ K +LL    Y+    L  V+ PE+++   +D  G+S  ++H         
Sbjct: 242 TFRILRRVEGKAILLELSLYLFSMTLKAVQVPERFSEN-FDFIGNSENIYHICIILGSLL 300

Query: 302 HLYGLIKSYNLVH 314
           H   L+ SY  +H
Sbjct: 301 HFKMLLNSYFFMH 313

>NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90
          Length = 318

 Score =  114 bits (286), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 77/307 (25%), Positives = 152/307 (49%), Gaps = 14/307 (4%)

Query: 19  STVTKEETSGPVKGQKTDK----MSK-KKRKLYTWDEIPHWQR--DNEHILSGYVGETRS 71
           S++T  +   P     T K    +SK   R  Y   E+P WQR  ++  +++G++ ET S
Sbjct: 2   SSITTTKGGCPNDNYPTSKRYTVISKLSTRNHYKLKELPEWQREFNSGKVITGFLKETNS 61

Query: 72  MFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCF--DKFAVTQFETTTLIDYVMIDLFSL 129
             +C  S  Y HN S+NI  + +    +  +L F  D + +  F +TT+ DY++++L+ L
Sbjct: 62  FKKCLWSTMYWHNSSINISLNGIAATVYFMLLFFFTDCYLIPSFPSTTMSDYIVLNLYLL 121

Query: 130 VSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLF 189
            +     + +IF+ +K+HS+  A    KL+ +G++  + +S+V+++YY +F+    F  F
Sbjct: 122 TATQNFMVGTIFYIMKSHSKQQAFLWYKLNNIGLINHIASSVVTLLYYHYFDYVFYFKFF 181

Query: 190 SFITCTFGA--ACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYL 247
           + +T        C+++S      TR  + +    ++   L  ++P +  I  +G +++  
Sbjct: 182 TIVTLLLITLFTCSIISDSFNKMTRIRKNFLLLAYII--LLTLMPSLFAILRFGLAKVLE 239

Query: 248 RIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHXXXXXXXXCHLYGLI 307
           RI +  ++L    Y  G  +   + PE++    +D  G+S  ++          H   L+
Sbjct: 240 RISLNLIILEIFIYAFGLTIRTSQLPERFF-NSFDFLGNSENVYQLSIIVCSFIHFKILM 298

Query: 308 KSYNLVH 314
            SY L+H
Sbjct: 299 NSYCLMH 305

>CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {ON}
           similar to uniprot|Q03419 Saccharomyces cerevisiae
           YDR492w
          Length = 301

 Score = 97.4 bits (241), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 82/293 (27%), Positives = 140/293 (47%), Gaps = 20/293 (6%)

Query: 38  MSKK--KRKLYTWDEIPHWQRD--NEHILSGYVGETRSMF-QCFLSLFYLHNESVNIYTH 92
           M KK  + K+ T +++P W R   N  I +GY   T + +  C   L   +N+S++IY +
Sbjct: 1   MEKKTVQSKIVTLEKLPVWYRRYGNSRIKTGYFYYTNATYLGCLQKLVKFNNDSISIYMN 60

Query: 93  LLPGIAFLFVLCF--DKFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSIFHCLKNHSRS 150
           L+ G+    +L F  D   +    +TT+ DY++I+LF + + T     ++   LK HS  
Sbjct: 61  LVCGLISGVMLLFYTDVRLIPSHPSTTMTDYIIINLFLMATTTYFATMTLGQLLKGHSEY 120

Query: 151 VATFGNKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAACAVVSLKEGFR 210
                N+   L +V+L+  S+V+++YY FF+   LF LF   TC   +  ++V + + ++
Sbjct: 121 QGKLWNQAKQLALVLLLTCSIVTLLYYAFFDHVFLFKLFVIWTCLLMSITSIVIINDQYK 180

Query: 211 TREWRPYRAAMFVAFG-LSAVLPIVTGIFYYGFSEIYLRIQVKWVLLGG--IFYITGAVL 267
               R  + +  V FG LS  LPI   I  +G  + Y + ++ + +L    + Y   A+L
Sbjct: 181 ----RVQKLSCVVIFGVLSISLPIAVSIIKFGLFDSYKKQRIPFQVLTWEIVLYSLSAML 236

Query: 268 YGVRFPEKYAPGKYD-IW-----GHSHQLFHXXXXXXXXCHLYGLIKSYNLVH 314
              R PE       D  W     G+S Q+           H   +I +Y +VH
Sbjct: 237 QLTRLPELTLSTLGDSFWIVDYLGNSDQVSQLVTIFAIIVHFNTIIFAYEVVH 289

>Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 82.4 bits (202), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 78/326 (23%), Positives = 142/326 (43%), Gaps = 34/326 (10%)

Query: 11  CSLTTDQTS------TVTKEETSGPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEHILSG 64
            SLTT + S      T  K   +G       D  +K+ +K + + ++  WQ+   +  S 
Sbjct: 2   ASLTTVEQSPAKCKTTTEKGNGTGETTNSNVDAETKEIKKGFPFHDLAKWQQQYRNKSS- 60

Query: 65  YVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCF--DKFAVTQFETTT-LIDY 121
                              NES+    +LL  ++   +L F  D + +  F TTT + DY
Sbjct: 61  ------------------RNESLVALIYLLGSMSSFCLLIFFTDFYLIPLFPTTTTMTDY 102

Query: 122 VMIDLFSLVSFTCLTLSSIFHCLKNHS-RSVATFGNKLDYLGIVVLVVTSMVSIMYYGFF 180
           ++ + + L  F    +  ++H +KN S +       K  YL  + L+++S ++I+YY F+
Sbjct: 103 IVFNFYLLNVFVFCMVHFVYHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFY 162

Query: 181 ETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAV-LPIVTGIFY 239
           +    F +F+ +    G       L +   + + R  +   F++  +    LP++T I  
Sbjct: 163 DYVFFFKIFTLLMNFIGLVAYFFILTDKLNSSK-RFNKTVFFISVSVVCCSLPLLTAIIT 221

Query: 240 Y-GFSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKY--APGKYDIWGHSHQLFHXXXX 296
           + G   +  RI+VK +    +  +  +++Y  RFPE       K + W HS  LFH    
Sbjct: 222 FDGLENLKERIKVKAITCELVALVAASIIYVTRFPESLFRRNKKEESWNHSEYLFHLVIS 281

Query: 297 XXXXCHLYGLIKSYNLVHLKMAIAQL 322
                H + LI+SY L+H  +   +L
Sbjct: 282 GTAFYHFFILIQSYILMHSSLNQPEL 307

>Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 80.5 bits (197), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 78/325 (24%), Positives = 145/325 (44%), Gaps = 34/325 (10%)

Query: 6   KKRSQCSLTTDQTSTVTKEETSGPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEHILSGY 65
           +  ++C+ T ++ +  T E  S    G KT    K+ +K + + ++  WQ   ++  S  
Sbjct: 9   QSPAKCNTTPEKCNNSTAEINS--TVGAKT----KETKKGFPFHDLAKWQEQYKNKSS-- 60

Query: 66  VGETRSMFQCFLSLFYLHNESVNIYTHLLPG-IAFLFVLCFDKFAVTQF--ETTTLIDYV 122
                             NESV    +LL   ++F  ++ F  F +      TTT+ DY+
Sbjct: 61  -----------------RNESVVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYI 103

Query: 123 MIDLFSLVSFTCLTLSSIFHCLKNHS-RSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFE 181
           + + + L  F    +  I+H +KN S +       K  YL  + L+++S ++I+YY F++
Sbjct: 104 VFNFYLLNVFVFCMVHFIYHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYD 163

Query: 182 TPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFG-LSAVLPIVTGIFYY 240
               F +F+ +    G       L +   + + R  +   F++   +   LP++T I  +
Sbjct: 164 YVFFFKIFTLLMNFIGLVAYFFILTDKLISSK-RFNKTVFFISVSVICCSLPLLTAIITF 222

Query: 241 -GFSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKY--DIWGHSHQLFHXXXXX 297
            G   +  RI+V  +    +  +  +++Y  RFPE +  GK   + W HS  LFH     
Sbjct: 223 DGLENLKERIKVNAITWELVALVAASIIYVTRFPELFLRGKKKEEGWNHSEYLFHLIISG 282

Query: 298 XXXCHLYGLIKSYNLVHLKMAIAQL 322
               H + LI+SY L+H  +   +L
Sbjct: 283 AAFYHFFILIQSYILMHSSLNQPEL 307

>Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 78.2 bits (191), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 74/314 (23%), Positives = 142/314 (45%), Gaps = 29/314 (9%)

Query: 17  QTSTVTKEETSGPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEHILSGYVGETRSMFQCF 76
           +T+T    + +G V     D  +K+ +K + + ++  WQ+  ++        +RS     
Sbjct: 15  KTATEKYSDATGAVTSN-ADVETKETKKGFPFHDLAKWQKQYKN------KSSRS----- 62

Query: 77  LSLFYLHNESVNIYTHLLPGIAFLFVLCF--DKFAVTQFETTT-LIDYVMIDLFSLVSFT 133
                   ES+    +LL  ++   +L F  D + +  F TTT + DY++ + + L  F 
Sbjct: 63  --------ESLVALIYLLGSMSSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFV 114

Query: 134 CLTLSSIFHCLKNHS-RSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLFSFI 192
              +  I+H +KN S +       K  YL  + L+++S ++I+YY F++    F +F+ +
Sbjct: 115 FCMIHFIYHFIKNISLQQHIEIWQKFSYLANINLLISSQITILYYLFYDYVFFFKIFTLL 174

Query: 193 TCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAV-LPIVTGIFYY-GFSEIYLRIQ 250
               G A   V L +   + + R  +   F++  +    LP++T I  + G   +  RI+
Sbjct: 175 MTFIGLAAYFVILTDKLNSYK-RFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKDRIK 233

Query: 251 VKWVLLGGIFYITGAVLYGVRFPEKYA--PGKYDIWGHSHQLFHXXXXXXXXCHLYGLIK 308
           +  +    +  +  +++Y  RFPE       K + W HS   FH         H + LI+
Sbjct: 234 LNAITWELVTLVVASMIYVTRFPESLCRRNEKEEGWNHSEYFFHLLISGTAFYHFFILIQ 293

Query: 309 SYNLVHLKMAIAQL 322
           SY L+H  +   +L
Sbjct: 294 SYILMHSSLNQPEL 307

>YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}
           IZH4Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by fatty acids and altered zinc levels; deletion
           reduces sensitivity to excess zinc; possible role in
           sterol metabolism
          Length = 312

 Score = 74.7 bits (182), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 77/325 (23%), Positives = 145/325 (44%), Gaps = 34/325 (10%)

Query: 12  SLTTDQTSTV----TKEETSGPVKGQKTDKMSKKK--RKLYTWDEIPHWQRDNEHILSGY 65
           SLTT + S V    T E+ S   +G  +++ ++ K  +K + + ++   Q+  ++  S  
Sbjct: 3   SLTTIEQSPVKCETTTEKESNDTRGTDSNENAETKETKKGFPFHDLAKLQKQYKNKSS-- 60

Query: 66  VGETRSMFQCFLSLFYLHNESVNIYTHLLPG-IAFLFVLCFDKFAVTQF--ETTTLIDYV 122
                             NES+    +LL   ++F  ++ F  F +      TTT+ DY+
Sbjct: 61  -----------------RNESLVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYI 103

Query: 123 MIDLFSLVSFTCLTLSSIFHCLKNHS-RSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFE 181
           + + + L  F    +  I+H +KN S +       K  YL  + L+++S ++I+YY F++
Sbjct: 104 VFNFYLLNVFVFCMVHFIYHFVKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYD 163

Query: 182 TPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAV-LPIVTGIFYY 240
               F +F+ +    G       L +   + + R  +   F++  +    LP++T I  +
Sbjct: 164 YVFFFKIFTLLMNFIGLVAYFFILTDKLISSK-RFNKTVFFISVSVVCCSLPLLTAIITF 222

Query: 241 -GFSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKY--APGKYDIWGHSHQLFHXXXXX 297
            G   +  RI+V  +    +  +  +++Y  RFPE       K + W HS  LFH     
Sbjct: 223 DGLENLKERIKVNAITWELVALVAASIIYVTRFPESLFRRNKKEEGWNHSEYLFHLLISG 282

Query: 298 XXXCHLYGLIKSYNLVHLKMAIAQL 322
               H + LI+SY L+H  +   +L
Sbjct: 283 TAFYHFFILIQSYILMHSSLNQPEL 307

>KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5.197
           YLR023C
          Length = 509

 Score = 74.7 bits (182), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 105/234 (44%), Gaps = 12/234 (5%)

Query: 50  EIPHWQRDNEHILSGYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFD--K 107
           ++P   R+N +I++ Y     S  +  LS+F LHNE+ NI++HLL  I FL+VL  D   
Sbjct: 197 QLPFPYRENRYIINNYRFYD-SHKKSLLSIFKLHNEATNIWSHLLGAIYFLYVLFHDLPN 255

Query: 108 FAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNK---LDYLGIV 164
             +           + + LF   S  C+  S+ +H    +  S+     K   +DY GI 
Sbjct: 256 SIIVSSSMVPTTAKLFLYLFVFASLKCMLSSTFYHTF--NGTSMLKLRRKFMCVDYSGIS 313

Query: 165 VLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVA 224
           +L+ +S++SI +   ++ P +   +   +   G     ++    F + E RP R   F+ 
Sbjct: 314 ILITSSILSIQFISLYDYPNILKFYMCASFMLGVLGIFMNWSPLFDSPEARPLRIKFFIL 373

Query: 225 FGLSAVLPIVTGIFYYGFSEIYLRIQVKWVLLGG--IFYITGAVLYGVRFPEKY 276
                   ++  +F      I+  I V   L     ++Y+ G V YG   PE++
Sbjct: 374 LSSCGAFALLHLVFLE--KSIFAAIDVLLPLTNKSIVWYLVGVVFYGSFIPERF 425

>TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {ON}
           Anc_5.197 YLR023C
          Length = 569

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 109/247 (44%), Gaps = 18/247 (7%)

Query: 41  KKRKLYTWDEIPHWQRDNEHILSGYVGETRSMFQCFLSLFY---LHNESVNIYTHLLPGI 97
           K+R L+ + E+P   R+N++I+ GY    +  +Q  LS+F    +HNE+ NI+TH+L   
Sbjct: 240 KERHLHYY-ELPFPWRENKYIIHGYRFHDK-FYQLILSVFNWYGVHNETTNIWTHMLAAF 297

Query: 98  AFLFVLCFD---KFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATF 154
             +++L  D    F V   E        +I +F      C+  S  +H   N + S+   
Sbjct: 298 YLIYLLTVDFQKTFIVLDTEHVPATTKYIIYMFLGAGIKCMFASVFWHTF-NGTTSIRLR 356

Query: 155 GN--KLDYLGIVVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAACAVVSLKEGFRTR 212
                +DY GI +L+  S++S  Y   ++ P     +  ++  F      ++    F + 
Sbjct: 357 PKFCCVDYTGITLLISASIMSAEYITLYDYPKAMSFYMILSGIFAVFGLYLNWSPKFDSP 416

Query: 213 EWRPYRAAMFVAFGLSAVLPIVTGIFYYGFSE---IYLRIQVKWVLLGGIFYITGAVLYG 269
           E RP R   FV       L  V  +   G S    ++  +  K V    I+YI G   YG
Sbjct: 417 EARPLRIKFFVLLAAVGGLSFVNLVCLEGLSRAIWLFSPVTNKSV----IYYIIGVFFYG 472

Query: 270 VRFPEKY 276
              PE++
Sbjct: 473 SFIPERF 479

>AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR023C
          Length = 419

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 116/257 (45%), Gaps = 43/257 (16%)

Query: 43  RKLYTWDEIPHWQRDNEHILSG---YVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAF 99
           R L+ W E+P+  R+N +I+ G   Y    +S+    L+ +  HNE++NI++HL+     
Sbjct: 103 RHLHYW-ELPYAWRENRYIIYGHRFYHSHRKSLLS-VLNAYGWHNETINIWSHLVGAAVL 160

Query: 100 LFVLC--FDKFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSIFHC------LKNHSRSV 151
            ++LC  + +  V +      +    I  F      C+  S  +H       LK  SR V
Sbjct: 161 AYLLCWGWPRSDVYRAAQVPRLAKWAIGAFLACGVKCMASSVAWHTFNGTCHLKLRSRFV 220

Query: 152 ATFGNKLDYLGIVVLVVTSM---VSIMYYGFFETPALFYLFSFITCTFGAACAVVSLKEG 208
                 +DY GI +LV  S+   V++  YG   +  L Y +   +   G A  V++    
Sbjct: 221 C-----VDYTGITLLVTASVVTTVAVTLYGL--SRPLMYAYMVASIGLGTAAGVMNWSPH 273

Query: 209 FRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQVKW---------VLLGGI 259
           F   E RP R A++V  GL+A+     G+  +    +++ +QV+W         V    +
Sbjct: 274 FDRPEARPLRIAVYV--GLAAL-----GLVSF----VHVWMQVRWASAHLMAPLVYKSLV 322

Query: 260 FYITGAVLYGVRFPEKY 276
           +Y  G V Y    PE++
Sbjct: 323 WYGIGVVFYATLVPERW 339

>TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON}
           Anc_5.197 YLR023C
          Length = 437

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 100/238 (42%), Gaps = 18/238 (7%)

Query: 50  EIPHWQRDNEHILSGYVGETRSMFQCFLSL---FYLHNESVNIYTHLLPGIAFLFVLCF- 105
           ++P   R+N +I+ GY     S  +C LS+   +  HNE++NI++HL   +  L++  F 
Sbjct: 118 QLPFPWRENRYIIKGYRFY-DSNVKCLLSVVNYYGWHNETLNIWSHLGGFLTLLYIAVFV 176

Query: 106 -DKFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSIFHCLKNH-SRSVATFGNKLDYLGI 163
                V Q E       +++ +F +    C+  S  +H      S ++      +DY GI
Sbjct: 177 YPNTEVYQSELIPTTAKMLLFVFLIAGMKCMLASVFWHTFDGTCSYTLRPKFCCVDYTGI 236

Query: 164 VVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFV 223
            +L+  S+++  Y      P   +++  ++   G     ++    F   E RP R   FV
Sbjct: 237 TILITASILTAEYVSLSHAPIWMFIYMSLSLALGTFGVYINWSPKFDGPEARPLRIKFFV 296

Query: 224 AFGLSAVLPIVTGIFYYGFSEIYLRIQVKWVLL-----GGIFYITGAVLYGVRFPEKY 276
                  L  V  IF        LR    W+L        I+Y+ G   YG   PEKY
Sbjct: 297 TLSAMGCLSFVHLIF-----TTSLR-HACWLLAPIISKSTIWYVIGVFFYGSFIPEKY 348

>Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON}
           (229517..231250) [1734 nt, 578 aa]
          Length = 577

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 57/239 (23%), Positives = 112/239 (46%), Gaps = 20/239 (8%)

Query: 50  EIPHWQRDNEHILSGY--VGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFD- 106
           ++P   R+N +I++GY    +   +     + +  HNE+ NI++HLL  I F +++ F+ 
Sbjct: 255 QLPFPWRENRYIINGYRFYHKNSKLLLSVFNWYGFHNETANIWSHLLGAIYFAYIVLFEF 314

Query: 107 --KFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNK--LDYLG 162
              F V   E      Y++  LF L    C+ L+S+F    N + S+        +DY G
Sbjct: 315 PKSFIVQSPEVPPSAKYIVY-LFLLAGIKCM-LASVFWHTFNGTCSIKLRPKYCCVDYSG 372

Query: 163 IVVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMF 222
           I +L+  S+++  +   ++  ++  ++  ++  FG     ++    F + E RP R   F
Sbjct: 373 ITILITASILTAEFVSLYDHRSIMTVYMSLSLLFGCFGLYLNWSPKFDSPEARPLRIKFF 432

Query: 223 V---AFGLSAVLPI--VTGIFYYGFSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKY 276
           +   A G  A   +  + G+ Y  +  +Y  +  K +    ++Y+ G   YG   PE++
Sbjct: 433 ILLAALGGLAFFHVAYLEGMAYAAW--LYSPVTSKSI----VWYLIGVFFYGSFIPERF 485

>Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023C -
           Hypothetical ORF [contig 94] FULL
          Length = 566

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 70/245 (28%), Positives = 106/245 (43%), Gaps = 27/245 (11%)

Query: 50  EIPHWQRDNEHILSGYV---GETRSMFQCFLSLFYLHNESVNIYTHLLPG--IAFLFVLC 104
           E+P   R+N  I+ GY       +S+   F + +  HNE+VNI+THL     +A+L    
Sbjct: 239 ELPFPWRENRFIIHGYRFYNSYKKSLLSIF-NWYGWHNETVNIWTHLGGALYLAYLLFRG 297

Query: 105 FDKFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSIFHCLKN----HSRSVATFGNKLDY 160
           F + AV Q E        M  +F L    C   S ++H          RS       +DY
Sbjct: 298 FSQTAVYQSELVPTAAKCMAFVFLLSGLECFLFSVVWHTFNGICHLQQRSNCAC---VDY 354

Query: 161 LGIVVLVVTSMVS---IMYYGFFETPALFYLFSFITCT--FGAACAVVSLKEGFRTREWR 215
            GI +LV  S+++   +   G  E P  + L  F T +   G     ++    F   E R
Sbjct: 355 TGITILVTASILTTEFVTLSGAAEAPFTWSLLFFTTTSSILGVIGVYMNWSPKFDRPESR 414

Query: 216 PYRAA---MFVAFGLSAVLPIVTGIFYYGFSEIYLRIQVKWVLLGGI-FYITGAVLYGVR 271
           P R A   +  +FG  + L   + IF+   S   L   +K VL   + +Y+ G V YG  
Sbjct: 415 PLRIAFYLLLASFGFFSYLH--SRIFHTSISSSEL---IKPVLSKSLAWYLIGVVFYGTF 469

Query: 272 FPEKY 276
            PE++
Sbjct: 470 IPERW 474

>Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}
           similar to Ashbya gossypii AAL153C
          Length = 568

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 55/236 (23%), Positives = 105/236 (44%), Gaps = 13/236 (5%)

Query: 50  EIPHWQRDNEHILSG---YVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFD 106
           E+P   R+N +I+ G   Y    +S+    L+++  HNE++NI++H+   I  L+++   
Sbjct: 244 ELPQPWRENPYIIYGHRFYHSHKKSLLS-ILNVYGWHNETINIWSHIAGAIILLYIM-LR 301

Query: 107 KFAVTQFETTTLIDYV---MIDLFSLVSFTCLTLSSIFHCLKN--HSRSVATFGNKLDYL 161
            F  +    +T +  V    I +F L    C+  S ++H      H    + F + +DY 
Sbjct: 302 GFPNSDVFNSTQVPKVAKGAIYVFLLCGIKCMVSSVMWHTFSGTCHLPLRSRF-SCVDYT 360

Query: 162 GIVVLVVTSMVSIMYYGFFE-TPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAA 220
           GI +L+  S+++   +  +   P   YL+  I+   G   A  +    F   + R +R A
Sbjct: 361 GITILITASVMTTEAFTLYRLAPKAMYLYMGISLCLGVFAAFTNWSRRFDGPDSRIFRVA 420

Query: 221 MFVAFGLSAVLPIVTGIFYYGFSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKY 276
            +V      ++  V    +  +S   L I    +    ++Y+ G V Y    PE++
Sbjct: 421 FYVILAGLGLISFVHLTVHSDWSSSRLMI-TPLINKSIVWYLIGVVFYATLVPERW 475

>KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some
           similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 622

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 69/275 (25%), Positives = 118/275 (42%), Gaps = 53/275 (19%)

Query: 40  KKKRKLYTWD--------------EIPHWQRDNEHILSGYV---GETRSMFQCFLSLFYL 82
           KK  + Y WD              E+P   R+N +I+ GY       +S+    ++ +  
Sbjct: 279 KKTIQFYNWDNACDLGRQRHLHFYELPFPWRENRYIIHGYRFYDSHVKSVLSV-VNWYGW 337

Query: 83  HNESVNIYTHLLPGIAFLFVLCFDKFAVTQF---ETTTLIDYVMIDLFSLVSFTCLTLSS 139
           HNE++NI++HL  G  +L  L F +   T+    +   L   ++I +F +    CL  SS
Sbjct: 338 HNETLNIWSHLF-GAVYLAYLLFIQLPTTKVFMSQDVPLFGKLIIQVFLIAGVKCLLSSS 396

Query: 140 IFH------CLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFE--TPAL---FYL 188
           ++H      CL    +        +DY GI VL+  S++S  +   +   T +L     +
Sbjct: 397 VWHTLNGTCCLPLRCKFAC-----IDYTGITVLITASILSTEFVSVYNLATQSLSTSMTV 451

Query: 189 FSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAF-GLSAV----LPIVTGIFYYG-- 241
           +  ++   G   + ++    F   E RP+R A +V   GL  +    L I  GI +    
Sbjct: 452 YMSLSLCLGIFGSFMNWSPRFDRPESRPFRIAFYVLLAGLGMISFLHLTISRGIDHSSQF 511

Query: 242 FSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKY 276
           F  ++ R          I+Y+ G V YG   PE++
Sbjct: 512 FKPVWNR--------SLIWYLIGVVFYGSFIPERW 538

>KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.197
           YLR023C
          Length = 538

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 56/248 (22%), Positives = 107/248 (43%), Gaps = 22/248 (8%)

Query: 42  KRKLYTWDEIPHWQRDNEHILSGYV---GETRSMFQCFLSLFYLHNESVNIYTHLLP--G 96
           + KL  + E+P   R+N +I+  Y       +S+    ++ +  HNE+ NI++H L    
Sbjct: 213 REKLLHYYELPFPWRENRYIIHNYRFYDSNVKSLLSA-INWYGWHNETSNIWSHFLGFFY 271

Query: 97  IAFLFVLCFDKFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSIFHCLKNHS-----RSV 151
           + +L V  F +  V Q +        ++ +F   +  CL  S+ +H     +     R  
Sbjct: 272 VVYLAVYEFPQSVVFQSDRIPSSAKFVVYIFLFAAMKCLIASAFWHTFNGTAFLKMRRRF 331

Query: 152 ATFGNKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAACAVVSLKEGFRT 211
           A     +DY GI +L+  S+++  +    +   +  L+  I+ T G     ++    F T
Sbjct: 332 AC----VDYSGISILITASILTAEFVTLNDHRPMMILYMTISLTLGIIGVFLNCSPQFDT 387

Query: 212 REWRPYRAAMFVAFGLSAVLPIVTGIFYYGFS---EIYLRIQVKWVLLGGIFYITGAVLY 268
            E RP R   F+      VL  +   +   ++   ++   I  K +    ++Y+ G V Y
Sbjct: 388 PEARPLRIRFFMLLAAMGVLSFINASYLESWAYAVDLLSPITNKSI----VWYLVGVVFY 443

Query: 269 GVRFPEKY 276
           G   PE++
Sbjct: 444 GSFIPERF 451

>KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 546

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 100/249 (40%), Gaps = 35/249 (14%)

Query: 50  EIPHWQRDNEHILSGYV---GETRSMFQCFLSLFYLHNESVNIYTHLLPGI--AFLFVLC 104
           E+P   R+N  I+ GY      ++S+   F + +  HNE+VNI+THL   +  AFL    
Sbjct: 219 ELPFPWRENRFIIHGYRFYNSYSKSLLSIF-NWYGWHNETVNIWTHLCGALYFAFLIFKG 277

Query: 105 FDKFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSIFHC------LKNHSRSVATFGNKL 158
           F +  V Q E        M  +F      C   S ++H       LK  S         +
Sbjct: 278 FSQTTVYQSELVPTAAKFMAFVFLTAGLECFLFSVVWHTFNGICHLKQRSNCAC-----V 332

Query: 159 DYLGIVVLVVTSMVSIMYYGFFETPALFYLFSFI-----TCTFGAACAVVSLKEGFRTRE 213
           DY GI VLV  S+++  +     +    + +S +     +   GA    ++    F   E
Sbjct: 333 DYTGITVLVTASILTTEFVTLSGSSDATFTWSLLFFTGASAALGAVGVFMNWSPKFDRPE 392

Query: 214 WRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQVKWVLLGGIF------YITGAVL 267
            RP R A +       +L    G F Y  S ++        L+  +F      YI G V 
Sbjct: 393 SRPLRIAFY-------LLLASFGFFSYLHSRLFNTAVDSSDLIKPVFMKSLAWYIIGVVF 445

Query: 268 YGVRFPEKY 276
           YG   PE++
Sbjct: 446 YGTFIPERW 454

>NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197
          Length = 578

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 54/239 (22%), Positives = 100/239 (41%), Gaps = 20/239 (8%)

Query: 50  EIPHWQRDNEHILSGYV---GETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFD 106
           ++P   R+N +I+  Y       +S+   F + +  HNES NI+THLL  I  +++  +D
Sbjct: 254 QLPFPWRENRYIIYNYRFYDSHKKSLLSIF-NWYGWHNESSNIWTHLLGAIYLIYLSIYD 312

Query: 107 --KFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSIFHCLKNHS--RSVATFGNKLDYLG 162
                + Q E       +++ LF   +  CL  S  +H     S  +  + F   +DY G
Sbjct: 313 FPNSEIFQSEKVPTTAKLIVYLFLFAAIKCLLASVFWHTFNGTSFLKLRSKFA-CVDYSG 371

Query: 163 IVVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMF 222
           I +L+  S+++  +   + +     ++  I+ + G     ++    F   E RP R   F
Sbjct: 372 ITILITASILTTEFVTMYSSFFAMCIYMTISLSLGMFGVFMNWSPKFDRPEARPLRIKFF 431

Query: 223 VAFGLSAVLPIVTGIFYYGFSEIYLRIQVKWVLL-----GGIFYITGAVLYGVRFPEKY 276
           +      VL  +   +              W+L        ++Y+ G V YG   PE++
Sbjct: 432 ILLASMGVLSFLHLTYLTNLQ------YATWLLTPVTNKSIVWYLVGVVFYGSFIPERF 484

>SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]
           {ON} some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 563

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 72/251 (28%), Positives = 109/251 (43%), Gaps = 36/251 (14%)

Query: 50  EIPHWQRDNEHILSGYV---GETRSMFQCFLSLFYLHNESVNIYTHLLPG--IAFLFVLC 104
           E+P   R+N  I+ GY      T+S+    L+ +  HNE+ NI+THL     IA+L    
Sbjct: 236 ELPFPWRENRFIIHGYRFYHSHTKSLLS-ILNWYGWHNETTNIWTHLFGSLYIAYLAFYE 294

Query: 105 FDKFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSIFHCL----KNHSRSVATFGNKLDY 160
           F + +V            M+ LF    F CL  S  +H      K H RS       +DY
Sbjct: 295 FPQSSVYLSGDVPQFAKYMVYLFLGAGFKCLVSSVTWHTFNGTCKLHLRSKFAC---MDY 351

Query: 161 LGIVVLVVTSMVS---IMYYGFFETPA-------LFYL-FSFITCTFGAACAVVSLKEGF 209
            GI VL+  S+++   +  YG  + P        +FY+  S + C FG     ++    F
Sbjct: 352 TGITVLITASIMTAEFVSLYGNGDNPNSPVTFSLIFYMAVSSVLCCFG---VFMNWSPRF 408

Query: 210 RTREWRPYRAAMFV---AFGLSAVLPIVTGIFYYGFSEIYLRIQVKWVLLGGI-FYITGA 265
              E RP R A ++     G  A L + T I  +  S   +R     VL   + +Y+ G 
Sbjct: 409 DRPESRPLRIAFYLLLAGMGFLAFLHL-TLITNFAHSSWLIRP----VLDKSVCWYLIGV 463

Query: 266 VLYGVRFPEKY 276
           + YG   PE++
Sbjct: 464 IFYGSFIPERW 474

>YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON}
           IZH3Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by zinc deficiency; deletion reduces sensitivity
           to elevated zinc and shortens lag phase, overexpression
           reduces Zap1p activity
          Length = 543

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 53/238 (22%), Positives = 105/238 (44%), Gaps = 18/238 (7%)

Query: 50  EIPHWQRDNEHILSGYV---GETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFD 106
           ++P   R+N +I+ GY      ++S+   F + +  HNE+ NI++HLL  I  +++  +D
Sbjct: 220 QLPFPWRENRYIIHGYRFYNTHSKSLLSIF-NWYGWHNETSNIWSHLLGAIYIIYLAIYD 278

Query: 107 KFAVTQFETTTLID---YVMIDLFSLVSFTCLTLSSIFHCLKNHS--RSVATFGNKLDYL 161
            F  ++    + +      ++ +F   +  C+  S  +H     S  +  + F   +DY 
Sbjct: 279 -FPQSEVWRNSQVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFAC-VDYS 336

Query: 162 GIVVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAM 221
           GI +L+  S+++  +   +      Y +  I+   G     ++    F   E RP R   
Sbjct: 337 GITILITASILTTEFVTMYSCYWAMYTYMSISLALGVFGVFMNWSPRFDRPEARPLRIRF 396

Query: 222 FVAFGLSAVLPIVTGIFYYGF---SEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKY 276
           F+      VL  +  IF       + ++  +  K V    ++Y+ G V YG   PE++
Sbjct: 397 FILLATMGVLSFLHLIFLTDLHYAATLFSPVTYKSV----VWYLVGVVFYGSFIPERF 450

>Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 55.1 bits (131), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 103/238 (43%), Gaps = 18/238 (7%)

Query: 50  EIPHWQRDNEHILSGYV---GETRSMFQCFLSLFYLHNESVNIYTHLLPG--IAFLFVLC 104
           ++P   R+N +I+ GY      ++S+    ++ +  HNE+ NI++HLL    I +L +  
Sbjct: 219 QLPFPWRENRYIIHGYRFYNTHSKSLLS-IINWYGWHNETSNIWSHLLGAMYIIYLAIYD 277

Query: 105 FDKFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSIFHCLKNHS--RSVATFGNKLDYLG 162
           F +  V +          ++ +F   +  C+  S  +H     S  R  + F   +DY G
Sbjct: 278 FPQSEVWRNPNVPQQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLRLRSKFAC-VDYSG 336

Query: 163 IVVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMF 222
           I +L+  S+++  +   +        +  I+   G     ++    F   E RP R   F
Sbjct: 337 ITILITASILTTEFVTMYSCYWAMCTYMGISLALGVIGVFMNWSPRFDRPEARPLRIRFF 396

Query: 223 VAFGLSAVLPIVTGIF----YYGFSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKY 276
           +      VL  +  IF    YY  S ++  +  K V    ++Y+ G V YG   PE++
Sbjct: 397 ILLATMGVLSFLHLIFLTDIYYA-SRLFGPVTYKSV----VWYLVGVVFYGSFIPERF 449

>TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {ON}
           Anc_5.197 YLR023C
          Length = 450

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/242 (23%), Positives = 105/242 (43%), Gaps = 26/242 (10%)

Query: 50  EIPHWQRDNEHILSGYVGETRSMFQCFLSL---FYLHNESVNIYTHLLPGIAFLFVLCFD 106
           ++P   R+N  I+ GY     S ++  LS+   +  HNE+ NI+THL   +  L++  +D
Sbjct: 136 QLPFPWRENRFIIHGYRFYD-SHYKSLLSIVNWYGWHNETANIWTHLGGALYVLWLAVYD 194

Query: 107 --KFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSIFH------CLKNHSRSVATFGNKL 158
             + +V + E   ++   ++ +F   +  C+  S   H      CL   S+        +
Sbjct: 195 FPRTSVWESEQVPMVAKCIVYVFLAAALKCMLASVFGHTFNGTCCLALRSKFAC-----V 249

Query: 159 DYLGIVVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYR 218
           DY GI +L+  S+++  +   +  P     +  ++   G    +++    F   E RP R
Sbjct: 250 DYSGITMLITASILTTEFVTMYNYPWSLRFYLAVSTVLGIFGVIMNWSPKFDRPEARPLR 309

Query: 219 AAMFVAF----GLSAVLPIVTGIFYYGFSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPE 274
              F+      GLS +   + G + Y     +L   V    L  ++Y+ G   YG   PE
Sbjct: 310 IKFFILLAAMGGLSFMQLGLLGGWKYA---SWLMAPVTHKSL--VWYLLGVAFYGSFVPE 364

Query: 275 KY 276
           ++
Sbjct: 365 RF 366

>NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.197
           YLR023C
          Length = 543

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 56/246 (22%), Positives = 102/246 (41%), Gaps = 34/246 (13%)

Query: 50  EIPHWQRDNEHILSGYV---GETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFD 106
           ++P   R+N +I+  Y       +S+   F + +  HNE+ NI+THL+ G+  +++  +D
Sbjct: 220 QLPFPWRENRYIIYNYRFYDSHKKSLLSIF-NWYGWHNETSNIWTHLIGGLYLIYMAVYD 278

Query: 107 -----KFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSIFHC------LKNHSRSVATFG 155
                 F   +  TT  +   ++ LF   +  CL  S  +H       LK  S+      
Sbjct: 279 FPRSEIFLSDKIPTTAKL---IVYLFLFAAIKCLFASVFWHSFNGTCTLKLRSKFAC--- 332

Query: 156 NKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAACAVVSLKEGFRTREWR 215
             +DY GI +L+  S+++  +   + +     ++  I+ + G     ++    F   E R
Sbjct: 333 --VDYSGISILITASILTTEFVTLYSSYRAMCVYMAISLSLGIFGVFMNWSPKFDRPEAR 390

Query: 216 PYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQVKWVLL-----GGIFYITGAVLYGV 270
           P R   FV      VL  +   F   +          W+L        ++Y  G V YG 
Sbjct: 391 PLRIKFFVLLASMGVLSFLHLTFLTDWK------YATWLLAPVTNKSIVWYCIGVVFYGS 444

Query: 271 RFPEKY 276
             PE++
Sbjct: 445 FIPERF 450

>Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {ON}
           YLR023C (REAL)
          Length = 541

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 55/238 (23%), Positives = 99/238 (41%), Gaps = 18/238 (7%)

Query: 50  EIPHWQRDNEHILSGYVGETRSMFQCFLSL---FYLHNESVNIYTHLLPG--IAFLFVLC 104
           ++P   R+N +I+ GY     + ++  LS+   +  HNE+ NI+THLL    I +L V  
Sbjct: 219 QLPFPWRENRYIIHGYRFYN-THYKSLLSVINWYGWHNETSNIWTHLLGAMYIVYLAVYD 277

Query: 105 FDKFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSIFHCLKNHS-RSVATFGNKLDYLGI 163
           F    V Q          ++  F   +  C+  S  +H     S   + +    +DY GI
Sbjct: 278 FPHSEVWQNPEVPQQARWIVFAFLAAALKCMLSSVFWHTFNGTSFLGLRSKFACVDYSGI 337

Query: 164 VVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFV 223
            +L+  S+++  +   +        +  I+   G     ++    F   E RP R   F+
Sbjct: 338 TILITASILTTEFVTMYSCYWAMCTYMTISLALGVFGVFMNWSPRFDRPEARPLRIRFFI 397

Query: 224 AFGLSAVLPIVTGIFYYGFSEIYLRIQVKWVL-----LGGIFYITGAVLYGVRFPEKY 276
                 VL  +  IF    ++++  I   W+         ++Y+ G V YG   PE++
Sbjct: 398 LLATMGVLSFLHLIF---LTDLHYAI---WLFSPVTNKSVVWYLVGVVFYGSFIPERF 449

>Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 50/237 (21%), Positives = 101/237 (42%), Gaps = 16/237 (6%)

Query: 50  EIPHWQRDNEHILSGYV---GETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFD 106
           ++P   R+N +I+ GY      ++S+   F + +  HNE+ NI++HLL  +  +++  +D
Sbjct: 219 QLPFPWRENRYIIHGYRFYNTHSKSLLSIF-NWYGWHNETSNIWSHLLGAMYLIYLAIYD 277

Query: 107 --KFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSIFHCLKNHS--RSVATFGNKLDYLG 162
             +  V +          ++ +F   +  C+  S  +H     S  +  + F   +DY G
Sbjct: 278 FPQSEVWKNPKVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFAC-VDYSG 336

Query: 163 IVVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMF 222
           I +L+  S+++  +   +        +  I+   G     ++    F   E RP R   F
Sbjct: 337 ITILITASILTTEFVTMYSCYWAMCTYMGISLALGIFGVFMNWSPRFDRPEARPLRIRFF 396

Query: 223 VAFGLSAVLPIVTGIFYYGF---SEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKY 276
           +      VL  +  IF       + ++  +  K V    ++Y+ G   YG   PE++
Sbjct: 397 ILLATMGVLSFLHLIFLTDLRYAARLFSPVTYKSV----VWYLVGVAFYGSFIPERF 449

>CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q07959 Saccharomyces cerevisiae
           YLR023c
          Length = 545

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 102/243 (41%), Gaps = 28/243 (11%)

Query: 50  EIPHWQRDNEHILSGY--VGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFDK 107
           E+P   R+N  I++GY      +      ++ +  HNE+ NI+THLL G+  L+++ F +
Sbjct: 218 ELPFPWRENRCIINGYRFYNSHKKSLLSIVNWYGWHNETSNIWTHLLGGLYILYLM-FYQ 276

Query: 108 FAVTQF-------ETTTLIDYVMIDLFSLVSFTCLTLSSIFHCLKNHS--RSVATFGNKL 158
           F  ++        +   LI YV    F + +  CL  S  +H     S  R    F   +
Sbjct: 277 FPSSEVFMSEQVPKAAKLITYV----FLIAAAKCLFSSVFWHTFNGTSLLRLRCKFAC-V 331

Query: 159 DYLGIVVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYR 218
           DY GI +L+  S+++  +   ++ P     +  ++   G     ++    F   E RP R
Sbjct: 332 DYSGISILITASILTTEFVTMYQCPWAMVSYMALSTALGIFGVFMNWSPKFDRPEARPLR 391

Query: 219 AAMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQVKWVL-----LGGIFYITGAVLYGVRFP 273
              F+      +L  +   F    S         W+L        ++Y+ G V YG   P
Sbjct: 392 IKFFILLASMGILSFLHLTFITSLS------HSTWLLSPITKKSVVWYLVGVVFYGSFIP 445

Query: 274 EKY 276
           E++
Sbjct: 446 ERW 448

>ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 531

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 50/236 (21%), Positives = 102/236 (43%), Gaps = 14/236 (5%)

Query: 50  EIPHWQRDNEHILSGY--VGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFDK 107
           ++P   R+N++I+ GY      +  F   ++ +  HNE+ NI+THLL G  +L  L F  
Sbjct: 209 QLPFPYRENKYIIHGYRFYASHKKSFLSIINWYGWHNETSNIWTHLL-GGLYLIYLAFYH 267

Query: 108 FAVTQFETTTLID---YVMIDLFSLVSFTCLTLSSIFHCLK-NHSRSVATFGNKLDYLGI 163
           F  +    +  +      ++ +F   +  C+  S  +H     H   + +    +DY GI
Sbjct: 268 FPHSNIWLSDRVPKPAKCIVAVFLAAAIKCMFASVFWHTFNGTHLLRLRSKFACVDYTGI 327

Query: 164 VVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFV 223
            +L+  S++++ +   ++       +   +   G     ++    F   E RP R   F+
Sbjct: 328 TILITASILTVEFVTMYDYKISLLFYMICSLALGIIGVSMNWSPKFDRPEARPLRIKFFI 387

Query: 224 ---AFGLSAVLPIVTGIFYYGFSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKY 276
                G S+ + +V    +   +++   +  K V    ++Y+ G   YG   PE++
Sbjct: 388 LLATVGCSSFIRLVFLTNWRYAADLLTPLTNKSV----VWYLIGVFFYGSFIPERF 439

>KLTH0C10208g Chr3 complement(846933..847844) [912 bp, 303 aa] {ON}
           similar to uniprot|Q12125 Saccharomyces cerevisiae
           YOR164C Hypothetical ORF
          Length = 303

 Score = 33.5 bits (75), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 112 QFETTTLIDYVMIDLFSLVSFTCLTLSS-IFHCLKNH-SRSVATFGNKLDYLG 162
           +F+T    DY  ++   L+ ++C T ++ +F  LK H + S   +G++LDYLG
Sbjct: 225 EFKTYCFEDYPELNFLQLLPYSCQTKNADLFDFLKKHYAGSSERYGSELDYLG 277

>Kwal_55.20171 s55 complement(281102..283198) [2097 bp, 698 aa] {ON}
           YHR084W (STE12) - Transcription factor [contig 153] FULL
          Length = 698

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 7/63 (11%)

Query: 39  SKKKRKLYTWDEIPH-------WQRDNEHILSGYVGETRSMFQCFLSLFYLHNESVNIYT 91
           ++KK+K++ W  +PH        +RD +   +G +  TRS+ +  LS  Y     +++Y 
Sbjct: 142 TQKKQKVFFWFSVPHDKLFADALERDMKRQSAGQLPTTRSVSEPALSFTYDDKSGLSLYD 201

Query: 92  HLL 94
            LL
Sbjct: 202 QLL 204

>YKL071W Chr11 (305114..305884) [771 bp, 256 aa] {ON} Putative
           protein of unknown function; expression induced in cells
           treated with the mycotoxin patulin, and also the quinone
           methide triterpene celastrol; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 256

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 41/93 (44%), Gaps = 2/93 (2%)

Query: 160 YLGIVVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRA 219
           +LGI + +  S VS  YY   ETP   +L  + T   G   A+  +      ++ R    
Sbjct: 86  FLGIDIFIACSAVSDSYYKVLETPKSVWLNHYSTNALGPILALQKVYPLLLLKKTRKIFF 145

Query: 220 AMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQVK 252
              VA  ++A +P+   +  YG S+  L   VK
Sbjct: 146 ISSVAGSINAFVPL--SVSAYGQSKAALNYAVK 176

>NDAI0E03840 Chr5 (841914..846083) [4170 bp, 1389 aa] {ON} Anc_7.57
            YOR336W
          Length = 1389

 Score = 31.6 bits (70), Expect = 3.4,   Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 18/34 (52%)

Query: 104  CFDKFAVTQFETTTLIDYVMIDLFSLVSFTCLTL 137
            C D F +  F   T  DY+ +D FS+  FT + L
Sbjct: 1075 CGDDFIIGSFSVNTYSDYIPVDSFSIADFTPIKL 1108

>KLTH0E03586g Chr5 complement(323231..325336) [2106 bp, 701 aa] {ON}
           similar to uniprot|P13574 Saccharomyces cerevisiae
           YHR084W STE12 Transcription factor that is activated by
           a MAP kinase signaling cascade activates genes involved
           in mating or pseudohyphal/invasive growth pathways
           cooperates with Tec1p transcription factor to regulate
           genes specific for invasive growth
          Length = 701

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 33/63 (52%), Gaps = 7/63 (11%)

Query: 39  SKKKRKLYTWDEIPH-------WQRDNEHILSGYVGETRSMFQCFLSLFYLHNESVNIYT 91
           ++KK+K++ W  +PH        +RD +   +G +  TR++ +  LS  Y     +++Y 
Sbjct: 142 TQKKQKVFFWFSVPHDKFFAYALERDMKRQSAGQLSTTRAVSEPALSFTYDDKSGLSLYD 201

Query: 92  HLL 94
            LL
Sbjct: 202 QLL 204

>KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {ON} 
          Length = 321

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 52/125 (41%), Gaps = 16/125 (12%)

Query: 100 LFVLCFDKFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLD 159
           L V   D + V +  +TT+ DYV++++F   +F C     +  C         T G+ L 
Sbjct: 109 LLVFFTDVYLVPRHVSTTMTDYVLLNVFLATAFQCAACHMV-QCF------TTTAGSVLS 161

Query: 160 YLGIVVLVVTSMVSIMYYGFFETP------ALFYLFSFITCTFGAACAVVSLKEGFRTRE 213
            + ++     S V+++YY +++        ALF     +     AA  V S       R+
Sbjct: 162 TITMLNHWACSAVTLLYYSYYDNVFYFKLLALFTANWTLVV---AAVTVTSTASNSPKRQ 218

Query: 214 WRPYR 218
           W   R
Sbjct: 219 WWSRR 223

>Kwal_26.8982 s26 complement(1028091..1029386) [1296 bp, 431 aa]
           {ON} YMR209C - Hypothetical ORF [contig 68] FULL
          Length = 431

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 8/64 (12%)

Query: 26  TSGPVK------GQKTDKMSKKKRKLYTWDEIPHWQRDNEHILSGYVGETRSMFQCFLSL 79
            +GP+K       Q TD    K R+L  W ++ H     E  L+GY+   +S++Q + SL
Sbjct: 364 NAGPLKYGTRPKVQLTDSELTKLRELRHWKDLSHACNPKE--LNGYLTNQKSLYQGYYSL 421

Query: 80  FYLH 83
              H
Sbjct: 422 VKFH 425

>ZYRO0G16742g Chr7 (1373818..1375449) [1632 bp, 543 aa] {ON} weakly
           similar to uniprot|P21147 Saccharomyces cerevisiae
           YGL055W OLE1 Fatty acid desaturase required for
           monounsaturated fatty acid synthesis and for normal
           distribution of mitochondria
          Length = 543

 Score = 30.0 bits (66), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 23/32 (71%), Gaps = 1/32 (3%)

Query: 231 LPIVTGIFYYGFSEIYLRIQVKWVLLGGIFYI 262
           +P  TGI+Y GF ++ + IQ +W+LLG + +I
Sbjct: 279 VPYWTGIYYLGFVKMSI-IQQQWLLLGTLAHI 309

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.141    0.442 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,179,830
Number of extensions: 1336669
Number of successful extensions: 4970
Number of sequences better than 10.0: 84
Number of HSP's gapped: 5025
Number of HSP's successfully gapped: 84
Length of query: 322
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 212
Effective length of database: 40,868,139
Effective search space: 8664045468
Effective search space used: 8664045468
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 66 (30.0 bits)