Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G044106.28ON38138119670.0
ZYRO0C07546g6.28ON37737812171e-167
Kpol_1037.236.28ON37837911821e-161
SAKL0E01518g6.28ON37938011811e-161
NCAS0D021406.28ON37637911801e-161
Suva_15.1726.28ON39837811781e-161
CAGL0E02497g6.28ON37637811541e-157
Skud_15.1596.28ON37937911521e-157
YOL003C (PFA4)6.28ON37837811501e-157
NDAI0C026506.28ON38938911371e-154
Smik_15.1676.28ON37837811271e-153
KLTH0C10978g6.28ON37737911021e-149
TPHA0J003906.28ON38038011021e-149
Ecym_30326.28ON37738010891e-147
Kwal_56.224596.28ON38338110391e-140
KLLA0C06204g6.28ON37738210261e-138
ACL003C6.28ON37537810001e-134
KNAG0F029306.28ON3863869661e-129
KAFR0A051306.28ON3963999221e-122
TBLA0B004806.28ON3774134972e-58
NDAI0G013403.12ON3351332115e-18
TPHA0P015603.12ON3311762072e-17
CAGL0D02508g3.12ON332592011e-16
NCAS0E013003.12ON3271891965e-16
SAKL0H13860g8.389ON352931965e-16
Kwal_55.221263.12ON360711912e-15
KLLA0E02069g3.12ON325931902e-15
KAFR0A085903.12ON3311311884e-15
KLTH0F19580g3.12ON342711886e-15
Ecym_20143.12ON339751877e-15
SAKL0C13596g3.12ON333921878e-15
KNAG0K025703.12ON328711869e-15
ZYRO0C04092g8.389ON3661021879e-15
TDEL0A003103.12ON329901869e-15
Kpol_1014.293.12ON326921851e-14
Skud_12.3218.389ON356601833e-14
TBLA0H001503.12ON345581824e-14
TDEL0F051308.389ON359601816e-14
NCAS0B035908.286ON329751806e-14
Suva_10.3428.389ON356911806e-14
NCAS0C029208.389ON374921806e-14
Smik_12.3068.389ON359931807e-14
SAKL0H16434g8.286ON555921819e-14
KAFR0H019808.389ON361781762e-13
YLR246W (ERF2)8.389ON359841762e-13
Skud_4.3878.286ON336891753e-13
KLTH0F08668g8.389ON358681753e-13
ZYRO0C03410g3.12ON3271181743e-13
TPHA0C023608.389ON404661754e-13
TBLA0H009208.389ON360771744e-13
ADL197C3.12ON390711744e-13
Suva_14.153.12ON3302531717e-13
Ecym_41788.389ON368671719e-13
Skud_14.153.12ON3362381701e-12
ZYRO0D06600g8.286ON330491701e-12
YNL326C (PFA3)3.12ON3361631691e-12
KAFR0B053708.286ON3291451691e-12
CAGL0G08217g8.389ON326611692e-12
Smik_14.63.12ON3341031682e-12
TBLA0D040408.286ON329701663e-12
KNAG0A027108.389ON354861673e-12
AGL125C8.389ON3671391674e-12
Kwal_23.33028.389ON353511648e-12
TPHA0C010708.286ON3331501639e-12
CAGL0B01991g8.286ON330631621e-11
NDAI0G022508.389ON389851641e-11
TDEL0F041308.286ON328571611e-11
YDR126W (SWF1)8.286ON336621612e-11
KLLA0D18370g8.389ON355601584e-11
KLTH0G13112g8.286ON3491771575e-11
NDAI0J010008.286ON339621576e-11
Suva_2.2898.286ON335621567e-11
Smik_4.3728.286ON335491567e-11
Kpol_1033.168.286ON321481504e-10
KLLA0F19690g8.286ON324711461e-09
TBLA0E028305.579ON386901462e-09
Ecym_42828.286ON340801442e-09
Smik_4.7375.579ON3782121443e-09
Kwal_56.236978.286ON338631391e-08
AGR065W8.286ON326441381e-08
YDR459C (PFA5)5.579ON3742321363e-08
KNAG0H031108.286ON331681353e-08
NCAS0F013905.579ON3742541353e-08
ZYRO0D13860g5.579ON3651431301e-07
Skud_4.7345.579ON3802091282e-07
Kpol_1004.575.579ON3622061264e-07
KAFR0I011105.579ON3702321265e-07
KNAG0C028305.579ON3541031256e-07
KNAG0C062305.626ON7521101259e-07
KLTH0G04972g5.579ON367711231e-06
TDEL0A044405.579ON365671222e-06
Kwal_47.183665.579ON356741203e-06
NDAI0H018905.579ON406501185e-06
Ecym_41145.579ON3721031185e-06
SAKL0G06160g5.579ON364941141e-05
TPHA0C003705.626ON7591131151e-05
Skud_4.5275.626ON764731142e-05
Suva_2.4325.626ON763601133e-05
TBLA0J008305.626ON7391521133e-05
NDAI0H008505.626ON786751133e-05
TDEL0A049205.626ON7501601115e-05
Suva_2.6345.579ON388501095e-05
YDR264C (AKR1)5.626ON764601098e-05
Smik_4.5155.626ON764601081e-04
NCAS0C052805.626ON757911071e-04
Kpol_526.325.626ON7771001072e-04
KLLA0D06149g5.579ON349661052e-04
ABR203W5.579ON359851052e-04
ZYRO0C11132g5.626ON759581025e-04
KAFR0H005705.626ON757631026e-04
KLTH0E02420g5.626ON73465990.001
Suva_8.875.626ON73069990.001
AER388C5.626ON72458980.002
YOR034C (AKR2)5.626ON74961980.002
CAGL0M08712g5.626ON763105940.006
CAGL0K06347g5.579ON35253920.007
SAKL0G07326g5.626ON73787920.008
Smik_15.2135.626ON74461910.011
Ecym_13305.626ON73976910.011
Skud_15.1995.626ON74161820.15
KNAG0B031405.626ON68294810.21
KLLA0E16721g5.626ON75262780.48
ACL040C7.281ON34258741.2
NCAS0G035501.531ON40675703.5
TBLA0H022505.102ON55732686.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G04410
         (381 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {O...   762   0.0  
ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {...   473   e-167
Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {O...   459   e-161
SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} simila...   459   e-161
NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {O...   459   e-161
Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {...   458   e-161
CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {...   449   e-157
Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {...   448   e-157
YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON} ...   447   e-157
NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28     442   e-154
Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {...   438   e-153
KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {...   429   e-149
TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28...   429   e-149
Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to ...   424   e-147
Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003...   404   e-140
KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {...   399   e-138
ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON} S...   389   e-134
KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {O...   376   e-129
KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa] ...   359   e-122
TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28 ...   196   2e-58
NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12      86   5e-18
TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.1...    84   2e-17
CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar...    82   1e-16
NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON...    80   5e-16
SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} simi...    80   5e-16
Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL3...    78   2e-15
KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {O...    78   2e-15
KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3....    77   4e-15
KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} simi...    77   6e-15
Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON} s...    77   7e-15
SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} simi...    77   8e-15
KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.1...    76   9e-15
ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {...    77   9e-15
TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON} ...    76   9e-15
Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON} (48992.....    76   1e-14
Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246...    75   3e-14
TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}...    75   4e-14
TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {O...    74   6e-14
NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON}      74   6e-14
Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246...    74   6e-14
NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389     74   6e-14
Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246...    74   7e-14
SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]...    74   9e-14
KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.3...    72   2e-13
YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subun...    72   2e-13
Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W ...    72   3e-13
KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} simila...    72   3e-13
ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar...    72   3e-13
TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.3...    72   4e-13
TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.3...    72   4e-13
ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON} S...    72   4e-13
Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON} ...    70   7e-13
Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar t...    70   9e-13
Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}...    70   1e-12
ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {O...    70   1e-12
YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}  P...    70   1e-12
KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {...    70   1e-12
CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {O...    70   2e-12
Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON} ...    69   2e-12
TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {...    69   3e-12
KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.3...    69   3e-12
AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON} S...    69   4e-12
Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W...    68   8e-12
TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {O...    67   9e-12
CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar...    67   1e-11
NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389     68   1e-11
TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.28...    67   1e-11
YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}  SWF1Palmit...    67   2e-11
KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]...    65   4e-11
KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]...    65   5e-11
NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8....    65   6e-11
Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W ...    65   7e-11
Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W ...    65   7e-11
Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON} (35544.....    62   4e-10
KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} simil...    61   1e-09
TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.5...    61   2e-09
Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}...    60   2e-09
Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {...    60   3e-09
Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {...    58   1e-08
AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic hom...    58   1e-08
YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}...    57   3e-08
KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON...    57   3e-08
NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {O...    57   3e-08
ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]...    55   1e-07
Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {...    54   2e-07
Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa] ...    53   4e-07
KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.5...    53   5e-07
KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {O...    53   6e-07
KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa] ...    53   9e-07
KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {...    52   1e-06
TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {O...    52   2e-06
Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459...    51   3e-06
NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {O...    50   5e-06
Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}...    50   5e-06
SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {...    49   1e-05
TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626...    49   1e-05
Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON...    49   2e-05
Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON...    48   3e-05
TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {...    48   3e-05
NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.6...    48   3e-05
TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {O...    47   5e-05
Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {...    47   5e-05
YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}  ...    47   8e-05
Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON...    46   1e-04
NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa] ...    46   1e-04
Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}...    46   2e-04
KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} simila...    45   2e-04
ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic ho...    45   2e-04
ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {...    44   5e-04
KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.6...    44   6e-04
KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {...    43   0.001
Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}...    43   0.001
AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}...    42   0.002
YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON} ...    42   0.002
CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} simil...    41   0.006
CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa] ...    40   0.007
SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {...    40   0.008
Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {...    40   0.011
Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar t...    40   0.011
Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {...    36   0.15 
KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.6...    36   0.21 
KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} simi...    35   0.48 
ACL040C Chr3 complement(293391..294419) [1029 bp, 342 aa] {ON} S...    33   1.2  
NCAS0G03550 Chr7 complement(664516..665736) [1221 bp, 406 aa] {O...    32   3.5  
TBLA0H02250 Chr8 (543632..545305) [1674 bp, 557 aa] {ON} Anc_5.1...    31   6.4  

>TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {ON}
           Anc_6.28 YOL003C
          Length = 381

 Score =  762 bits (1967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/381 (96%), Positives = 369/381 (96%)

Query: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60
           MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT
Sbjct: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60

Query: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120
           NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF
Sbjct: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120

Query: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVXXX 180
           PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFV   
Sbjct: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVLLT 180

Query: 181 XXXXXXXXXANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINEST 240
                    ANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINEST
Sbjct: 181 ITILLCRCLANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINEST 240

Query: 241 AAELSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNEISEY 300
           AAELSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNEISEY
Sbjct: 241 AAELSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNEISEY 300

Query: 301 SSRASYEDLLLSLPWPPDGGRTRAGPGSLSSSIESITKQGEQLIRRRPNDTSDLIGRRQW 360
           SSRASYEDLLLSLPWPPDGGRTRAGPGSLSSSIESITKQGEQLIRRRPNDTSDLIGRRQW
Sbjct: 301 SSRASYEDLLLSLPWPPDGGRTRAGPGSLSSSIESITKQGEQLIRRRPNDTSDLIGRRQW 360

Query: 361 QNDWGENLEDFGVDVDTEQAS 381
           QNDWGENLEDFGVDVDTEQAS
Sbjct: 361 QNDWGENLEDFGVDVDTEQAS 381

>ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  473 bits (1217), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 219/378 (57%), Positives = 277/378 (73%), Gaps = 1/378 (0%)

Query: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60
           MPV+LKWP+LGIAIPC L+SFIGY  H+FILSNFLS  KQ+WF+ +L +IW SYY AIYT
Sbjct: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60

Query: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120
            PG+P PNF+  K  WK+YCKKC+NYKPERAHHCKTCNQCVL MDHHCPWT NCVG+ NF
Sbjct: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF 120

Query: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVXXX 180
           PHF+RFL WVI  T +LLY+L  R   +  + N P Y++++SEL+FLTIL P+D F+   
Sbjct: 121 PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180

Query: 181 XXXXXXXXXANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINEST 240
                    +NQIF G +QIETWE ERL+ L+ SKRL+P L+   W+++P  R +  E  
Sbjct: 181 ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE 240

Query: 241 AAELSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNEISEY 300
           A+ LS  + + L+ +VNFPYD+DPWSN  + LG+PL WLWPFG+PKGDGM F KN+ISE+
Sbjct: 241 ASRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISEF 300

Query: 301 SSRASYEDLLLSLPWPPDGGRTRAGPGSLSSSIESITKQGEQLIRRRPNDTSDLIGRRQW 360
               +  D+LL+LPWPPDGG+ +       +++E+  + GEQ+IR+R  D  D   R QW
Sbjct: 301 -EETNLTDMLLALPWPPDGGKDKVISIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRTQW 359

Query: 361 QNDWGENLEDFGVDVDTE 378
           QN WGENLEDFGVDVD E
Sbjct: 360 QNTWGENLEDFGVDVDAE 377

>Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {ON}
           complement(51397..52533) [1137 nt, 379 aa]
          Length = 378

 Score =  459 bits (1182), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 215/379 (56%), Positives = 272/379 (71%), Gaps = 2/379 (0%)

Query: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60
           MPVKLK+PW+GIAIPC L+SFI Y  H+FIL NFLS  KQ+WF+ ++ +IW+SYY AIYT
Sbjct: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60

Query: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120
           NPG+P  N+  P  +WKNYCKKC  YKPER HHCKTC QCVLMMDHHCPWTMNCVG+ NF
Sbjct: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF 120

Query: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVXXX 180
           PHFLRFL WVIV T +LLY L+SRI+ LW+ RNLP Y+F++SE++FLTI TP+D FV   
Sbjct: 121 PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT 180

Query: 181 XXXXXXXXXANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINEST 240
                     NQ+ +G +QIETWE ERL++LF  +RL P LI   W+  P  +   NE+ 
Sbjct: 181 ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPDNEAK 240

Query: 241 AAELSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNEISEY 300
           A ++ ++K +R + +V+FPYDL   +N   +LG+P+ WLW +G P GDGM F KNE S +
Sbjct: 241 AEKI-VSKRIRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYSLF 299

Query: 301 SSRASYEDLLLSLPWPPDGGRTRAG-PGSLSSSIESITKQGEQLIRRRPNDTSDLIGRRQ 359
              +  ED +LSLPWPPDGG+       S ++SIE+ TK GE +IR+R   +  L  R Q
Sbjct: 300 EEDSILEDQILSLPWPPDGGKHGFNIENSSTNSIETSTKDGEHVIRKRSPVSKLLESRTQ 359

Query: 360 WQNDWGENLEDFGVDVDTE 378
           W NDWGENLEDFGVD+D E
Sbjct: 360 WYNDWGENLEDFGVDIDVE 378

>SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} similar
           to uniprot|Q12006 Saccharomyces cerevisiae YOL003C
           DHHC-CRD protein
          Length = 379

 Score =  459 bits (1181), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 216/380 (56%), Positives = 272/380 (71%), Gaps = 3/380 (0%)

Query: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60
           M VKLKWPWLGIAIP  L+SFIGYC H+FILSNFL   KQLWF+ +L +IW+SYY AIYT
Sbjct: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60

Query: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120
           NPG+P P F   K+EW+N+C KC NYKPERAHHCK CNQCVL MDHHCPWTMNCVGH NF
Sbjct: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF 120

Query: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVXXX 180
            HF+RFL WVI  T+FLL  LV RI+ LW  R++P+Y  HRSEL+FLTILTP+DAFV   
Sbjct: 121 AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT 180

Query: 181 XXXXXXXXXANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINEST 240
                     NQI  GM+QIE+WE++R++ +F S +L+P ++E   +I PG+    ++  
Sbjct: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQDDDI 240

Query: 241 AAELSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNEISEY 300
              LS N+ L L+++VNFPYDL+PW+NA   LG+   W+ P+G  KG+GM F KNE+S Y
Sbjct: 241 RKLLSQNR-LSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSVY 299

Query: 301 SSRASYEDLLLSLPWPPDGGRTRAGPGSLSSS--IESITKQGEQLIRRRPNDTSDLIGRR 358
                 ED LLSLPWPPDGGR +   G  +    +ES T+ GE+++R+R  D    + R+
Sbjct: 300 EPEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPRK 359

Query: 359 QWQNDWGENLEDFGVDVDTE 378
           +W NDWGENL DFGVD+D E
Sbjct: 360 KWYNDWGENLADFGVDLDEE 379

>NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {ON}
           Anc_6.28
          Length = 376

 Score =  459 bits (1180), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 216/379 (56%), Positives = 274/379 (72%), Gaps = 4/379 (1%)

Query: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60
           MPVKLK+PW+G+ IPC+L SFIGY  H F+L+NF+S   QLWFQ +L ++W+SY  AI+T
Sbjct: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60

Query: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120
           NPGRP  +F+  K EW ++CKKCQ +KPERAHHCKTCNQCVLMMDHHCPWTMNCVG  NF
Sbjct: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120

Query: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVXXX 180
           PHFLRFL WV+V T FLLYQL+ R I LW  ++LP Y+F ++E+ FL IL P+D FV   
Sbjct: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180

Query: 181 XXXXXXXXXANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINEST 240
                    +NQI  G +QIE+WELERL+ L+  K+L+P L+   W+I+P  +   N+  
Sbjct: 181 VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVL 240

Query: 241 AAEL-SMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNEISE 299
           A +L    +++R E++V FPYDLD WSNA  +LG+P+ WLW FG P  DGM F KNE++ 
Sbjct: 241 AKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKNELAL 300

Query: 300 YSSRASYEDLLLSLPWPPDGGRTRAGPGSLSSSIESITKQGEQLIRRRPNDTSDLIGRRQ 359
           Y   A+ EDLLLSLPWPPDGGR         +++ESIT+ GEQ+IR+R N  +D   R+ 
Sbjct: 301 YEEGAAIEDLLLSLPWPPDGGRNFIQQK--GTNVESITENGEQVIRQR-NFENDNSYRKT 357

Query: 360 WQNDWGENLEDFGVDVDTE 378
           W NDWGENLEDFGVDVD E
Sbjct: 358 WNNDWGENLEDFGVDVDVE 376

>Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {ON}
           YOL003C (REAL)
          Length = 398

 Score =  458 bits (1178), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 214/378 (56%), Positives = 269/378 (71%)

Query: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60
           M VKLKWPWLGIAIP  L+SFIGY  H+FILSNFLS SKQ+ F+ +L++IW+SYY AIYT
Sbjct: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80

Query: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120
           NPG+P P ++     W NYCKKCQNYKPER+HHCK CNQCVLMMDHHCPWTMNCVG  N+
Sbjct: 81  NPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNY 140

Query: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVXXX 180
           PHFLRF+ WVI  T FL    + R+  +W+ R+LP Y+F +SELVFLTILTPL+ FV   
Sbjct: 141 PHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPLNFFVLLT 200

Query: 181 XXXXXXXXXANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINEST 240
                     NQI NG SQIE+W+++RL++LFDS+RL+  LIE  W I+P  R    E  
Sbjct: 201 IVILFLRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEARSPQLERD 260

Query: 241 AAELSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNEISEY 300
           A +L    ++R E+VVNFPY++D ++NA   LG   LWLWP G P GDG SF KN+IS+Y
Sbjct: 261 AEKLLTQHKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNSFQKNDISKY 320

Query: 301 SSRASYEDLLLSLPWPPDGGRTRAGPGSLSSSIESITKQGEQLIRRRPNDTSDLIGRRQW 360
              +S ED++LSLPWPPDGG+ +      + +IE+  + GEQ++R R         R +W
Sbjct: 321 EVNSSLEDIMLSLPWPPDGGKIKTASNHSNLAIETCNEGGEQVVRSRIAQHGRSATREKW 380

Query: 361 QNDWGENLEDFGVDVDTE 378
            NDWGE+L+DFGVDVD E
Sbjct: 381 YNDWGESLDDFGVDVDME 398

>CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003c
          Length = 376

 Score =  449 bits (1154), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 216/378 (57%), Positives = 267/378 (70%), Gaps = 2/378 (0%)

Query: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60
           MPVKLKWPWLGIAIP  L++ IGYC H+FIL NFLS  KQLW+Q    +IWLSYY AIYT
Sbjct: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60

Query: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120
            PG+P  NF+  K EWK YCKKC+ YKPER+HHCKTCNQCVLMMDHHCPWTMNCVG+NNF
Sbjct: 61  PPGKPPTNFKPSKNEWKVYCKKCKCYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF 120

Query: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVXXX 180
           PHF+RFL WVIV T  L   L +RI  +W  R+ P Y++++SEL+FLTILTPL+AF+   
Sbjct: 121 PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT 180

Query: 181 XXXXXXXXXANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINEST 240
                     NQIFNG SQIE+WE++RL+ L    +L+P+LIE  W IFP  R +  ES 
Sbjct: 181 ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ 240

Query: 241 AAELSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNEISEY 300
           A  L   K L L+++VNFPYDL P+ NA QLLG P LWL+PF  P+ DG+ F KNE S  
Sbjct: 241 AEALLNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESMI 300

Query: 301 SSRASYEDLLLSLPWPPDGGRTRAGPGSLSSSIESITKQGEQLIRRRPNDTSDLIGRRQW 360
               S  D++L LPWPPD  +        +S+++ I+++GEQ+IR R  +    + R +W
Sbjct: 301 EDPNSLNDIILCLPWPPDSTKHLNSTSEHTSNVQIISEEGEQVIRIRTPEKK--LSRSEW 358

Query: 361 QNDWGENLEDFGVDVDTE 378
            NDWGE+LEDFGVDVD E
Sbjct: 359 LNDWGESLEDFGVDVDVE 376

>Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {ON}
           YOL003C (REAL)
          Length = 379

 Score =  448 bits (1152), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 212/379 (55%), Positives = 270/379 (71%), Gaps = 1/379 (0%)

Query: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60
           M VKLKWPWLGIAIP  L+SFIGY  H+FILSNFLS SKQL F+ +L++IW+SYY AIYT
Sbjct: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60

Query: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120
           N GRP PN+      W N+CKKCQ+YKPER+HHCK CNQCVLMMDHHCPWTMNCVG  N+
Sbjct: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120

Query: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVXXX 180
           PHFLRFL WVIV T+ L    V RI  +W+ R+LP Y+F +SEL+FLTIL+PLD FV   
Sbjct: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180

Query: 181 XXXXXXXXXANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINEST 240
                    +NQI NG SQIE+W+++RL++L DS +L+P LI+  W I+P  R   +E  
Sbjct: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERD 240

Query: 241 AAE-LSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNEISE 299
           A + L+     R +++V+FPY+ +P +NA   LG   LWLWP+G P GDG SF KN+IS+
Sbjct: 241 ADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDISQ 300

Query: 300 YSSRASYEDLLLSLPWPPDGGRTRAGPGSLSSSIESITKQGEQLIRRRPNDTSDLIGRRQ 359
           Y   +  ED++LSLPWPPDG +T+A     +S+IE+  + GEQ++R R         R +
Sbjct: 301 YEVNSPLEDIILSLPWPPDGNKTKAVSNHNNSTIETYNEGGEQIVRSRNAQHGSDAIREK 360

Query: 360 WQNDWGENLEDFGVDVDTE 378
           W NDWGE+L+DFGVDVD E
Sbjct: 361 WYNDWGESLDDFGVDVDME 379

>YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON}
           PFA4Palmitoyltransferase with autoacylation activity,
           required for palmitoylation of amino acid permeases
           containing a C-terminal Phe-Trp-Cys site; required for
           modification of Chs3p; member of the DHHC family of
           putative palmitoyltransferases
          Length = 378

 Score =  447 bits (1150), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 215/378 (56%), Positives = 267/378 (70%)

Query: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60
           MPVKL+WPWLGIAIP  L+SFIGY  H+FILSNFLS  KQ+ F+  L++IWLSYY AI T
Sbjct: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60

Query: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120
           NPGRP PN++ P   W+N+CKKCQ+YKPER+HHCKTCNQCVLMMDHHCPWTMNCVG  N+
Sbjct: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120

Query: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVXXX 180
           PHFLRFL W+IV T+ L      RI  +W+ R+LP Y F +SEL+FLTI +PL++FV   
Sbjct: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180

Query: 181 XXXXXXXXXANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINEST 240
                     NQI NG SQIE+W+++RL++LF+S RL   LI+  W I+P +R   N+  
Sbjct: 181 ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240

Query: 241 AAELSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNEISEY 300
           A E    K  R +++VNFPYD D ++NA   LG   LWLWP+G P GDG +F KN IS+Y
Sbjct: 241 AEEHLTKKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISKY 300

Query: 301 SSRASYEDLLLSLPWPPDGGRTRAGPGSLSSSIESITKQGEQLIRRRPNDTSDLIGRRQW 360
            + +S ED +LSLPWPPDGG+T       SS+IE   + GEQLIR R         R +W
Sbjct: 301 EANSSLEDHILSLPWPPDGGKTNTVFNHGSSTIEMRNESGEQLIRTRLPQNGRHASREKW 360

Query: 361 QNDWGENLEDFGVDVDTE 378
            NDWGE+L+DFGVDVD E
Sbjct: 361 YNDWGESLDDFGVDVDME 378

>NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28
          Length = 389

 Score =  442 bits (1137), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 202/389 (51%), Positives = 278/389 (71%), Gaps = 13/389 (3%)

Query: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60
           M +KLK+PWLG+AIP  ++SFIGY  H+FILSNFLS  KQ+WFQ +L++IW+SY  AI+T
Sbjct: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60

Query: 61  NPGRPRPNFEVPKY----EWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVG 116
           NPG+P  N +   +    +W  +CKKC NYKPER+HHCKTCNQCVLMMDHHCPWTMNCVG
Sbjct: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120

Query: 117 HNNFPHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAF 176
           + NFPHF+RFL+W+I+ T FLL  L+ R + +W  R+LP Y+F R+E++FLTIL P+DAF
Sbjct: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180

Query: 177 VXXXXXXXXXXXXANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQI 236
           +             NQI  GM+QIE WELERL+ LF +K+L+P++I   W+++P  R ++
Sbjct: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240

Query: 237 NESTAAE-LSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKN 295
            ++ A + LS  K++R E++VNFPYD+D W+N   ++G+   W+W FG P  +G+ F KN
Sbjct: 241 ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN 300

Query: 296 EISEYSSRASYEDLLLSLPWPPDGGRTRAGPGSLSSSIESITKQGEQLIRRRPNDTSDL- 354
           EIS Y   +S EDLLLSLPWPPD GR      +  +S+ES+   GEQ++R R ++ +++ 
Sbjct: 301 EISLYEPGSSVEDLLLSLPWPPDKGRNFI--SNKDTSVESLVYDGEQVVRNRASNDTNIS 358

Query: 355 -----IGRRQWQNDWGENLEDFGVDVDTE 378
                I R +W NDWGE+L DFGVD++ E
Sbjct: 359 TINKDISREEWNNDWGESLVDFGVDIEAE 387

>Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {ON}
           YOL003C (REAL)
          Length = 378

 Score =  438 bits (1127), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 207/378 (54%), Positives = 263/378 (69%)

Query: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60
           M VKL+WPWLGIAIP +L+SFIGY  H+FILSNFL  +KQ+ F+ +L++IW SYY AIYT
Sbjct: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60

Query: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120
           NPGRP PN++     W N+CKKCQNYKPER+HHCKTCNQCVLMMDHHCPWTMNCVG  N+
Sbjct: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY 120

Query: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVXXX 180
           PHFLRFL W+I+ T+ L    V RI  +W+ RN P Y+F +SEL FLTIL+PL+ FV   
Sbjct: 121 PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPLNFFVLLT 180

Query: 181 XXXXXXXXXANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINEST 240
                     NQI NG SQIE+W+++RL++LFDS+RL+  LI   W I+P ++   +E  
Sbjct: 181 ITVLFLRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQHERD 240

Query: 241 AAELSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNEISEY 300
           A  L   +    E +VNFPY+ D  +NA   LG   LWLWP+G P G+G +F KN+IS Y
Sbjct: 241 AEGLLKQQRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISNY 300

Query: 301 SSRASYEDLLLSLPWPPDGGRTRAGPGSLSSSIESITKQGEQLIRRRPNDTSDLIGRRQW 360
              +  ED++LSLPWPPDGG T       +S+IE+  + GEQ++R R         R +W
Sbjct: 301 EVDSPLEDIILSLPWPPDGGETTTVSNPKTSTIETCNEGGEQVVRSRVAQNGRSASREKW 360

Query: 361 QNDWGENLEDFGVDVDTE 378
            NDWGE+L+DFGVDVD E
Sbjct: 361 FNDWGESLDDFGVDVDME 378

>KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  429 bits (1102), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 200/379 (52%), Positives = 262/379 (69%), Gaps = 4/379 (1%)

Query: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60
           MPV+LKWPWLGIA+P  L+++IGY  H+FIL NF S  +QLWF+ +L LIW+SY +AI+ 
Sbjct: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60

Query: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120
           NPGRP PNFE P ++WKNYCKKC NYKPER HHCKTC QCVL MDHHCPWTMNCVGHNNF
Sbjct: 61  NPGRPPPNFEPPIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF 120

Query: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVXXX 180
           PHF+RFL WV++ T++L   L  R    W  RN   ++ H SEL FL +  PL+AF+   
Sbjct: 121 PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRKFV-HTSELCFLFVNAPLNAFILLT 179

Query: 181 XXXXXXXXXANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINEST 240
                     NQ  NGM+QIE+WE +R++ LF ++RLVP LI+   ++FP   +  +E  
Sbjct: 180 VSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFP--EDTFDEGA 237

Query: 241 AAELSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNEISEY 300
           A +L  +K+L LED++NFPYD+D   N +  +G    W  P GRP+ +G  FV N++S+Y
Sbjct: 238 AQKLLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSDY 297

Query: 301 SSRASYEDLLLSLPWPPDGGRTRAG-PGSLSSSIESITKQGEQLIRRRPNDTSDLIGRRQ 359
             +AS ED LLSLPWPPDGGR ++     ++S++E+ +  GE  +R R  D+   + R +
Sbjct: 298 DIKASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNRSFDSRISVPRTE 357

Query: 360 WQNDWGENLEDFGVDVDTE 378
           W NDWGENL DFGVDVD E
Sbjct: 358 WHNDWGENLSDFGVDVDAE 376

>TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28
           YOL003C
          Length = 380

 Score =  429 bits (1102), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 198/380 (52%), Positives = 264/380 (69%), Gaps = 1/380 (0%)

Query: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60
           MPVK KWPW+GIAIPCVL+SFIGY  H++IL   LS  KQ +F+ +L +IW+SYY AI  
Sbjct: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60

Query: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120
           NPG+P  NF+   +EW+N+CKKC NYKPER+HHCKTCNQCVLMMDHHCPWTMNC+G NNF
Sbjct: 61  NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120

Query: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVXXX 180
           PHF+RFL+W++  T FLL+  + RII +W +RNLP Y+F RSE++ L + TPL+ F+   
Sbjct: 121 PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPLNLFILLT 180

Query: 181 XXXXXXXXXANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINEST 240
                     NQI NG +QIE WE++RL+  F  K+L+P LI   W+++P  +   ++  
Sbjct: 181 ITLLFCRCLFNQIINGKTQIEDWEMDRLENRFYLKKLLPQLILNLWELYPELKSAKHDEE 240

Query: 241 AAELSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNEISEY 300
           A  L   K +R + +VNFPYDL  + N   L+G PL WLWPFG P G+GM+F KNEI+ +
Sbjct: 241 AERLIEKKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIALF 300

Query: 301 SSRASYEDLLLSLPWPPDGGR-TRAGPGSLSSSIESITKQGEQLIRRRPNDTSDLIGRRQ 359
              +S     L+LPWPPD GR   +   +  S++E IT  GEQ++R R +  + ++ R +
Sbjct: 301 DPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSNVEFITTDGEQVVRNRTHAKNPILSREE 360

Query: 360 WQNDWGENLEDFGVDVDTEQ 379
           W N+WGENLEDFGVDV+ E 
Sbjct: 361 WFNEWGENLEDFGVDVEMEN 380

>Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to
           Ashbya gossypii ACL003C
          Length = 377

 Score =  424 bits (1089), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 199/380 (52%), Positives = 260/380 (68%), Gaps = 6/380 (1%)

Query: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60
           MPVKLKWPWLGIAIPC L++FIGY    F+L  FLS  +Q+WFQ +L +IWLSYY AIYT
Sbjct: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60

Query: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120
           NPG P P F+  K+EWKNYCKKCQN+KPER HHCKTC QCVL+MDHHCP+TMNCVG+NNF
Sbjct: 61  NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF 120

Query: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVXXX 180
           PHF+RFL W+I  T +L  Q   R   +W  R+    +  + E++FLTILTP +AFV   
Sbjct: 121 PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT 180

Query: 181 XXXXXXXXXANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINEST 240
                     NQ+ NGM+QIE WE++R++++F ++RLVP L+    +++P + +  ++  
Sbjct: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDG-HKGE 239

Query: 241 AAELSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNEISEY 300
              +  N+++  ED+VNFPYD DPW N    +G  L WL PFG+P G+GM F KNE+S Y
Sbjct: 240 IDRILNNRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSAY 299

Query: 301 SSRASYEDLLLSLPWPPDGGRTRAGPGSLSS--SIESITKQGEQLIRRRPNDTSDLIGRR 358
              ++  D LLSLPWPPDG R    P S +S   +ES T+ GE +IR+R  +    + R 
Sbjct: 300 EHGSTLTDKLLSLPWPPDGER---APNSSNSRLKVESSTRNGEHIIRKRSPEPRLNLSRT 356

Query: 359 QWQNDWGENLEDFGVDVDTE 378
           +W NDWGENL  FGVDVD +
Sbjct: 357 EWYNDWGENLAHFGVDVDAD 376

>Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003C -
           Hypothetical ORF [contig 185] FULL
          Length = 383

 Score =  404 bits (1039), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 196/381 (51%), Positives = 264/381 (69%), Gaps = 4/381 (1%)

Query: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60
           MPVKLKWPWLGIAIP  L++FIGY  H+FIL NFLS  +Q+WFQ  L++IW+SY  AI+T
Sbjct: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60

Query: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120
           NPG+P   F+   ++WKN C+KC+ YKPER HHCKTC+QCVL+MDHHCPWTMNCVGHNNF
Sbjct: 61  NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF 120

Query: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVXXX 180
           PHF+RFLVWVI+ T++L + L  RI + W+ R+   Y+  + ELVF+ I TPL+AFV   
Sbjct: 121 PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYV-QKIELVFIFINTPLNAFVWLT 179

Query: 181 XXXXXXXXXANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINEST 240
                     NQ   GM+QIE WE ER++  F++ RL+P L+E   +I+    + +N   
Sbjct: 180 IILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIY--GDDILNSPN 237

Query: 241 AAELSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNEISEY 300
           A +L   ++L+LE++VNFPYDL+  +N    +GN L  + P+  P G+G+ F KN++S Y
Sbjct: 238 AKKLINARDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLSSY 297

Query: 301 SSRASYEDLLLSLPWPPDGGRTR-AGPGSLSSSIESITKQGEQLIRRRPNDTSDLIGRRQ 359
            +  + ED LLSLPWPPDGGR +  G   +SS IE  + +GE ++R+R  D    + R +
Sbjct: 298 DTCHTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQRTE 357

Query: 360 WQNDWGENLEDFGVDVDTEQA 380
           W NDWGENL DFGVDV++E  
Sbjct: 358 WYNDWGENLSDFGVDVESETV 378

>KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC- CRD protein
          Length = 377

 Score =  399 bits (1026), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 193/382 (50%), Positives = 254/382 (66%), Gaps = 9/382 (2%)

Query: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60
           M +KLK  WLG+AIP  LV+ IGY  H+FILSNFLS ++Q+++Q    +IW+SYY AIYT
Sbjct: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60

Query: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120
           NPG P  +F+    EW NYCKKC+ YKPERAHHCKTCNQCVL MDHHCPWT+NCVGH+NF
Sbjct: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120

Query: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVXXX 180
           PHF+RFL WVI +TA+LL+ L+ RI +LW  R+   +    SE++F+ I+TP+DAFV   
Sbjct: 121 PHFMRFLFWVIFSTAYLLFLLIGRIYLLWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT 180

Query: 181 XXXXXXXXXANQIFNGMSQIETWELERLQALFDSKRL----VPLLIEAAWDIFPGTREQI 236
                     NQ  +GM+QIE+WE++R+Q+L    RL    +  L+E   +I P  + +I
Sbjct: 181 VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAKQHEI 240

Query: 237 NESTAAELSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNE 296
           N     +L   + +  ED  NFPYD++PW+N    +G   LWLWP+ +P   G SF KNE
Sbjct: 241 N-----KLLSKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNE 295

Query: 297 ISEYSSRASYEDLLLSLPWPPDGGRTRAGPGSLSSSIESITKQGEQLIRRRPNDTSDLIG 356
           +  Y   +S ED+L+SLPWPPDG    +      SSIE+I   GEQ+IR +  D  D +G
Sbjct: 296 LFFYDPNSSIEDMLMSLPWPPDGLTHHSRALGSGSSIETIVSGGEQVIRDKSVDLRDRLG 355

Query: 357 RRQWQNDWGENLEDFGVDVDTE 378
           R  W NDWGE+L DFGVD + E
Sbjct: 356 RNSWYNDWGEDLSDFGVDTELE 377

>ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL003C
          Length = 375

 Score =  389 bits (1000), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 189/378 (50%), Positives = 244/378 (64%), Gaps = 3/378 (0%)

Query: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60
           M V +KWPWLG+AIPC L+SF GY  HFF+L+NFLS  + LWFQ +L++IW+SY+ AIY 
Sbjct: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60

Query: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120
           NPGRP   F   +YEW+NYC KC+ YKPER HHCK CNQCVL+MDHHCPWTMNC+G    
Sbjct: 61  NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL 120

Query: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVXXX 180
                   W+I  T  LL+  V RI   W +R     +  + EL+FLTILTPLDAF+   
Sbjct: 121 APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT 180

Query: 181 XXXXXXXXXANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINEST 240
                     NQI NG +QIE WE++R++ LF  +RL+P L+    +I+PG+ E   E  
Sbjct: 181 ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEG-QEKE 239

Query: 241 AAELSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNEISEY 300
             E   +     ++V+NFPYD++PW N    +G+PL WL PFG PK DGM F KNEIS+Y
Sbjct: 240 VEEFLSSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISDY 299

Query: 301 SSRASYEDLLLSLPWPPDGGRTRAGPGSLSSSIESITKQGEQLIRRRPNDTSDLIGRRQW 360
               S +D LL+LPWPPD  R      S+ S +E  T+ GEQ++RRR    + +  R +W
Sbjct: 300 DEATSIQDKLLALPWPPDDTRHGIAFPSV-SHVEKDTQGGEQVVRRRHVPIA-VPPRNEW 357

Query: 361 QNDWGENLEDFGVDVDTE 378
            NDWGE+LE FGVDV+ E
Sbjct: 358 YNDWGESLEHFGVDVEVE 375

>KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {ON}
           Anc_6.28 YOL003C
          Length = 386

 Score =  376 bits (966), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 191/386 (49%), Positives = 249/386 (64%), Gaps = 16/386 (4%)

Query: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60
           MPV+LK PW GIAIPC L+ FIGY  H+FIL N LS  +Q+ FQ  L +IW+SYY AIYT
Sbjct: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60

Query: 61  NPGRPRPNFEVPKY---EWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGH 117
           NPG+P P+    ++   +   YC KC  +KPER+HHCKTC QCVLMMDHHCPWTMNC+G 
Sbjct: 61  NPGKP-PHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGF 119

Query: 118 NNFPHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLP----DYMFHRSELVFLTILTPL 173
            NFP F+RFL+WVI+ T+ L + L+ RI  +W+ RN+P           ELV L +LTP+
Sbjct: 120 GNFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPM 179

Query: 174 DAFVXXXXXXXXXXXXANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTR 233
           D FV             NQ+  GM+QIE+WE+ERLQ +F SK+L+P++IE  W+ FP  +
Sbjct: 180 DLFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQ 239

Query: 234 EQINESTAAE-LSMNKE--LRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGM 290
              +E  A + L MN++  L+   VVNFPYD+D  +N  Q LG+P+L LWPF   +G+G+
Sbjct: 240 TPEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGV 299

Query: 291 SFVKNEISEYSSRASYEDLLLSLPWPPDGGRTRAGPGSLSSS--IESITKQGEQLIRRRP 348
           +F KN+IS Y    S  DLLL L WPPDGGR    P     +  I+   + GE +IR+R 
Sbjct: 300 TFQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKR- 358

Query: 349 NDTSDLIGRRQWQNDWGENLEDFGVD 374
              S +  R  W+N WGE LE FGVD
Sbjct: 359 --NSPIESRTTWENQWGETLEGFGVD 382

>KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa]
           {ON} Anc_6.28 YOL003C
          Length = 396

 Score =  359 bits (922), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 190/399 (47%), Positives = 248/399 (62%), Gaps = 24/399 (6%)

Query: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60
           M ++LKWPWLGIAIP  L+SFIGY  H+FIL + LS   QLWFQ +L++IWLSYY AI  
Sbjct: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60

Query: 61  NPGRPR---PNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGH 117
           +PG P     N ++     + YCKKC  YKP RAHHCKTCN+C+LMMDHHCPWTMNCVG 
Sbjct: 61  DPGSPSIADKNEDIKTI--RTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGF 118

Query: 118 NNFPHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFV 177
            N+PHFLRFL WVIV TAFLL QL  RI  +W +      +  R E+V LTILTP+DAF+
Sbjct: 119 KNYPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFI 178

Query: 178 XXXXXXXXXXXXANQIFNGMSQIETWELERLQALFDSKR-----LVPLLIEAAWDIFP-G 231
                        NQIF+GMSQIE WE+ERL++ F S++      + +LI   + IF   
Sbjct: 179 LLTITLLLIRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFSIE 238

Query: 232 TREQINESTAAELSMNKELRL--EDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDG 289
           + E   E     L  + + RL    ++NFPYD+D  +NA  +LG    WL PFG P+GDG
Sbjct: 239 SPEDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEGDG 298

Query: 290 MSFVKNEISEYSSRASYEDLLLSLPWPPDGGRTRAGPG--SLSSSIESITKQGEQLIRRR 347
           M F  NEI+   + ++  DLLLSLPWPPD   ++ G      +  +E+  + GE ++R R
Sbjct: 299 MHFELNEIASEKA-STLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLRNR 357

Query: 348 --------PNDTSDLIGRRQWQNDWGENLEDFGVDVDTE 378
                   P    + + R+ W N+WGENL+ FGVD++ E
Sbjct: 358 TVSPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396

>TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28
           YOL003C
          Length = 377

 Score =  196 bits (497), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 129/413 (31%), Positives = 201/413 (48%), Gaps = 74/413 (17%)

Query: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60
           M ++   PW G+AIP  ++  +    +F IL + L+ ++ +W+     +I  SYY AI T
Sbjct: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60

Query: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPE----------------RAHHCKTCNQCVLMM 104
            P  P P+        +++     N + +                RAHHCKTCN CV+MM
Sbjct: 61  -PPTPAPSTLT-----QSFISDVMNNENDIFPTTTCKKCKKIKLPRAHHCKTCNTCVVMM 114

Query: 105 DHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFH--RS 162
           DHHCPWTMNCVG+ N+PHF+RFL WVI++T  LL QL+ +   L+  RN P +++   + 
Sbjct: 115 DHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKY 174

Query: 163 ELVFLTILTPLDAFVXXXXXXXXXXXXANQIFNGMSQIETWELERLQALF----DSKRLV 218
           +++ LT+L P   FV             NQI+NGM+QIE W+ E ++  +     SK  +
Sbjct: 175 KIIILTLLIPGTIFVWLTVLLLLLKTLQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVAL 234

Query: 219 PLLIEAAWDIFPGTREQINESTAAELSMNK-------ELRLEDVVNFPYDLDPWSNAEQL 271
            L +      F   +   +  T  +  ++              ++NFPYDL   +N    
Sbjct: 235 QLQLLENLLNFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITTT 294

Query: 272 LG--NPLLWLWPFGRPKGDGMSFVKNEISEYS------SRASYEDLLLSLPWPPDGGRTR 323
           +G  NPL W  P+  P    ++   N+I+E++      +  + +D+LL LPWP       
Sbjct: 295 MGSLNPLSWFNPWYTP----LTASYNKINEFAIWDDNETHDNIKDMLLCLPWP------- 343

Query: 324 AGPGSLSSSIESITKQGEQLIRRRPNDTSDLIGRRQWQNDWGENLEDFGVDVD 376
                L+ S  S  + GE +++                ND+GE L+DFGVD D
Sbjct: 344 -----LNYSNNSTFQDGELVVK---------------SNDYGETLQDFGVDYD 376

>NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12
          Length = 335

 Score = 85.9 bits (211), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 66/133 (49%), Gaps = 5/133 (3%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLY 139
           C+ CQ +KP+R HHC TCN+C+L MDHHCPW   C+G  N   F++FL++  +  AF+  
Sbjct: 109 CQTCQVWKPDRCHHCSTCNKCILKMDHHCPWFAECIGFKNQKFFIQFLIYCTIY-AFVAL 167

Query: 140 QLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVXXXXXXXXXXXXANQIFNGMSQ 199
            L+S   V W      +YM     + F  ++  L AFV              Q+    + 
Sbjct: 168 GLISYQFVNWYKNQ--NYM--NEYIDFTLLIVGLLAFVISISVLAFSSFSIYQVLKNRTT 223

Query: 200 IETWELERLQALF 212
           IE + + R    F
Sbjct: 224 IEMYGIRRYNRDF 236

>TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 83/176 (47%), Gaps = 18/176 (10%)

Query: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120
           N GRPR             C+ C  +KP+R+HHC TCN+CVL MDHHCPW   C+G  N 
Sbjct: 103 NNGRPR------------VCRTCNVWKPDRSHHCSTCNRCVLKMDHHCPWFSECIGFKNQ 150

Query: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVXXX 180
             F++FL++     A+++  L S+ +  W D    +  F    L+FL IL    A V   
Sbjct: 151 KFFIQFLIYN-TTYAYVIAILTSKQMYNWFDDGSYENEFVNMYLLFLWIL----ALVVSL 205

Query: 181 XXXXXXXXXANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFP-GTREQ 235
                       + N  + IE + + + +   +     P  + +  +IF  G++++
Sbjct: 206 ALSCFAGFSVYMVMNNKTTIEMYAMRKYRDDLELYNRNPNRVPSVENIFDLGSKKE 261

>CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326c
          Length = 332

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 31/59 (52%), Positives = 41/59 (69%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLL 138
           CK C ++KP+R HHC TCN CVL MDHHCPW   CVG+ N   F++FL++  V +  +L
Sbjct: 106 CKSCSSWKPDRCHHCSTCNVCVLKMDHHCPWFAGCVGYRNQKFFIQFLIYCTVYSILVL 164

>NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON}
           Anc_3.12
          Length = 327

 Score = 80.1 bits (196), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 89/189 (47%), Gaps = 22/189 (11%)

Query: 66  RPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLR 125
           + +F + K      C+ CQ +KP+R HHC TC++C+L MDHHCPW   C+G  N  +F++
Sbjct: 87  KRSFTLKKDGRYRLCQTCQVWKPDRCHHCSTCDKCILKMDHHCPWFAECIGFENQKYFVQ 146

Query: 126 FLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTP-LDAFVXXXXXXX 184
           FL++    +  +L+     +   +  +   D      EL+ L +LT  + A V       
Sbjct: 147 FLIYCTAYSIVVLFFTSCELHYWFSGKQYED------ELIDLMLLTVWILAIVITVSLIF 200

Query: 185 XXXXXANQIFNGMSQIETW-------ELERLQALFDSKRLVPLLIEAAWDIFPGTREQIN 237
                  Q+    + IE +       +LE L+ L D++      ++  +D+  G+R +  
Sbjct: 201 FSSFSIYQLLKNQTTIEMYGMKREKRDLELLRGLEDAE------VDNIFDL--GSRRRNW 252

Query: 238 ESTAAELSM 246
           ES   E  M
Sbjct: 253 ESVMGESYM 261

>SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 352

 Score = 80.1 bits (196), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 38/93 (40%), Positives = 52/93 (55%), Gaps = 8/93 (8%)

Query: 55  YYAIYTNP-GRPR-PNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTM 112
           YY + T P G P   N EV       YC  C+ ++P RA HC TC  C++  DHHC W  
Sbjct: 151 YYNMITLPTGNPLIANIEV------KYCTTCRIWRPPRASHCSTCEACIITHDHHCKWVN 204

Query: 113 NCVGHNNFPHFLRFLVWVIVATAFLLYQLVSRI 145
           NC+G  N+ +F  FLV  ++ATAF++     R+
Sbjct: 205 NCIGQRNYHYFFTFLVSCVIATAFIIANCAIRV 237

>Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL326C
           - Hypothetical ORF [contig 124] FULL
          Length = 360

 Score = 78.2 bits (191), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 47/71 (66%), Gaps = 1/71 (1%)

Query: 79  YCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLL 138
           +C+ C  +KP+R HHC  CN+C L MDHHCPW  +CVG+ N  +F+ FL++   A + L+
Sbjct: 132 FCRTCVVWKPDRCHHCSGCNKCYLKMDHHCPWFASCVGYRNQKYFIHFLLYT-TAYSILV 190

Query: 139 YQLVSRIIVLW 149
           + L    +++W
Sbjct: 191 FFLTGADLLMW 201

>KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {ON}
           weakly similar to uniprot|P42836 Saccharomyces
           cerevisiae YNL326C PFA3 Palmitoyltransferase for Vac8p
           one of three yeast DHHC-cysteine rich domain proteins
           (Pfa3p Erf2p Akr1p) with palmitoyltransferase activity
           required for vacuolar integrity under stress conditions
          Length = 325

 Score = 77.8 bits (190), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 56/93 (60%), Gaps = 6/93 (6%)

Query: 79  YCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLL 138
           +C+ C+ +KP+R HHC  CN+C L MDHHCPW  +CVG  N   F++FL +  V + ++L
Sbjct: 104 FCQTCEIWKPDRCHHCSKCNKCFLKMDHHCPWFASCVGFRNQKFFVQFLAYTTVYSLYVL 163

Query: 139 YQLVSRIIVLWRDRNLPDYMFHRSELVFLTILT 171
               +++   +R       M ++SEL+ L +L 
Sbjct: 164 LMTSAQLYSWFRQ------MKYKSELLDLHLLV 190

>KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 77.0 bits (188), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 64/131 (48%), Gaps = 5/131 (3%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLY 139
           C+ C  +KP+R HHC +CN+C+L MDHHCPW   C+G  N  +F++FL +    +  +L+
Sbjct: 106 CQTCMFWKPDRCHHCSSCNRCILKMDHHCPWFAECIGFKNQKYFIQFLFYCTSYSIIVLF 165

Query: 140 QLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVXXXXXXXXXXXXANQIFNGMSQ 199
            + S  I  W      +Y F   +L+ + +L    A V              Q+    + 
Sbjct: 166 -VTSIQIYHWFRSTSYEYEFIDFKLLTVWLL----AIVIFISLVLFTGFSVFQLLGNQTT 220

Query: 200 IETWELERLQA 210
           IE +   R +A
Sbjct: 221 IELYAYRRYKA 231

>KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 342

 Score = 77.0 bits (188), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 47/71 (66%), Gaps = 1/71 (1%)

Query: 79  YCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLL 138
           +C+ C  +KP+R HHC  C +C L MDHHCPW  +CVG+ N  +F++FL++  V  + L+
Sbjct: 105 FCRVCAVWKPDRCHHCSACKKCFLKMDHHCPWFASCVGYANQKYFVQFLIYGTVF-SILI 163

Query: 139 YQLVSRIIVLW 149
           + L    ++LW
Sbjct: 164 FLLSGTELLLW 174

>Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON}
           similar to Ashbya gossypii ADL197C
          Length = 339

 Score = 76.6 bits (187), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 48/75 (64%)

Query: 79  YCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLL 138
           YC  C  +KP+R+HHC +CN+C L  DHHCPW  +C+G NN   F++FL++  + +  + 
Sbjct: 109 YCATCGVWKPDRSHHCSSCNKCYLKRDHHCPWFSSCIGFNNQKFFVQFLMYSTLYSISIF 168

Query: 139 YQLVSRIIVLWRDRN 153
                +I+  +R++N
Sbjct: 169 IAATLQIVSWFRNQN 183

>SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 333

 Score = 76.6 bits (187), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 33/92 (35%), Positives = 58/92 (63%), Gaps = 6/92 (6%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLY 139
           C+ C+ +KP+R+HHC +CN+C L MDHHCPW  +C+G  N   F++FL++    T + ++
Sbjct: 105 CRNCKVWKPDRSHHCSSCNKCFLKMDHHCPWFASCIGFKNQKLFIQFLLY---TTWYAVF 161

Query: 140 QLVSRIIVLWRDRNLPDYMFHRSELVFLTILT 171
             ++  + LW+     D   +  EL+ L+++T
Sbjct: 162 VFMTTGLQLWK---WLDNKMYEKELIDLSLMT 190

>KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.12
           YNL326C
          Length = 328

 Score = 76.3 bits (186), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 47/71 (66%), Gaps = 3/71 (4%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLY 139
           C+ C+ +KP+R HHC +C++C+L MDHHCPW   CVG  N   F++FL++    TA+ ++
Sbjct: 103 CQSCRYWKPDRCHHCSSCDRCILKMDHHCPWIAGCVGFRNQKLFIQFLLY---TTAYAIF 159

Query: 140 QLVSRIIVLWR 150
            L    + L+R
Sbjct: 160 VLSMTSVQLYR 170

>ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {ON}
           similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 366

 Score = 76.6 bits (187), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 53/102 (51%), Gaps = 3/102 (2%)

Query: 55  YYAIYTNPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNC 114
           YY+  + P       ++       YC  C+ ++P RA HC TC  C+L  DHHC W  NC
Sbjct: 156 YYSTISLPAPQTIRGDIQAKIELKYCTSCRIWRPPRASHCSTCEACILTHDHHCIWVNNC 215

Query: 115 VGHNNFPHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPD 156
           +G  N+ +F+ FL   I+++ FL+       I ++  RNLP 
Sbjct: 216 IGQRNYRYFILFLASAILSSIFLIANCS---IHIYHHRNLPS 254

>TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON}
           Anc_3.12 YNL326C
          Length = 329

 Score = 76.3 bits (186), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 53/90 (58%), Gaps = 3/90 (3%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLY 139
           C+ C  +KP+R HHC  CN+C+L MDHHCPW  +CVG  N  +F++FL++   AT +   
Sbjct: 108 CRTCHVWKPDRCHHCSACNRCILRMDHHCPWLPDCVGFRNQKYFIQFLMY---ATLYAFN 164

Query: 140 QLVSRIIVLWRDRNLPDYMFHRSELVFLTI 169
            L+   I L+   +  DY     +LV  ++
Sbjct: 165 VLIFDTIQLYIWFHQGDYERQLIDLVLFSV 194

>Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON}
           (48992..49972) [981 nt, 327 aa]
          Length = 326

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 52/92 (56%), Gaps = 1/92 (1%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLY 139
           C+ C  +KP+R HHC  C++C+L MDHHCPW   CVG  N  +F++FL++  V  A L+ 
Sbjct: 106 CRTCNVWKPDRCHHCSACDKCILKMDHHCPWFAECVGFKNQKYFVQFLIYTTVY-AILVM 164

Query: 140 QLVSRIIVLWRDRNLPDYMFHRSELVFLTILT 171
              S  I  W    L +    +  L+ + IL+
Sbjct: 165 TYTSFQIYDWFKNELYETEIIKIRLLMVWILS 196

>Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 40/60 (66%)

Query: 79  YCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLL 138
           YC+ C+ ++P R  HC TCN CV++ DHHC W  NCVG  N+  FL FL+  I ++ FLL
Sbjct: 174 YCQSCRIWRPPRTSHCSTCNVCVMVHDHHCVWVNNCVGKRNYRFFLIFLLSAIFSSVFLL 233

>TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}
           Anc_3.12 YNL326C
          Length = 345

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 39/58 (67%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFL 137
           C+ C  +KP+R HHC +C++C+L MDHHCPW   C+G  N  +F+ FL++  +   F+
Sbjct: 106 CRTCLVWKPDRCHHCSSCDRCILKMDHHCPWFAECIGFKNHKYFINFLIYNSLYATFV 163

>TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {ON}
           Anc_8.389 YLR246W
          Length = 359

 Score = 74.3 bits (181), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 39/60 (65%)

Query: 79  YCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLL 138
           YC  C+ ++P RA HC TC  CV+  DHHC W  NCVG  N+ +F+ FL+  ++A  FL+
Sbjct: 180 YCTSCRIWRPPRASHCSTCGVCVMTHDHHCIWVNNCVGQRNYRYFIIFLIGTVLAELFLI 239

>NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON} 
          Length = 329

 Score = 73.9 bits (180), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 46/75 (61%), Gaps = 4/75 (5%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLY 139
           C+ CQ+YKP R+ HC  C++CVL+ DHHC W  NCVG  N+ +F  FL   I  T  L Y
Sbjct: 137 CRTCQSYKPARSKHCSICDRCVLVADHHCIWVNNCVGKGNYTYFYMFL---ITNTFSLTY 193

Query: 140 QLVSRIIVLWRDRNL 154
             + R++ ++   N+
Sbjct: 194 AFI-RLLTIFYTTNV 207

>Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 73.9 bits (180), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 49/91 (53%), Gaps = 4/91 (4%)

Query: 55  YYAIYTNPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNC 114
           YY + T P  P  + ++       YC  C+ ++P R+ HC TCN CV++ DHHC W  NC
Sbjct: 154 YYNLITLPTHPSVHNDITI----KYCTSCRIWRPPRSSHCSTCNICVMVHDHHCIWVNNC 209

Query: 115 VGHNNFPHFLRFLVWVIVATAFLLYQLVSRI 145
           +G  N+  FL FL+  I ++  LL      I
Sbjct: 210 IGKRNYRFFLIFLLSAIFSSILLLVNCAVHI 240

>NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389
          Length = 374

 Score = 73.9 bits (180), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 49/92 (53%), Gaps = 17/92 (18%)

Query: 63  GRPRPNFEVPKYEWKN----------------YCKKCQNYKPERAHHCKTCNQCVLMMDH 106
           G  + NF++P+ E+ N                YCK C+ ++P R+ HC  C  CVLM DH
Sbjct: 152 GSVQRNFQIPQ-EYYNQITLPTFHTDCNIVLKYCKTCRIWRPPRSSHCSICETCVLMHDH 210

Query: 107 HCPWTMNCVGHNNFPHFLRFLVWVIVATAFLL 138
           HC W  NCVG  N+ +FL FL    + + FL+
Sbjct: 211 HCVWVNNCVGQRNYRYFLTFLTSSTLTSIFLI 242

>Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246W
           (REAL)
          Length = 359

 Score = 73.9 bits (180), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 53/93 (56%), Gaps = 18/93 (19%)

Query: 63  GRPRPNFEVPKYEWKN-----------------YCKKCQNYKPERAHHCKTCNQCVLMMD 105
           G+ R N+++P+ E+ N                 YC+ C+ ++P R+ HC TCN CV++ D
Sbjct: 142 GQLRNNYQIPQ-EYYNLITLPTHSSVSKDITIKYCQSCRIWRPPRSSHCSTCNVCVMVHD 200

Query: 106 HHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLL 138
           HHC W  NC+G  N+  FL FL+  ++++  LL
Sbjct: 201 HHCIWVNNCIGKRNYRFFLVFLLSAVISSIILL 233

>SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 555

 Score = 74.3 bits (181), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 33/92 (35%), Positives = 52/92 (56%), Gaps = 6/92 (6%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLY 139
           C+ C   KP R+ HC  CN+C+LM+DHHC W  NC+G  N+ +F  FL+  +   ++   
Sbjct: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191

Query: 140 QLVSRIIVLWRDRNLPDYMFHRSELVFLTILT 171
           +L S I ++ +  N+         ++ LTILT
Sbjct: 192 RLTS-IQLMSQTENIK-----TKPMLVLTILT 217

>KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.389
           YLR246W
          Length = 361

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 46/78 (58%), Gaps = 2/78 (2%)

Query: 79  YCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLL 138
           YC+ C+ ++P RA HC  C  CV+  DHHC W  NCVG  N+ +F+ FL+   +A+ FLL
Sbjct: 177 YCRTCRIWRPPRASHCSICEACVMTHDHHCIWINNCVGQRNYRYFVTFLISGTLASIFLL 236

Query: 139 YQLVSRIIVLWRDRNLPD 156
                 I +  R R++ D
Sbjct: 237 ANCA--IHLARRRRSISD 252

>YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subunit
           of a palmitoyltransferase, composed of Erf2p and Shr5p,
           that adds a palmitoyl lipid moiety to heterolipidated
           substrates such as Ras1p and Ras2p through a thioester
           linkage; mutants partially mislocalize Ras2p to the
           vacuole
          Length = 359

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 47/84 (55%), Gaps = 4/84 (4%)

Query: 55  YYAIYTNPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNC 114
           YY + T P        + K     YC  C+ ++P R+ HC TCN CV++ DHHC W  NC
Sbjct: 154 YYNLITLPTHS----SISKDITIKYCPSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNC 209

Query: 115 VGHNNFPHFLRFLVWVIVATAFLL 138
           +G  N+  FL FL+  I+++  LL
Sbjct: 210 IGKRNYRFFLIFLLGAILSSVILL 233

>Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W
           (REAL)
          Length = 336

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 49/89 (55%), Gaps = 6/89 (6%)

Query: 60  TNPGRPRPNFEVPKYEWKNY-----CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNC 114
           +N  RP    + P Y++  Y     C  C+  KP R+ HC  CN+C+L+ DHHC W  NC
Sbjct: 112 SNVHRPGSTEKYP-YDYLIYYPDVQCSTCRITKPARSRHCSICNRCILVADHHCIWVNNC 170

Query: 115 VGHNNFPHFLRFLVWVIVATAFLLYQLVS 143
           +G  N+  F  FL+  IV+ ++   +L S
Sbjct: 171 IGKGNYIQFYLFLISNIVSMSYAFLRLCS 199

>KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 358

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 38/68 (55%)

Query: 78  NYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFL 137
            YC  C+ ++P RA HC TC  CVL  DHHC W  NC+G  N+ +FL FL    +AT   
Sbjct: 176 KYCATCRIWRPPRASHCSTCEACVLTHDHHCTWVNNCIGQRNYRYFLTFLASCCLATTLC 235

Query: 138 LYQLVSRI 145
           +     R+
Sbjct: 236 IVGCGIRV 243

>ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 327

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 53/118 (44%), Gaps = 26/118 (22%)

Query: 47  LALIWLSYYYAIYTNPGRPRPNFEVPKYEWK--------------------------NYC 80
           +A+   +YY  I T PG P     +  Y+ +                            C
Sbjct: 48  VAIGLYTYYKVIITGPGSPLDYDTIKVYDMQAVESGAELPPEFLSRRSITTKRDGRFRVC 107

Query: 81  KKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLL 138
           + C  +KP+R HHC  C++C+L MDHHCPW   C+G NN   F+++L++    +  + 
Sbjct: 108 RTCHVWKPDRCHHCSRCDKCILKMDHHCPWFPGCIGFNNQRFFIQYLLYATTYSIVIF 165

>TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.389
           YLR246W
          Length = 404

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 41/66 (62%)

Query: 73  KYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIV 132
           +Y    YC+ C+ ++P R+ HC  C+ CV+ +DHHC W  NCVG  N+ +FL FL   I+
Sbjct: 189 QYVEITYCRTCRIWRPPRSSHCSICDCCVMSLDHHCLWLNNCVGKRNYRYFLIFLTSTIM 248

Query: 133 ATAFLL 138
              FLL
Sbjct: 249 TVIFLL 254

>TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.389
           YLR246W
          Length = 360

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 44/77 (57%)

Query: 79  YCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLL 138
           YC  C  ++P RA HC  C  C+ + DHHC W  NCVG+ N+ +F+ FLV  I+++ F++
Sbjct: 189 YCSTCHIWRPPRASHCSICQACIDVHDHHCIWINNCVGNRNYRYFIIFLVGAILSSIFII 248

Query: 139 YQLVSRIIVLWRDRNLP 155
                 +  + R  N P
Sbjct: 249 INCSIHVARIRRASNAP 265

>ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL326C
          Length = 390

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 45/71 (63%), Gaps = 1/71 (1%)

Query: 79  YCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLL 138
           YC KC+ +KP+R HHC  C++C L  DHHC W   C+G+NN   FL FL++  V  AF +
Sbjct: 170 YCVKCKVWKPDRCHHCSACDKCYLRRDHHCVWFPGCIGYNNHKFFLHFLLYASV-YAFWI 228

Query: 139 YQLVSRIIVLW 149
             + +  +V+W
Sbjct: 229 CIITTWDLVVW 239

>Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON}
           YNL326C (REAL)
          Length = 330

 Score = 70.5 bits (171), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 63/253 (24%), Positives = 99/253 (39%), Gaps = 45/253 (17%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLL- 138
           C+ C  +KP+R HHC +C+ C+L MDHHCPW   C G  N   F++FL++       +L 
Sbjct: 106 CQICHVWKPDRCHHCSSCDMCILKMDHHCPWFAECTGFKNQKLFIQFLMYTTFYAFLVLI 165

Query: 139 ---YQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVXXXXXXXXXXXXANQIFN 195
              Y+L +       ++ L D+      L+ + I   + AF               Q+ N
Sbjct: 166 YSCYELGTWFHSGSFNQELIDFHLLGVALLAIAIFISVLAFTAFSIY---------QVCN 216

Query: 196 GMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINESTAAELSMNKELRLEDV 255
             + IE + + R                     +    E IN++  A      + +LE++
Sbjct: 217 NQTTIELYGMRR---------------------YRRDLEIINDTYGA------DTQLENI 249

Query: 256 VNFPYDLDPWSNAEQLLGNP-LLWLWPFGRPKGDGMSFVKNEISEY-SSRASYEDLLLSL 313
            +    +  W   + L+G   L WL P    K       K+E   Y   R   +D LLS 
Sbjct: 250 FDLGSSIANW---QDLMGMSWLEWLLPIETYKYKRSKHTKDEKGLYFDIRPEAQDRLLSS 306

Query: 314 PWPPDGGRTRAGP 326
               D    R  P
Sbjct: 307 RGLEDRLMRRVTP 319

>Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar to
           Ashbya gossypii AGL125C
          Length = 368

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 39/67 (58%)

Query: 79  YCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLL 138
           YC  C+ ++P RA HC TCN C++  DHHC W  NCVG  N+ +FL F+   ++    L+
Sbjct: 188 YCTTCRIWRPLRASHCSTCNSCIMTFDHHCIWVNNCVGQRNYRYFLTFIYSAVLTIILLV 247

Query: 139 YQLVSRI 145
                R+
Sbjct: 248 INCSVRL 254

>Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}
           YNL326C (REAL)
          Length = 336

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 69/238 (28%), Positives = 97/238 (40%), Gaps = 48/238 (20%)

Query: 15  PCVLVSFIGYCGHFFILSNFLSPSKQL--WFQC-----NLALIWLSYYYAIYTNPGRPR- 66
           P VL S    C +F+ +   L+   Q+  WF        L +   +YY  I T PG P  
Sbjct: 12  PRVLTS----CLYFWTVYTTLTRIHQIPGWFLAVTLIPTLMVALYTYYKVISTGPGSPLD 67

Query: 67  -PNFEV-------------PKYEWKN-----------YCKKCQNYKPERAHHCKTCNQCV 101
            P+  V             P+Y  K             C+ C  +KP+R HHC +C+ C+
Sbjct: 68  FPDLLVHDLKAAENGLELPPEYMSKRCMTLKRDGRFRVCQICHVWKPDRCHHCSSCDICI 127

Query: 102 LMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHR 161
           L MDHHCPW   C G  N   F++FL++     AFL+       +  W +       F R
Sbjct: 128 LKMDHHCPWFAECTGFKNQKFFIQFLMYTTFY-AFLVLIDTCYELGTWFNSG----SFSR 182

Query: 162 SELVFLTIL-TPLDAFVXXXXXXXXXXXXANQIFNGMSQIETWELER----LQALFDS 214
            EL+ L +L T L A                Q+ N  + IE   + R    L+ L DS
Sbjct: 183 -ELIDLHLLGTALLAIAVFISVLAFSAFSIYQVCNNQTTIELHSMRRYRRDLEILNDS 239

>ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {ON}
           similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 330

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 33/49 (67%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLV 128
           C+ CQ  KP R+ HC  CNQCVL +DHHC W  NCVG  N+ +F  FLV
Sbjct: 135 CRTCQLPKPARSKHCNVCNQCVLAVDHHCIWINNCVGLGNYLYFYLFLV 183

>YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}
           PFA3Palmitoyltransferase for Vac8p, required for
           vacuolar membrane fusion; contains an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain;
           autoacylates; required for vacuolar integrity under
           stress conditions
          Length = 336

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 70/163 (42%), Gaps = 32/163 (19%)

Query: 46  NLALIWLSYYYAIYTNPGRPR--PNFEV-------------PKYEWKN-----------Y 79
            LA+   +YY  I   PG P   P+  V             P+Y  K             
Sbjct: 46  TLAVALYTYYKVIARGPGSPLDFPDLLVHDLKAAENGLELPPEYMSKRCLTLKHDGRFRV 105

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLY 139
           C+ C  +KP+R HHC +C+ C+L MDHHCPW   C G  N   F++FL++  +  AFL+ 
Sbjct: 106 CQVCHVWKPDRCHHCSSCDVCILKMDHHCPWFAECTGFRNQKFFIQFLMYTTLY-AFLVL 164

Query: 140 QLVSRIIVLW-----RDRNLPDYMFHRSELVFLTILTPLDAFV 177
                 +  W      +R L D+      L+ + +   + AF 
Sbjct: 165 IYTCYELGTWFNSGSFNRELIDFHLLGVALLAVAVFISVLAFT 207

>KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 67/145 (46%), Gaps = 20/145 (13%)

Query: 78  NYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLV--WVIVATA 135
            +C  C+  KP R+ HC  CN+CVL+ DHHC W  NC+G  N+ +F  FLV   +++  A
Sbjct: 135 TFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYA 194

Query: 136 FLLYQLVSRIIVL--WRDRNLPDYMFHRSELVFLTILTPLDAFVXXXXXXXXXXXXANQI 193
           FL      RII+L  + D   P+        + LT L    AF                +
Sbjct: 195 FL------RIILLTAYSDIGFPN--------IVLTFLILSGAFFAILLVFTYLQFAL--V 238

Query: 194 FNGMSQIETWELERLQALFDSKRLV 218
           ++GM+  E  +   +Q      RL+
Sbjct: 239 YDGMTTNEKDKWFTIQEFMREGRLI 263

>CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {ON}
           similar to uniprot|Q06551 Saccharomyces cerevisiae
           YLR246w ERF2
          Length = 326

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 37/61 (60%)

Query: 78  NYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFL 137
            YC  C+ ++P RA HC  C  CVL  DHHC W  NCVG  N+ +FL FL+   +A A L
Sbjct: 158 KYCHTCKIWRPPRASHCSVCECCVLTHDHHCIWVNNCVGQRNYRYFLAFLLSSTLACALL 217

Query: 138 L 138
           +
Sbjct: 218 I 218

>Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON}
           YNL326C (REAL)
          Length = 334

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 52/103 (50%), Gaps = 6/103 (5%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLY 139
           C+ C  +KP+R HHC +C+ CVL MDHHCPW   C G  N   F++FL++     AFL+ 
Sbjct: 106 CQVCHVWKPDRCHHCSSCDICVLKMDHHCPWFAECTGFKNQKFFIQFLMYT-TCYAFLVL 164

Query: 140 QLVSRIIVLW-----RDRNLPDYMFHRSELVFLTILTPLDAFV 177
                 +  W      +R L D+      L+ + +   + AF 
Sbjct: 165 IYTCYELGTWFNSGSFNRELIDFQLLGVALLAVAVFITVLAFT 207

>TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 40/70 (57%)

Query: 58  IYTNPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGH 117
           +Y+N    +  ++   Y     CK C+  KP R+ HC  C+QC+L+ DHHC W  NC+G 
Sbjct: 115 MYSNDSIKKYAYDRILYFPDTECKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGR 174

Query: 118 NNFPHFLRFL 127
            NF +F  FL
Sbjct: 175 GNFLYFYLFL 184

>KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.389
           YLR246W
          Length = 354

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 45/86 (52%), Gaps = 8/86 (9%)

Query: 55  YYAIYTNPGRPR-PNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMN 113
           YY I T P   R  + EV       YC  C+ ++P RA HC+ C  CV   DHHC W  N
Sbjct: 166 YYNIVTLPTAQRSAHVEV------KYCTACKIWRPPRASHCRICQVCVQTQDHHCAWINN 219

Query: 114 CVGHNNFPHFLRFLVWVIVATAFLLY 139
           CVG  N+ +FL FL     AT  +L+
Sbjct: 220 CVGQRNYRYFLTFLT-ATCATCTVLF 244

>AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR246W
           (ERF2)
          Length = 367

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 67/139 (48%), Gaps = 13/139 (9%)

Query: 7   WPWLGIAIPCVLVSFI--GYCGHFFILSNFLSPSKQLWFQCNLALIWLSY-----YYAIY 59
           W  +  A PCV++ +     C   FI +    P   L    +LA +   Y     YY+I 
Sbjct: 113 WKHVAGAKPCVVLCYYFWTLCFASFISTGATDPGT-LPRNIHLAQLQDDYKLPLEYYSII 171

Query: 60  TNPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNN 119
           T P  P  N  V       YC  C+ ++P RA HC  C+ C+L  DHHC W  NC+G  N
Sbjct: 172 TLPS-PVANAPVRL----KYCTTCRIWRPPRASHCAVCDSCILSFDHHCDWLNNCIGQRN 226

Query: 120 FPHFLRFLVWVIVATAFLL 138
             +FL FL   ++++ +LL
Sbjct: 227 HRYFLAFLFSSVLSSIWLL 245

>Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W
           (ERF2) - Mutation has an Effect on Ras Function [contig
           251] FULL
          Length = 353

 Score = 67.8 bits (164), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (62%)

Query: 78  NYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLV 128
            YC  C+ ++P RA HC  C  C+L  DHHC W  NC+G  N+ +FL FLV
Sbjct: 171 KYCPTCRIWRPPRASHCSVCGACILNHDHHCKWVNNCIGQRNYRYFLTFLV 221

>TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {ON}
           Anc_8.286 YDR126W
          Length = 333

 Score = 67.4 bits (163), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 66/150 (44%), Gaps = 11/150 (7%)

Query: 69  FEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLV 128
           F+   Y   N C  C   KP R+ HC  C  C+L+ DHHC W  NC+G  N+ +F  FL 
Sbjct: 128 FDNIIYHSGNVCSTCNIEKPARSKHCNICGTCILLQDHHCIWVNNCIGLGNYKYFFMFL- 186

Query: 129 WVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVXXXXXXXXXXX 188
             ++ T  L Y  +  + +     ++P        ++ L ILT   + +           
Sbjct: 187 --LLNTISLSYAFLRLLHITLSKPDVPK----SKNILALCILTGSFSVI----CGVFFYL 236

Query: 189 XANQIFNGMSQIETWELERLQALFDSKRLV 218
              Q+ NGM+  ET +   +Q L    +L+
Sbjct: 237 QMKQVNNGMTTNETDKWYAVQELMREGKLI 266

>CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar to
           uniprot|Q04629 Saccharomyces cerevisiae YDR126w
          Length = 330

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (58%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLY 139
           C+ C+  KP R+ HC  CN C+ + DHHC W  NCVG  N+ +F  FL   ++  ++   
Sbjct: 136 CRTCKQVKPARSKHCTVCNSCIYLADHHCVWINNCVGMGNYMYFYSFLCSNLLLLSYSFI 195

Query: 140 QLV 142
           +L+
Sbjct: 196 RLI 198

>NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389
          Length = 389

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 41/85 (48%), Gaps = 6/85 (7%)

Query: 54  YYYAIYTNPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMN 113
           YY  +    G P     +       YC  C+ ++P R+ HC  C  C++  DHHC W  N
Sbjct: 197 YYNEVTLPTGNPESTINI------KYCTTCRIWRPPRSSHCSICEACIITHDHHCIWVNN 250

Query: 114 CVGHNNFPHFLRFLVWVIVATAFLL 138
           C+G  N+  FL FL+     + FL+
Sbjct: 251 CIGQRNYRFFLTFLLSGTFTSIFLI 275

>TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.286
           YDR126W
          Length = 328

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAF 136
           C+ C   KP R+ HC  C +CVL+ DHHC W  NC+G  N+  F  FLV  +++ ++
Sbjct: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSY 194

>YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}
           SWF1Palmitoyltransferase that acts on transmembrane
           proteins, including the SNAREs Snc1p, Syn8p, Tlg1p and
           likely all SNAREs; contains an Asp-His-His-Cys-cysteine
           rich (DHHC-CRD) domain; may have a role in vacuole
           fusion
          Length = 336

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 36/62 (58%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLY 139
           C  C+  KP R+ HC  CN+CVL+ DHHC W  NC+G  N+  F  FL+  I +  +   
Sbjct: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195

Query: 140 QL 141
           +L
Sbjct: 196 RL 197

>KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]
           {ON} similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 355

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 37/60 (61%)

Query: 79  YCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLL 138
           YC+ C+ ++P R+ HC  C+ CVL  DHHC W  NC+G  N+  FL FL+   ++   L+
Sbjct: 173 YCQTCRIWRPPRSAHCSVCDVCVLSHDHHCKWLNNCIGKRNYRFFLEFLMASTISCILLI 232

>KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 349

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 73/177 (41%), Gaps = 23/177 (12%)

Query: 6   KWPWLGIAIPCVLVSFIGYCGHFF-------ILSNFLSPSKQLWFQCNLALIWLSYYYAI 58
           ++ W   AIP   +S   YC   F       I S      + L     L+   ++    I
Sbjct: 47  RFRWKFRAIPAFYLSIYAYCTFLFFKDIEGLIRSRLFGVERLLIIPVALSAPIITGLLTI 106

Query: 59  YTNPGRPRPNFEVPKYEWKNY-----CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMN 113
           +  P     +  +  Y+   +     C+ C+  K  R  HC  C+QCV + DHHC W  N
Sbjct: 107 WIKPKSTYASPMLDAYDELIFHSGVSCRTCKLPKFARTKHCPICDQCVQLADHHCVWANN 166

Query: 114 CVGHNNFPHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTIL 170
           C+G  N+ +F  FL    V+  FL      R++ L R         H  +L+ L+IL
Sbjct: 167 CIGRGNYQYFYLFL----VSNVFLTNYGFLRLLFLQR-------FVHSRQLLILSIL 212

>NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8.286
           YDR126W
          Length = 339

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 36/62 (58%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLY 139
           C+ C   KP R+ HC+ CN C+L+ DHHC W  NC+G  N+ +F  FL+   +   +   
Sbjct: 139 CRTCGIVKPARSKHCEICNSCILLCDHHCLWVNNCIGEGNYLYFYSFLLCNCITMTYSFI 198

Query: 140 QL 141
           +L
Sbjct: 199 RL 200

>Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 35/62 (56%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLY 139
           C  C+  K  R+ HC  CN+CVL+ DHHC W  NC+G  N+  F  FL   I + ++   
Sbjct: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195

Query: 140 QL 141
           +L
Sbjct: 196 RL 197

>Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 30/49 (61%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLV 128
           C  C   KP R+ HC  CN+C+L+ DHHC W  NC+G  N+  F  FL+
Sbjct: 136 CSTCHIIKPARSKHCSICNRCILVADHHCIWVNNCIGKGNYLQFYLFLI 184

>Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON}
           (35544..36509) [966 nt, 322 aa]
          Length = 321

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 31/48 (64%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFL 127
           CK C+  KP R+ HC  C++C+L+ DHHC W  NC+G  N+  F  F+
Sbjct: 135 CKTCRKPKPARSKHCSICDKCILLQDHHCIWVNNCIGMGNYKWFYLFI 182

>KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} similar
           to uniprot|Q04629 Saccharomyces cerevisiae YDR126W SWF1
           Spore Wall Formation
          Length = 324

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 40/71 (56%), Gaps = 4/71 (5%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLY 139
           C+ C+  K  R+ HC  C +C+ + DHHC W  NCVG+ N+ +F  FL    ++   LL 
Sbjct: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFL----LSNCLLLT 184

Query: 140 QLVSRIIVLWR 150
               R++ L+R
Sbjct: 185 YASLRLLTLFR 195

>TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.579
           YDR459C
          Length = 386

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 48/90 (53%), Gaps = 1/90 (1%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLY 139
           C +CQ+ K ER HH      CV   DH+C W    +G +N+  FL+F+ +  +  + +  
Sbjct: 123 CSECQSLKLERTHHSSAMGHCVPRFDHYCVWVGTVIGKDNYLLFLQFVAYYAINLSIIWV 182

Query: 140 QLVSRIIVLWRDR-NLPDYMFHRSELVFLT 168
            +VS I ++ R R N P + F+ + ++ L 
Sbjct: 183 SIVSYIHMIIRKRPNQPHHHFNTNLIIILV 212

>Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii AGR065W
          Length = 340

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 41/80 (51%), Gaps = 6/80 (7%)

Query: 55  YYAIYTNPGR------PRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHC 108
           YY I T+P        P   F+   +     C+ C+  K  R+ HC  C +C+L+ DHHC
Sbjct: 102 YYTIVTSPHDTITYVGPEIPFDGIIFHDNIVCRSCRLKKAARSKHCSICGRCILVADHHC 161

Query: 109 PWTMNCVGHNNFPHFLRFLV 128
            W  NC+G  N+ +F  FL+
Sbjct: 162 VWLNNCIGLGNYQYFYLFLL 181

>Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {ON}
           YDR459C (REAL)
          Length = 378

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 92/212 (43%), Gaps = 32/212 (15%)

Query: 79  YCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLL 138
           +C  CQ+ K ER+HH      C+   DH+C W    +G +N+  F++F  +    ++ LL
Sbjct: 130 WCSPCQSLKMERSHHSSELGHCIPRFDHYCVWIGTIIGRDNYRPFVQFTGYF---SSLLL 186

Query: 139 YQLVSRIIVLWRDRNLPDYMF-HRSEL---VFLTILTPLDAFVXXXXXXXXXXXXANQIF 194
              VS  + +   RN+  +   H S L   VFLT+     AF             +N  +
Sbjct: 187 IMWVSICVFI---RNITQHHHNHNSPLNANVFLTL-----AFAIFGWLFTTSMLASNIFY 238

Query: 195 NGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINESTAAELSMNKELRLED 254
             M Q +T+    L+A+ DSKR            F   +     S A +L    E    +
Sbjct: 239 --MCQNKTY----LEAIMDSKR----------KNFGTRKIFCYYSEANKLRFVVEFERTE 282

Query: 255 VVNFPYDLDPWSNAEQLLG-NPLLWLWPFGRP 285
             +F      ++N +  +G N L+WL PFG+P
Sbjct: 283 FHSFWSKKTIFANIKDFMGPNMLMWLIPFGKP 314

>Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {ON}
           YDR126W (PSL10) - Hypothetical ORF [contig 174] FULL
          Length = 338

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 34/63 (53%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLY 139
           C+ C+  K  R+ HC  C +C  + DHHC W  NC+G  N+ +F  FL   +  T +   
Sbjct: 131 CRTCKMPKYARSKHCAICGRCTQLADHHCVWANNCIGKGNYEYFYLFLASNVFLTVYGFT 190

Query: 140 QLV 142
           +L+
Sbjct: 191 RLL 193

>AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR126W (SWF1)
          Length = 326

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 27/44 (61%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHF 123
           C+ C+  KP R+ HC  C +CV + DHHC W  NCVG  N+  F
Sbjct: 126 CRTCRVRKPARSRHCGVCGRCVPLADHHCVWLNNCVGRGNYGLF 169

>YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}
           PFA5Palmitoyltransferase with autoacylation activity;
           likely functions in pathway(s) outside Ras; member of a
           family of putative palmitoyltransferases containing an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain
          Length = 374

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 93/232 (40%), Gaps = 41/232 (17%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLY 139
           C +CQ+ K ER HH      C+   DH+C W    +G +N+  F++F  +    +  LL 
Sbjct: 131 CSECQSLKMERTHHSSELGHCIPRFDHYCMWIGTVIGRDNYRLFVQFAAYF---STLLLI 187

Query: 140 QLVS-----RIIVLWRDRNLPDYMFH-RSELVFLTILTPLDAFVXXXXXXXXXXXXANQI 193
             VS     RII        P+   +  S LVF  +   L A              A+ I
Sbjct: 188 MWVSICVYIRIITQHNHNYSPNLNANIISTLVFAILGWLLTA-----------SLLASSI 236

Query: 194 FNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINESTAAELSMNKELRLE 253
           F  MSQ +T     L+A+ DSKR            F   +     S A +L    E    
Sbjct: 237 FY-MSQNKT----SLEAIIDSKR----------KKFGTRKIFCYYSEANKLRFVVEFDRS 281

Query: 254 DVVNFPYDLDPWSNAEQLLG-NPLLWLWPFGRP-----KGDGMSFVKNEISE 299
           +  +F       +N +  +G N L+W+ P G+P     K DG S  K  + E
Sbjct: 282 EFHSFWDKKSILANIKDFMGSNILMWIIPLGKPYTSRCKSDGKSGSKTTLVE 333

>KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON}
           Anc_8.286 YDR126W
          Length = 331

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 34/68 (50%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLY 139
           C+ C   K  R+ HC  C +C+ + DHHC W   C+G  NF +F  FL    +   +   
Sbjct: 139 CRSCHTVKWARSKHCSICRRCIQLADHHCIWFNTCIGRGNFFYFYVFLACHCLILTYAFA 198

Query: 140 QLVSRIIV 147
           +L   ++V
Sbjct: 199 RLFFFVVV 206

>NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {ON}
           Anc_5.579 YDR459C
          Length = 374

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 57/254 (22%), Positives = 102/254 (40%), Gaps = 32/254 (12%)

Query: 64  RPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHF 123
           +P   ++  K  +  +C  CQ+ K  R+HH K   +C+L  DH+C W    +  NN+  F
Sbjct: 102 KPPKYYQCDKNGYPPWCTHCQSLKLSRSHHSKQVGRCILRFDHYCAWIGCVIARNNYRLF 161

Query: 124 LRFLVW--VIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVXXXX 181
           L+++ W  +++   +L   +  R I +     +  ++     L  L  +  L  F+    
Sbjct: 162 LQYVGWFNLLLLWYWLTIAVFIRTIGMLNGNVIVGFI-----LSCLGWMMTLGLFISHIY 216

Query: 182 XXXXXXXXANQIFNGMSQIETWELER-----LQALFDSKRLVPLLIEAAWDIFPGTREQI 236
                        N  + IET + ER      + +  +  +    IE     F    +Q 
Sbjct: 217 YMS----------NNKTSIETLDAERGKRKKHKMMVTNDEIEHARIEYNRKYFCYYNQQD 266

Query: 237 NESTAAELSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLL-WLWPFGRPKGDGMSFVKN 295
                 EL+ ++  +     +F      W NA + LG+ ++ WL+P+G    D     K 
Sbjct: 267 KFRYVVELTADEFAKCWKKRSF------WINAREFLGSDIIFWLFPWGSYFPD---LRKR 317

Query: 296 EISEYSSRASYEDL 309
           E S + S     DL
Sbjct: 318 EASSFQSYGQSYDL 331

>ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 365

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 65/143 (45%), Gaps = 15/143 (10%)

Query: 79  YCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLL 138
           +C  CQ+ K ERAHH +    CV   DH C +  + +G +N+  F+++ V++ +  A + 
Sbjct: 126 WCTNCQSLKTERAHHSRELGHCVPKFDHKCTYLGSIIGKDNYRLFVQYCVFMTIWLAIIW 185

Query: 139 YQLVSRIIVLWRDRNLPDYMFHRSE----LVFLTILTPLDAFVXXXXXXXXXXXXANQIF 194
             +V+ I  + R     DY  H S     L+ + ILT L                 N I 
Sbjct: 186 TSIVAYIRSITR-----DYRGHGSHLNGNLIAILILTTL----FWITVTSLLLTQLNCIV 236

Query: 195 NGMSQIETWELERLQALFDSKRL 217
              + IE   +ER +  F ++++
Sbjct: 237 KNKTSIEV--MERRRKAFSTRKM 257

>Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {ON}
           YDR459C (REAL)
          Length = 380

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 86/209 (41%), Gaps = 26/209 (12%)

Query: 79  YCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLL 138
           +C  CQ+ K ER HH      CV   DH+C W    +G +N+  F++F+ +     + LL
Sbjct: 131 WCSPCQSLKTERTHHSSELGHCVPRFDHYCMWAGTVIGRDNYRLFVQFVAYF----SILL 186

Query: 139 YQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVXXXXXXXXXXXXANQIFNGMS 198
             + + I V  ++        H S+   + +   L                 + IF  MS
Sbjct: 187 LIMWASICVYTKEIT----QRHHSQGPRINVNVMLTLAFAILGWLLTTSTLGSAIFY-MS 241

Query: 199 QIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQIN-ESTAAELSMNKELRLEDVVN 257
           Q +T     L+A+ DSKR            F GTR+  +  S + +L    E    +   
Sbjct: 242 QNKT----SLEAIMDSKR----------KKF-GTRKIFSYYSESNKLRFVVEFDRSEFHA 286

Query: 258 FPYDLDPWSNAEQLLG-NPLLWLWPFGRP 285
           F       +N +  +G N L+WL P G+P
Sbjct: 287 FWSKKTILANVKDFMGPNMLMWLIPLGKP 315

>Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa]
           {ON} complement(123368..124456) [1089 nt, 363 aa]
          Length = 362

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 81/206 (39%), Gaps = 29/206 (14%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLY 139
           C  C++ K  R HH K    C+   DHHC W    +G +N+  F +F+ +    +  LL 
Sbjct: 124 CDTCKSLKIGRTHHSKRLGYCIPRFDHHCMWVGTVIGKSNYLLFTQFVFYF---SCLLLI 180

Query: 140 QLVSRIIVLWRDRNLPD--YMFHRSELVFLTILTPLDAFVXXXXXXXXXXXXANQIFNGM 197
             +S +  + R  + P   Y    + +V L +  P                  N+     
Sbjct: 181 FWISIVSYIKRIVDYPHTGYKLDPNLIVILILSVPFSIMTLSLFLSHVYFTFMNR----- 235

Query: 198 SQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINESTAAELSMNKELRLEDVVN 257
           + +E   ++R + L + K+ V  L + +     G R  I            E+  ED+ N
Sbjct: 236 TSLEIINIKRNKKL-NIKKFVCYLDKTS-----GNRYVI------------EMSPEDMAN 277

Query: 258 FPYDLDPWSNAEQLLGNP-LLWLWPF 282
                  W N +++LGN  L W  PF
Sbjct: 278 IWKKRSIWENFKEVLGNNFLFWFIPF 303

>KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.579
           YDR459C
          Length = 370

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 51/232 (21%), Positives = 92/232 (39%), Gaps = 31/232 (13%)

Query: 65  PRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFL 124
           P   ++     +  +C  C+  K  R+HH    N C+   DH+C W    +G +N+  F+
Sbjct: 104 PAKLYQCDSNGYPRWCSNCEGLKSLRSHHSSVANYCIPRFDHYCIWLGTTIGKDNYKQFV 163

Query: 125 RFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVXXXXXXX 184
            FL +  V  +F +  + + +  L   R+  +       LV L IL  +  F        
Sbjct: 164 IFLFYCTV--SFGIMWISAIVCYLKYGRHYQEQNNFDGNLVTLVILGAMGWFF----VAG 217

Query: 185 XXXXXANQIFNGMSQIETWELERLQAL---------FDSKRLVPLLIEAAWDIFPGTREQ 235
                 + +   ++ +E   L   +           F ++R V L   + WD      E 
Sbjct: 218 LLLAHISYMVRNLTSLEVIMLNNNKKFKKKHRKNSEFPTERTVFL---SFWD------ED 268

Query: 236 INESTAAELSMNKELRLEDVVNFPYDLDPWSNAEQLLG-NPLLWLWPFGRPK 286
            NE    E++  + ++  D  ++        N ++ +G NPLLWL+P    K
Sbjct: 269 RNERYIIEVTSTEFIKCFDKKSY------LKNCQEFMGQNPLLWLFPVAAYK 314

>KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {ON}
           Anc_5.579 YDR459C
          Length = 354

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 48/103 (46%), Gaps = 10/103 (9%)

Query: 59  YTNPGRPRPN--FEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVG 116
           +T+P   +P   ++  +  +  +C  CQ+ K  R HH      CV   DH+C W    +G
Sbjct: 103 FTSPQVNKPPLIYQCDENGYPTWCAHCQSVKSLRTHHSGRTGSCVFKFDHYCGWLGTLIG 162

Query: 117 HNNFPHFLRFLVWVIVATAFLLYQLVS-----RIIVLWRDRNL 154
             N+  F++FLV++      LL   +S     R+    RD NL
Sbjct: 163 AGNYLLFIQFLVYM---DCLLLIMWISMSPFIRVYTFRRDGNL 202

>KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa]
           {ON} Anc_5.626 YOR034C
          Length = 752

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 51/110 (46%), Gaps = 13/110 (11%)

Query: 34  FLSPSKQLWFQCNLALIWLSYYYAIYTNPG--RPRPNF-----------EVPKYEWKNYC 80
           F  P   + F   L  + L ++  +Y++PG   P  +F           ++ K++ KN+C
Sbjct: 401 FEEPMLSILFVAVLGCVHLLFFQLVYSDPGVLEPETDFNEIRNKISELLKIGKFDTKNFC 460

Query: 81  KKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWV 130
            +    KP R       ++ VL  DH+CPW  N VG  N   F+ +++ V
Sbjct: 461 IETWQRKPLRCKFSSFHSRLVLRFDHYCPWVYNDVGLLNHKKFMYYVMSV 510

>KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 367

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 7/71 (9%)

Query: 79  YCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLR-------FLVWVI 131
           +C  CQ+ K  R HH  T   C+   DH+C W    VG  N+  F++       F ++VI
Sbjct: 131 WCTACQSIKANRTHHSSTLGYCIPRFDHYCVWIGTVVGRKNYRLFVQFAFYFWAFAIFVI 190

Query: 132 VATAFLLYQLV 142
           V+TA  L +++
Sbjct: 191 VSTASFLPKII 201

>TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {ON}
           Anc_5.579 YDR459C
          Length = 365

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 36/67 (53%)

Query: 79  YCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLL 138
           +C  C + K ERAHH      CV   DH C W    +G +N+  F++F++++ + + F+ 
Sbjct: 126 WCSACDSVKTERAHHSSDMEYCVPRFDHKCAWLGAVIGRDNYRFFIQFVMYMAILSLFVF 185

Query: 139 YQLVSRI 145
             + + I
Sbjct: 186 VPICAFI 192

>Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459C -
           Hypothetical ORF [contig 196] FULL
          Length = 356

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLY 139
           C  CQ+ K  R HH  T   C+   DH+C W    VG  N+  F++F  +  + T +++ 
Sbjct: 125 CTACQSLKSNRTHHSSTLGYCIPRFDHYCVWIGTIVGRKNYRLFVQFAFYFWLFTIYMIA 184

Query: 140 QLVSRIIVLWRDRN 153
            + S +  + + R+
Sbjct: 185 SIASFLRRIIKSRS 198

>NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {ON}
           Anc_5.579 YDR459C
          Length = 406

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVW 129
           C  CQ+ K ER HH +    C+   DH+C W    +G NN+  F++++ +
Sbjct: 117 CTYCQSLKLERVHHSRQLGYCIFRFDHYCAWIGTVIGRNNYRLFIQYVFY 166

>Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}
           similar to Ashbya gossypii ABR203W
          Length = 372

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 49/103 (47%), Gaps = 7/103 (6%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVW--VIVATAFL 137
           C  CQ+ K ER+HH +    CV   DH+C W    +G  N+  F++++++  + + TA L
Sbjct: 127 CSTCQSLKIERSHHSELLKYCVPRFDHYCVWLGTVIGRKNYKLFMQYVMYFTIYLVTASL 186

Query: 138 LYQLVSRIIVLWRDR-----NLPDYMFHRSELVFLTILTPLDA 175
              L  + IV +        NL   +     L F   +TPL A
Sbjct: 187 TIALFMKRIVDYNKEHDLTLNLNIIVLFILVLAFAFFVTPLFA 229

>SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 364

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 43/94 (45%), Gaps = 6/94 (6%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLY 139
           C  CQ+ K ER HH  T   CV   DH+C W    VG  N+  F++F ++      F  Y
Sbjct: 127 CSMCQSLKMERTHHSATLGYCVPRFDHYCVWIGTVVGRKNYRLFIQFSMY------FFFY 180

Query: 140 QLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPL 173
            ++  I V    +++  +  H S  V   IL  L
Sbjct: 181 FVIVLIPVCKYLKDIIHHNRHTSPPVNPNILVLL 214

>TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626
           YOR034C
          Length = 759

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 49/113 (43%), Gaps = 13/113 (11%)

Query: 29  FILSNFLSPSKQLWFQCNLALIWLSYYYAIYTNPGRPRPN-------------FEVPKYE 75
           F+ +  L P + +     +++I + +   I ++PG                   ++ KY+
Sbjct: 400 FLTTVTLKPFRNMSLLITISIICILFGKLITSDPGNIYEEKDHGLVREMVEELMKLGKYD 459

Query: 76  WKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLV 128
             N+C +    KP R+ +    N  V   DH+CPW  N VG  N   FL F++
Sbjct: 460 TSNFCIETLTRKPLRSRYSYMNNALVSRFDHYCPWVYNDVGLKNHKTFLFFIL 512

>Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 36/73 (49%), Gaps = 1/73 (1%)

Query: 69  FEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLV 128
            E+ K++ KN+C +    KP R+      N  V   DH+CPW  N VG  N   F+ F +
Sbjct: 461 LEIGKFDTKNFCIETWTRKPLRSKFSSLNNAVVARFDHYCPWIFNDVGLKNHKAFI-FFI 519

Query: 129 WVIVATAFLLYQL 141
            ++ +  F  + L
Sbjct: 520 ALMESGIFTFFAL 532

>Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON}
           YDR264C (REAL)
          Length = 763

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%)

Query: 69  FEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLV 128
            E+ K++ KN+C +    KP R+      N  V   DH+CPW  N VG  N   F+ F+ 
Sbjct: 460 LEIGKFDTKNFCIETWARKPLRSRFSSLNNAVVARFDHYCPWIFNDVGLKNHKGFMFFIT 519

>TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {ON}
           Anc_5.626 YOR034C
          Length = 739

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 62/152 (40%), Gaps = 20/152 (13%)

Query: 5   LKWPWL-GIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYTNPG 63
           LK P+L G+    V+   I +C     ++ +  P     F  ++  +   +Y  I +NPG
Sbjct: 379 LKSPFLSGVFFGSVIWVVIVWCCKILPVAFWEEPIWNSIFGVSIIGVIYEFYKLIRSNPG 438

Query: 64  RPRPN-------------FEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPW 110
           R   N              E+ K++ +++C +    KP R+         V   DH+CPW
Sbjct: 439 RKNRNHDMESVRKTIQTLMELGKFDIRHFCLETWVRKPLRSKFSYLNQSVVNRYDHYCPW 498

Query: 111 TMNCVGHNNFPHFLRFL------VWVIVATAF 136
             N +G  N   F+ F+      +W  V   F
Sbjct: 499 VYNDIGLRNHKRFIMFIFFSEVTIWSFVIVCF 530

>NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.626
           YDR264C
          Length = 786

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 39/75 (52%), Gaps = 3/75 (4%)

Query: 69  FEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLV 128
            +V K++ KN+C +    KP R+ +    N  V   DH CPW  N VG  N  +F+ F++
Sbjct: 463 LDVGKFDSKNFCLESWTRKPLRSKYSHLNNALVARFDHFCPWIYNDVGLKNHKNFIGFIL 522

Query: 129 WV---IVATAFLLYQ 140
            V   I+  A L ++
Sbjct: 523 LVEAGIITFASLCFE 537

>TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {ON}
           Anc_5.626 YOR034C
          Length = 750

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 65/160 (40%), Gaps = 16/160 (10%)

Query: 69  FEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLV 128
            +V KY+ +++C +    KP R+         +   DH+CPW  N VG  N   FL F+ 
Sbjct: 451 LKVGKYDTRHFCIESWIRKPLRSRFSSLNGTLIARFDHYCPWIYNDVGLKNHKRFLYFVA 510

Query: 129 WVIVAT---AFLLYQLVSRIIVLWRDRN--LPDYMFHRSELV------FLTILTPLDAFV 177
            + VA    A L  +    +   + D N  L  ++   SEL         T L  L A  
Sbjct: 511 LIEVAVWIFAHLCLEYFDELEDNYDDYNGDLKCFLIGDSELCAGLTYDLFTTLILLWAVF 570

Query: 178 XXXXXXXXXXXXANQIFNGMSQIETWELERLQALFDSKRL 217
                       A QIF G++  E  +L R     D+KR+
Sbjct: 571 QSIWVGCLVFVQAFQIFKGVTNYEYSKLMR-----DNKRI 605

>Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {ON}
           YDR459C (REAL)
          Length = 388

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVW 129
           C  CQ+ K ER HH      CV   DH+C W    +G +N+  F++F+ +
Sbjct: 137 CSPCQSLKMERTHHSSELGHCVPRFDHYCLWVGTVIGRDNYRLFVQFVTY 186

>YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}
           AKR1Palmitoyl transferase involved in protein
           palmitoylation; acts as a negative regulator of
           pheromone response pathway; required for endocytosis of
           pheromone receptors; involved in cell shape control;
           contains ankyrin repeats
          Length = 764

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%)

Query: 69  FEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLV 128
            E+ K++ KN+C +    KP R+      N  V   DH+CPW  N VG  N   F+ F+ 
Sbjct: 461 LEIGKFDTKNFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFIT 520

>Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 31/60 (51%)

Query: 69  FEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLV 128
            ++ K++ K++C +    KP R+ +    N  V   DH+CPW  N VG  N   F+ F+ 
Sbjct: 461 LQIGKFDTKSFCIETWTRKPLRSKYSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFIT 520

>NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa]
           {ON} Anc_5.626
          Length = 757

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 40/91 (43%), Gaps = 1/91 (1%)

Query: 63  GRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPH 122
           G  +   +  K++ KN+C +    KP R+H        V   DH CPW  N +G  N  +
Sbjct: 440 GTIKELLDTGKFDIKNFCLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKN 499

Query: 123 FLRFLVWVIVATAFLLYQLVSRIIVLWRDRN 153
           F+ F++   V   F +  L  +   +  D N
Sbjct: 500 FMWFILLTEVGIWFFI-SLTMKYFDILEDTN 529

>Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}
           complement(77926..80259) [2334 nt, 778 aa]
          Length = 777

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 44/100 (44%), Gaps = 15/100 (15%)

Query: 49  LIWLSYYYA--IYTNPGRPRPNFE-------------VPKYEWKNYCKKCQNYKPERAHH 93
           +I LSY +   + ++PG     F              + K++  N+C +    KP R+ +
Sbjct: 433 IISLSYLFVNLVRSDPGTKPAEFNHDSIRETITNLMLIGKFDTNNFCIESSVRKPLRSRY 492

Query: 94  CKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVA 133
               +  V   DH CPW  N +G  N   F+ F++ +++ 
Sbjct: 493 SYLNSAIVTRFDHFCPWIYNDIGLKNHKLFVLFIILMVIG 532

>KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} similar
           to uniprot|Q03289 Saccharomyces cerevisiae YDR459C
           likely functions in pathway(s) outside Ras
          Length = 349

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 32/66 (48%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLY 139
           C  CQ+ K  R HH      CV   DH+C W    +G  N+  F++F  ++ +    L+ 
Sbjct: 128 CSNCQSLKMSRTHHSTKVGYCVPRFDHYCVWIGTVLGRLNYKLFVQFTFYLDLVVLILMI 187

Query: 140 QLVSRI 145
            + +++
Sbjct: 188 SIATQM 193

>ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR459C
          Length = 359

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 39/85 (45%), Gaps = 6/85 (7%)

Query: 79  YCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLL 138
           +C  CQ+ K  R HH      CV  +DH+C W    +G  N+  F +FL+       FL+
Sbjct: 121 WCSVCQSLKGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYRLFNQFLM------CFLM 174

Query: 139 YQLVSRIIVLWRDRNLPDYMFHRSE 163
           + L+  + V+   R +      R E
Sbjct: 175 HALIIFVSVVSLQRRIASSARMRGE 199

>ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 759

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 29/58 (50%)

Query: 73  KYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWV 130
           K++ KN+C +    KP R+      N  V   DH+CPW  N +G  N   FL  ++ V
Sbjct: 457 KFDSKNFCIETWVKKPLRSRFSSLSNSLVARFDHYCPWVYNDIGLRNHKAFLMCILLV 514

>KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.626
           YOR034C
          Length = 757

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 32/63 (50%)

Query: 71  VPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWV 130
           + K++ +N+C +    KP R+      N  V   DH+CPW  N +G  N   F+ F++ V
Sbjct: 454 IGKFDTRNFCIETWIRKPLRSKFSTFYNSTVSRFDHYCPWVYNDIGLKNHKIFIFFIISV 513

Query: 131 IVA 133
            + 
Sbjct: 514 EIG 516

>KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 734

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 32/65 (49%)

Query: 71  VPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWV 130
           + K++ +++C      KP R+   +     ++  DH CPW  N VG  N   F+ FL+ +
Sbjct: 445 IGKFDTRHFCVDTYKRKPLRSKFSRFNEALIVRFDHFCPWIYNDVGLLNHKQFIYFLLSL 504

Query: 131 IVATA 135
           +   +
Sbjct: 505 VSGVS 509

>Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}
           YOR034C (REAL)
          Length = 730

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 2/69 (2%)

Query: 60  TNPGRPRPN--FEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGH 117
           T P R   N   ++ KY+  N+C +    KP R+ +       V   +H+CPW  N +G 
Sbjct: 409 TTPVRETINQLIQIGKYDRNNFCVETLERKPLRSKYSLFSGALVARFNHYCPWVYNDIGL 468

Query: 118 NNFPHFLRF 126
            N   F+ F
Sbjct: 469 KNHKLFMFF 477

>AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR264C
           (AKR1) and YOR034C (AKR2)
          Length = 724

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 29/58 (50%)

Query: 69  FEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRF 126
             V KY+ K++C       P RA + +  +  +L  DH+CPW  N +G  N   F+ F
Sbjct: 437 LRVGKYDSKHFCIHSWIRLPLRAKYKRFVHSVILRYDHYCPWIYNYIGFRNHKIFIYF 494

>YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON}
           AKR2Ankyrin repeat-containing protein similar to Akr1p;
           member of a family of putative palmitoyltransferases
           containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD)
           domain; possibly involved in constitutive endocytosis of
           Ste3p
          Length = 749

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 31/61 (50%)

Query: 70  EVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVW 129
           ++ K++ +N+C +    KP R+ +       V   DH+CPW  N VG  N   F+ F V 
Sbjct: 438 DLGKFDRENFCVETLERKPLRSKYSFFSGALVARYDHYCPWIYNDVGLKNHKLFVFFAVT 497

Query: 130 V 130
           V
Sbjct: 498 V 498

>CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264c
           ankyrin repeat-containing protein
          Length = 763

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 44/105 (41%), Gaps = 13/105 (12%)

Query: 37  PSKQLWFQCNLALIWLSYYYAIYTNPGRPRPN-------------FEVPKYEWKNYCKKC 83
           P   L F   L  +  S +   +++PG                   +  K++ +++C + 
Sbjct: 400 PLGNLTFCAILCFVCYSLFLLAFSDPGHIGSENDHEKIRETISNLLKEGKFDTRSFCLET 459

Query: 84  QNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLV 128
              KP R+ +    +  +L  DH+CPW  N VG  N   F+ F++
Sbjct: 460 WVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFIL 504

>CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459c
          Length = 352

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 25/53 (47%)

Query: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIV 132
           C  CQ+ K  R  H      CV   DH+C W    +G  N+  F++F+ +  V
Sbjct: 116 CSNCQSLKVGRTKHSSHQGHCVPRFDHYCVWLGAVIGFKNYRLFVQFVFYFAV 168

>SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {ON}
           uniprot|Q875S9 Saccharomyces kluyveri AKR1
           Palmitoyltransferase AKR1
          Length = 737

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 35/87 (40%), Gaps = 1/87 (1%)

Query: 71  VPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWV 130
           V K++ K++C      KP R+         V   DH CPW  N +G  N   FL F +  
Sbjct: 443 VGKFDAKHFCISTWVRKPIRSKFSNFSRALVTRFDHFCPWIYNDIGLRNHKTFL-FFILC 501

Query: 131 IVATAFLLYQLVSRIIVLWRDRNLPDY 157
           +    F+  +L      +  D    DY
Sbjct: 502 LETCIFVFLKLCMEYFDVLEDTFEDDY 528

>Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {ON}
           YOR034C (REAL)
          Length = 744

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 29/61 (47%)

Query: 70  EVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVW 129
           ++ K++ +N+C +    KP R+         V   DH CPW  N +G  N   FL F + 
Sbjct: 435 QLGKFDRENFCVETLERKPLRSKFSPFSGALVARYDHFCPWVYNDIGLKNHKLFLFFALT 494

Query: 130 V 130
           V
Sbjct: 495 V 495

>Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar to
           Ashbya gossypii AER388C
          Length = 739

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 37/76 (48%), Gaps = 1/76 (1%)

Query: 69  FEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLV 128
             + K++ K++C       P R+ +    N  +   DH+CPW  N +G  N   FL F++
Sbjct: 445 LRIGKFDAKHFCIHSWVRIPLRSKYKTARNVLIARYDHYCPWVYNQIGFCNHKIFLFFIM 504

Query: 129 WVIVATAFLLYQLVSR 144
           ++ +   F+  +L  R
Sbjct: 505 FLQIG-VFIFVRLSIR 519

>Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {ON}
           YOR034C (REAL)
          Length = 741

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 29/61 (47%)

Query: 70  EVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVW 129
           ++ K++ +N+C +    K  R+ +       V   DH+CPW  N +G  N    L F + 
Sbjct: 432 QLGKFDKENFCVETLERKSLRSKYSVFSGALVARFDHYCPWIYNDIGLKNHKLSLFFAMT 491

Query: 130 V 130
           V
Sbjct: 492 V 492

>KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.626
           YOR034C
          Length = 682

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 38/94 (40%), Gaps = 13/94 (13%)

Query: 48  ALIWLSYYYAIYTNPG---------RPRPNFE----VPKYEWKNYCKKCQNYKPERAHHC 94
            L+ L Y   I+++PG           R + E    +  +    +C K    KP R    
Sbjct: 360 TLLLLCYGRLIFSDPGCIPEETDTDLIRNDIEKLIKLGSFNCHTFCLKTWIRKPVRCSLS 419

Query: 95  KTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLV 128
           K   Q V   DH+C W  N VG  N   ++ FL+
Sbjct: 420 KLNQQQVARFDHYCAWIYNDVGLKNHKLYIFFLI 453

>KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264C AKR1
           Palmitoyl transferase involved in protein palmitoylation
          Length = 752

 Score = 34.7 bits (78), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 29/62 (46%)

Query: 73  KYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIV 132
           K++ K++C       P R+ + +     +   DH CPW  N +G  N   F  F+V + +
Sbjct: 461 KFDAKHFCVHTWIRIPLRSKYDRDSACLISAFDHFCPWVYNQIGLLNHKLFYMFVVLLEI 520

Query: 133 AT 134
           + 
Sbjct: 521 SV 522

>ACL040C Chr3 complement(293391..294419) [1029 bp, 342 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL175C
           (AIR2) and YIL079C (AIR1)
          Length = 342

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 12/58 (20%)

Query: 74  YEWKNYCKKCQNYKPERAHHCKTC-----NQCVLMMDH---HCPWTMNCVGHNNFPHF 123
           +E +  CK C     +R H  K C     + C LM DH   HCP TM C   N+  H+
Sbjct: 63  HEAEAKCKNCS----QRGHIKKNCPHVICSYCGLMDDHYSQHCPRTMRCSHCNDSGHY 116

>NCAS0G03550 Chr7 complement(664516..665736) [1221 bp, 406 aa] {ON}
           Anc_1.531
          Length = 406

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 37/75 (49%), Gaps = 13/75 (17%)

Query: 215 KRLVPLLIEAAWDIFPGTREQINESTAAELSMNKELRLED-------VVNFPYDLDPWSN 267
           K+L PL+     +IFP   +  +  T  EL +NK+L +ED       + NFP+D D  SN
Sbjct: 158 KQLGPLV-----NIFPVISKS-DSLTPDELKLNKKLIMEDIDRFNLPIYNFPFDEDEISN 211

Query: 268 AEQLLGNPLLWLWPF 282
            +      L  L PF
Sbjct: 212 EDYETNMYLKSLLPF 226

>TBLA0H02250 Chr8 (543632..545305) [1674 bp, 557 aa] {ON} Anc_5.102
           YHR151C
          Length = 557

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 255 VVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPK 286
           ++N P+DL   +N   LL + LLW W F +P 
Sbjct: 335 IINNPFDLSNITNILPLLNSSLLWSWRFNQPS 366

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.139    0.468 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,804,647
Number of extensions: 1780057
Number of successful extensions: 4381
Number of sequences better than 10.0: 129
Number of HSP's gapped: 4355
Number of HSP's successfully gapped: 129
Length of query: 381
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 270
Effective length of database: 40,753,473
Effective search space: 11003437710
Effective search space used: 11003437710
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 67 (30.4 bits)