Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G044006.29ON1490146071470.0
ZYRO0C07524g6.29ON1670117939080.0
YOL004W (SIN3)6.29ON1536128438970.0
KAFR0A051206.29ON1479132338380.0
ACL004W6.29ON1377126437740.0
NCAS0D021306.29ON1434127837570.0
KNAG0F029206.29ON1492133137430.0
Kpol_1037.226.29ON1496116336790.0
CAGL0E02475g6.29ON1493131236120.0
KLTH0C10956g6.29ON1433149735860.0
SAKL0E01540g6.29ON1415112634660.0
Ecym_30336.29ON1474117433710.0
Skud_15.1586.29ON1555102832100.0
Suva_15.1716.29ON1561102631890.0
Smik_15.1666.29ON156699331820.0
TPHA0J004006.29ON151285531610.0
TBLA0E031606.29ON173991431250.0
KLLA0C06182g6.29ON151996330230.0
Kwal_56.224626.29ON1541101830020.0
NDAI0C026606.29ON165787828890.0
CAGL0J11594g6.29ON9373766512e-69
KAFR0B024108.207ON209785910.084
KLTH0F19052g3.36ON18089790.67
KLLA0E12057g8.69ON2148103821.00
Kpol_1025.354.128ON1184114801.5
Skud_5.2938.207ON215989801.7
KNAG0B061704.261ON1283133763.8
KNAG0G017108.207ON214699773.8
Smik_10.3121.466ON77699754.8
NDAI0G048001.466ON80673746.6
TDEL0A005503.36ON181108709.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G04400
         (1490 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6....  2757   0.0  
ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} simil...  1509   0.0  
YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Comp...  1505   0.0  
KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_...  1483   0.0  
ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic h...  1458   0.0  
NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6....  1451   0.0  
KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6....  1446   0.0  
Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON} (46639...  1421   0.0  
CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} simil...  1395   0.0  
KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} simil...  1385   0.0  
SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] ...  1339   0.0  
Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON} ...  1303   0.0  
Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL00...  1241   0.0  
Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL00...  1233   0.0  
Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL00...  1230   0.0  
TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {O...  1222   0.0  
TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6....  1208   0.0  
KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} simil...  1169   0.0  
Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] ...  1160   0.0  
NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {...  1117   0.0  
CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa...   255   2e-69
KAFR0B02410 Chr2 complement(467555..473848) [6294 bp, 2097 aa] {...    40   0.084
KLTH0F19052g Chr6 (1544223..1544765) [543 bp, 180 aa] {ON} simil...    35   0.67 
KLLA0E12057g Chr5 (1068487..1074933) [6447 bp, 2148 aa] {ON} sim...    36   1.00 
Kpol_1025.35 s1025 complement(81457..85011) [3555 bp, 1184 aa] {...    35   1.5  
Skud_5.293 Chr5 complement(467328..473804) [6477 bp, 2159 aa] {O...    35   1.7  
KNAG0B06170 Chr2 complement(1212229..1216080) [3852 bp, 1283 aa]...    34   3.8  
KNAG0G01710 Chr7 complement(375111..381551) [6441 bp, 2146 aa] {...    34   3.8  
Smik_10.312 Chr10 (493175..495505) [2331 bp, 776 aa] {ON} YJR040...    33   4.8  
NDAI0G04800 Chr7 complement(1155030..1157450) [2421 bp, 806 aa] ...    33   6.6  
TDEL0A00550 Chr1 complement(94467..95012) [546 bp, 181 aa] {ON} ...    32   9.7  

>TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6.29
            YOL004W
          Length = 1490

 Score = 2757 bits (7147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1352/1460 (92%), Positives = 1352/1460 (92%)

Query: 31   TTETHNNENGMNQAVETSTVGLTGGKTPEMTKQEIKVESKPHVTLPSISDLSGESAHNGK 90
            TTETHNNENGMNQAVETSTVGLTGGKTPEMTKQEIKVESKPHVTLPSISDLSGESAHNGK
Sbjct: 31   TTETHNNENGMNQAVETSTVGLTGGKTPEMTKQEIKVESKPHVTLPSISDLSGESAHNGK 90

Query: 91   DGLTSSNTPLRLPSVQSTYGSKAPGAGQEVNGTIMESTVNPAPAQGRQNSVGLSFASFDN 150
            DGLTSSNTPLRLPSVQSTYGSKAPGAGQEVNGTIMESTVNPAPAQGRQNSVGLSFASFDN
Sbjct: 91   DGLTSSNTPLRLPSVQSTYGSKAPGAGQEVNGTIMESTVNPAPAQGRQNSVGLSFASFDN 150

Query: 151  PLPPQQQTILSSSHFQVLPPHXXXXXXXXXXXXXXXHDAYYRPLNVKDALSYLEQVKYQF 210
            PLPPQQQTILSSSHFQVLPPH               HDAYYRPLNVKDALSYLEQVKYQF
Sbjct: 151  PLPPQQQTILSSSHFQVLPPHQQQQEQQQQMQQQMQHDAYYRPLNVKDALSYLEQVKYQF 210

Query: 211  NSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPGLIQGFNTFLPQGYRIECSAN 270
            NSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPGLIQGFNTFLPQGYRIECSAN
Sbjct: 211  NSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPGLIQGFNTFLPQGYRIECSAN 270

Query: 271  PDEPIRVTTPMGSSSVAGTIENAVAGFPAQPRIXXXXXXXXXXXXXXPEHVLPGVQVXXX 330
            PDEPIRVTTPMGSSSVAGTIENAVAGFPAQPRI              PEHVLPGVQV   
Sbjct: 271  PDEPIRVTTPMGSSSVAGTIENAVAGFPAQPRIQQLQQLGQQQEQSLPEHVLPGVQVTTS 330

Query: 331  XXXXXXXXXXXXXXXXXXXXXADYQLPLQPAAGQQSQLPSNDQGKKTADVEFSQAINYVN 390
                                 ADYQLPLQPAAGQQSQLPSNDQGKKTADVEFSQAINYVN
Sbjct: 331  ATTTPTLNNQQPQPQPRPQLPADYQLPLQPAAGQQSQLPSNDQGKKTADVEFSQAINYVN 390

Query: 391  KIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAXXXXXXXXXXXXXSSP 450
            KIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNA             SSP
Sbjct: 391  KIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDSSP 450

Query: 451  SANRXXXXXXXXXXXSPAFGLSAYYNETSPPTSRQNLPPLGSFSPPPNGAVPHNYYRDQQ 510
            SANR           SPAFGLSAYYNETSPPTSRQNLPPLGSFSPPPNGAVPHNYYRDQQ
Sbjct: 451  SANRQQQQPGVLQQQSPAFGLSAYYNETSPPTSRQNLPPLGSFSPPPNGAVPHNYYRDQQ 510

Query: 511  PQTLGLPPVAQVENHIDQRSPPHIATQGIAGEPMPVSNLRSQITAQSPSELAXXXXXXXX 570
            PQTLGLPPVAQVENHIDQRSPPHIATQGIAGEPMPVSNLRSQITAQSPSELA        
Sbjct: 511  PQTLGLPPVAQVENHIDQRSPPHIATQGIAGEPMPVSNLRSQITAQSPSELAQLHQQQQI 570

Query: 571  XXXPTANIPDGQYLDIAVRPEIDLDPSIVPVVPEPTAPIEDSLTLVEETSFFDRAKKFIG 630
               PTANIPDGQYLDIAVRPEIDLDPSIVPVVPEPTAPIEDSLTLVEETSFFDRAKKFIG
Sbjct: 571  PSQPTANIPDGQYLDIAVRPEIDLDPSIVPVVPEPTAPIEDSLTLVEETSFFDRAKKFIG 630

Query: 631  NKQIYTEFLKILNLFSQDLLDVDELVGRVEHYLGGNKELFVWFKNFVGFQDKPKHIENIV 690
            NKQIYTEFLKILNLFSQDLLDVDELVGRVEHYLGGNKELFVWFKNFVGFQDKPKHIENIV
Sbjct: 631  NKQIYTEFLKILNLFSQDLLDVDELVGRVEHYLGGNKELFVWFKNFVGFQDKPKHIENIV 690

Query: 691  HEKHRLDLDLCEACGPSYKKLPKSDTFMPCSGRDEMCWAVLNDEWVGHPVWASEDSGFIA 750
            HEKHRLDLDLCEACGPSYKKLPKSDTFMPCSGRDEMCWAVLNDEWVGHPVWASEDSGFIA
Sbjct: 691  HEKHRLDLDLCEACGPSYKKLPKSDTFMPCSGRDEMCWAVLNDEWVGHPVWASEDSGFIA 750

Query: 751  HRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMSEEEKATFKLPPGLGH 810
            HRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMSEEEKATFKLPPGLGH
Sbjct: 751  HRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMSEEEKATFKLPPGLGH 810

Query: 811  TSLTIYKKVIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWR 870
            TSLTIYKKVIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWR
Sbjct: 811  TSLTIYKKVIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWR 870

Query: 871  ELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEIGSIKTDQTNKRMHWLTPKPKDQLDY 930
            ELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEIGSIKTDQTNKRMHWLTPKPKDQLDY
Sbjct: 871  ELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEIGSIKTDQTNKRMHWLTPKPKDQLDY 930

Query: 931  YVPDKSVFFDILSLTDTFINHNSSYSNPDKIRLKDLFKIFVSLFFSIPMYEVNEAVSRRG 990
            YVPDKSVFFDILSLTDTFINHNSSYSNPDKIRLKDLFKIFVSLFFSIPMYEVNEAVSRRG
Sbjct: 931  YVPDKSVFFDILSLTDTFINHNSSYSNPDKIRLKDLFKIFVSLFFSIPMYEVNEAVSRRG 990

Query: 991  NLDDDKEDSTQKMESDNLNNSKRPREDEISLSEVLHRAKNQRFKSRAADXXXXXXXXXXX 1050
            NLDDDKEDSTQKMESDNLNNSKRPREDEISLSEVLHRAKNQRFKSRAAD           
Sbjct: 991  NLDDDKEDSTQKMESDNLNNSKRPREDEISLSEVLHRAKNQRFKSRAADETSEESAAEPE 1050

Query: 1051 XXXXXXXXXIRQEAKKPWLLGNLVEEVNAQGLINNRKTFNMFANTNIYVFFRHLTTLYER 1110
                     IRQEAKKPWLLGNLVEEVNAQGLINNRKTFNMFANTNIYVFFRHLTTLYER
Sbjct: 1051 PELNEEEETIRQEAKKPWLLGNLVEEVNAQGLINNRKTFNMFANTNIYVFFRHLTTLYER 1110

Query: 1111 LEEVKKMNDAVTKEINSRKVVQFAKDLNLISQQLKEMGLDFEGADAYEQLRHLCKRLIEG 1170
            LEEVKKMNDAVTKEINSRKVVQFAKDLNLISQQLKEMGLDFEGADAYEQLRHLCKRLIEG
Sbjct: 1111 LEEVKKMNDAVTKEINSRKVVQFAKDLNLISQQLKEMGLDFEGADAYEQLRHLCKRLIEG 1170

Query: 1171 DIEHQWFEESLRQAYNNKAFKLYTVDKVIQSLVKHAHTILTDSKTSEIMTSFEKDRTQIN 1230
            DIEHQWFEESLRQAYNNKAFKLYTVDKVIQSLVKHAHTILTDSKTSEIMTSFEKDRTQIN
Sbjct: 1171 DIEHQWFEESLRQAYNNKAFKLYTVDKVIQSLVKHAHTILTDSKTSEIMTSFEKDRTQIN 1230

Query: 1231 TSAKDQILYRLQVRSYMSSTENMFRIEYNKQSKNVRIQFIAVDDLTLAEPRSLEEKWRYY 1290
            TSAKDQILYRLQVRSYMSSTENMFRIEYNKQSKNVRIQFIAVDDLTLAEPRSLEEKWRYY
Sbjct: 1231 TSAKDQILYRLQVRSYMSSTENMFRIEYNKQSKNVRIQFIAVDDLTLAEPRSLEEKWRYY 1290

Query: 1291 VTSYSLSHPTEGISQEELQLPFLEKVLETEEDYGSDVDNFSIDKFSPEGVSKSTLKIKID 1350
            VTSYSLSHPTEGISQEELQLPFLEKVLETEEDYGSDVDNFSIDKFSPEGVSKSTLKIKID
Sbjct: 1291 VTSYSLSHPTEGISQEELQLPFLEKVLETEEDYGSDVDNFSIDKFSPEGVSKSTLKIKID 1350

Query: 1351 PETYLLDIEAGSYDVFSRKSVNRFPVIVDSNDYTTKKEKKKNMVIQFLESKKGWKKNLDD 1410
            PETYLLDIEAGSYDVFSRKSVNRFPVIVDSNDYTTKKEKKKNMVIQFLESKKGWKKNLDD
Sbjct: 1351 PETYLLDIEAGSYDVFSRKSVNRFPVIVDSNDYTTKKEKKKNMVIQFLESKKGWKKNLDD 1410

Query: 1411 DQVKAIQEKLARVKENGSLDDFNEASQTQQASEIIAPSKVEQSKESTVADVNSLPKELVE 1470
            DQVKAIQEKLARVKENGSLDDFNEASQTQQASEIIAPSKVEQSKESTVADVNSLPKELVE
Sbjct: 1411 DQVKAIQEKLARVKENGSLDDFNEASQTQQASEIIAPSKVEQSKESTVADVNSLPKELVE 1470

Query: 1471 AEDRGNDTTADEVDPEVVAH 1490
            AEDRGNDTTADEVDPEVVAH
Sbjct: 1471 AEDRGNDTTADEVDPEVVAH 1490

>ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1670

 Score = 1509 bits (3908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 765/1179 (64%), Positives = 894/1179 (75%), Gaps = 57/1179 (4%)

Query: 357  PLQPAAGQQSQLPSNDQGKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQRE 416
            P QP      Q    DQ KK ADVEFSQAI+YVNKIKNRF++QPDIYKHFLEILQTYQRE
Sbjct: 497  PTQPEVPAPVQPQLADQTKKAADVEFSQAISYVNKIKNRFSDQPDIYKHFLEILQTYQRE 556

Query: 417  QKPINEVYAQVTVLFQNAXXXXXXXXX----XXXXSSPSANRXXXXXXXXXXXSPAFGLS 472
            QKPINEVYAQVTVLFQNA                 ++    +           + A G  
Sbjct: 557  QKPINEVYAQVTVLFQNAPDLLDDFKKFLPDSSASAAQQQRQQLQPVMQHQQAAAATGY- 615

Query: 473  AYYNETSPPTSRQNLPPLGSFSPPPNGAVPHNYYRDQQP-QTLGLPPVAQVENHIDQRSP 531
             YY E  P  +RQNLPPLGSFSPPPNG  P +YY  Q+P Q + LPP+  +E    + +P
Sbjct: 616  GYYGENQP-VARQNLPPLGSFSPPPNGTAPRDYY--QEPSQGMALPPMTHLETQAAKVTP 672

Query: 532  PH-IATQGIAGEPMPVSNLRSQIT----AQSPSELA--------------------XXXX 566
             H + TQG++ + +P+SN+RS       AQ+P E A                        
Sbjct: 673  SHYVMTQGMSNDAIPLSNMRSPTVGAPGAQTPVETAPQHPQQYSPQQAPQPQLPQQQLPP 732

Query: 567  XXXXXXXPTANIP-----------DGQYLDIAVRPEIDLDPSIVPVVPEPTAPIEDSLTL 615
                   P   IP           + QY+DIAVRPEIDLDPSIVPVVPEPT PIEDSL+L
Sbjct: 733  QQQEQSLPPQTIPLTQPSQLGPQQEVQYVDIAVRPEIDLDPSIVPVVPEPTEPIEDSLSL 792

Query: 616  VEETSFFDRAKKFIGNKQIYTEFLKILNLFSQDLLDVDELVGRVEHYLGGNKELFVWFKN 675
            VEETSFFD+AKKFIGNKQ+YTEFLKILNL+SQDLLD+D LV +VEHYLGG+KELF WFKN
Sbjct: 793  VEETSFFDKAKKFIGNKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSKELFTWFKN 852

Query: 676  FVGFQDKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKSDTFMPCSGRDEMCWAVLNDEW 735
            FVG+QD+PK+IEN++HEKHRLDLD+CEA GPSYKKLPKSDTFMPCSGRDEMCW VLNDEW
Sbjct: 853  FVGYQDRPKNIENVIHEKHRLDLDMCEASGPSYKKLPKSDTFMPCSGRDEMCWEVLNDEW 912

Query: 736  VGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMS 795
            +GHPVWASEDSGFIAHRKNQYEETLFK+EEERHEYDFYIESNLRTIQTLETIASKIANM+
Sbjct: 913  IGHPVWASEDSGFIAHRKNQYEETLFKVEEERHEYDFYIESNLRTIQTLETIASKIANMT 972

Query: 796  EEEKATFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKD 855
            EEEKA FKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHE+PA+AVPVVLKRLKQKD
Sbjct: 973  EEEKANFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAVAVPVVLKRLKQKD 1032

Query: 856  EEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEIGSIKTDQTNK 915
            EEWRRAQREWNKVWRELEQKVY+KSLDHLGLTFKQADKKLLTTKQLISEI SIK DQTNK
Sbjct: 1033 EEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNK 1092

Query: 916  RMHWLTPKPKDQLDYYVPDKSVFFDILSLTDTFINHNSSYSNPDKIRLKDLFKIFVSLFF 975
            R+HWLTPKPK QLDY  PD+ +F DILSLT+ F+NH  +YSN DK RLKD  K F+SLFF
Sbjct: 1093 RIHWLTPKPKSQLDYDFPDREIFCDILSLTEVFLNHTGNYSNSDKERLKDFLKSFLSLFF 1152

Query: 976  SIPMYEVNEAVSRRGNLDDDKEDSTQKMESDNLNNSKRPREDEISLSEVLHRAKNQRFKS 1035
            SIP+ EVN+ + RR   + ++ ++ +K     L + KRPRE E+ L ++LHR K Q+ K 
Sbjct: 1153 SIPVSEVNDGLRRRSPSNKEEHEANKKENGTALAHGKRPREIELPLRDILHRNKYQKLKL 1212

Query: 1036 RA----ADXXXXXXXXXXXXXXXXXXXXIRQEAKKPWLLGNLVEEVNAQGLINNRKTFNM 1091
            R+                          I+QEAKKPWLLGN+VEE NAQG+I+NRK+FN+
Sbjct: 1213 RSDGEEGSIGQSEEGLDEQEEVDEEEEIIKQEAKKPWLLGNIVEEANAQGIISNRKSFNL 1272

Query: 1092 FANTNIYVFFRHLTTLYERLEEVKKMNDAVTKEINSRKVVQFAKDLNLISQQLKEMGLDF 1151
            FANT+IYVFFRHLTTLYERL EVK ++  VT+EINSRKV QFAKDLNLIS+QLK MGLDF
Sbjct: 1273 FANTSIYVFFRHLTTLYERLIEVKSIDQEVTQEINSRKVSQFAKDLNLISEQLKNMGLDF 1332

Query: 1152 EGADAYEQLRHLCKRLIEGDIEHQWFEESLRQAYNNKAFKLYTVDKVIQSLVKHAHTILT 1211
             G DAYEQL HL KRLIEGDIEHQWFEESLRQAYNN+AFK YTVDKV+Q+LVKHAHTILT
Sbjct: 1333 AGLDAYEQLLHLSKRLIEGDIEHQWFEESLRQAYNNRAFKFYTVDKVVQALVKHAHTILT 1392

Query: 1212 DSKTSEIMTSFEKDRTQINTSAKDQILYRLQVRSYMSSTENMFRIEYNKQSKNVRIQFIA 1271
            D K SEIM  FEKDRT   TSAKDQILYR+Q RS+MS+TENMFRIE+N+ SK+V IQ+IA
Sbjct: 1393 DIKCSEIMVLFEKDRTLATTSAKDQILYRMQARSHMSNTENMFRIEFNRISKHVCIQYIA 1452

Query: 1272 VDDLTLAEPRSLEEKWRYYVTSYSLSHPTEGISQEELQLPFLEKVLETEEDYGSDVDNFS 1331
            +DDLTLAE +SLE+KW+YYVTSYSLSHPTEGIS E+LQ+PFLEK++E+E++Y  D DN  
Sbjct: 1453 IDDLTLAEAKSLEDKWKYYVTSYSLSHPTEGISHEDLQVPFLEKIIESEQEY--DEDNGG 1510

Query: 1332 IDKFSPEGVSKSTLKIKIDPETYLLDIEAGSYDVFSRKSVNRFPVIVDSNDYTTKKEKKK 1391
              KFSPEGVSKS+L+IKIDPETY L++E GS DVFSRK+VN+FP+  +S  + TK +KK 
Sbjct: 1511 DPKFSPEGVSKSSLRIKIDPETYFLEVEPGSCDVFSRKAVNKFPLEKNSESHKTKVDKKN 1570

Query: 1392 NMVIQFLESKKGWKKNLDDDQVKAIQEKLARVKENGSLDDFNEASQTQQASEIIAP--SK 1449
             ++  +L+S+KGWKKNLD   +++++EKL  VK  G+L  +       +++   AP    
Sbjct: 1571 ELIRGYLDSEKGWKKNLDAKSIQSVEEKLNFVKNYGTLQGYRAQENGLESTTKEAPFSDA 1630

Query: 1450 VEQSKESTV-AD--VNSLPKELVEAEDR-GNDTTADEVD 1484
            VE+  +S   AD   N  P      E+R GNDTTA++V+
Sbjct: 1631 VERKADSAAQADGAANGGPSNTAGVEERGGNDTTAEDVE 1669

 Score =  244 bits (622), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 153/312 (49%), Positives = 173/312 (55%), Gaps = 73/312 (23%)

Query: 64  EIKVES--KPHVTLPSISDLSGESAHN--------------------------------- 88
           EIK ES  KPH  LPSISDLSGE+  +                                 
Sbjct: 81  EIKQESGSKPHFVLPSISDLSGETGSSPSHGGSGTTNTTNVNTSGSQNPNATGAGVNSTM 140

Query: 89  --GKDGLTSSNTPLRLPSVQSTYGSKAP-------GAGQEVNG-TIMESTVNPAP----- 133
             G   + S  +  RL SVQ+TY S  P           EV G T + S+ +        
Sbjct: 141 APGVPSMLSQQSLPRLSSVQATYPSAPPVLPRFSTATAGEVQGPTTLTSSSSIPTTQQQQ 200

Query: 134 ------------AQGRQNSVGLSFASFDNPLPPQQQTILSSSHFQVLPPHXXXXXXXXXX 181
                        + R  S G+S ASFDNPLPP Q ++  S H+Q+L             
Sbjct: 201 QQQPPDDKSRIGVKPRSGSAGMSVASFDNPLPPSQPSV-PSLHYQMLSSQQQQEQKGQDQ 259

Query: 182 XXXXX--------HDAYYRPLNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAID 233
                        HD YYRPLNVKDALSYLEQVK+QFNSRPDVYNHFLDIMKDFKSQAID
Sbjct: 260 QQQHQQQQQQIPLHDQYYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAID 319

Query: 234 TPGVIDRVSTLFKGYPGLIQGFNTFLPQGYRIECSANPDEPIRVTTPMGSSSVAGTIE-N 292
           TPGVI+RVSTLF+GYP LIQGFNTFLPQGYRI+CS NPDEPI+VTTPMGSS+VAG  E N
Sbjct: 320 TPGVIERVSTLFRGYPNLIQGFNTFLPQGYRIDCSQNPDEPIKVTTPMGSSTVAGVAEMN 379

Query: 293 AVAGFPA-QPRI 303
             A F   QPRI
Sbjct: 380 QAALFQGQQPRI 391

 Score = 53.1 bits (126), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 40/62 (64%)

Query: 199 ALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPGLIQGFNTF 258
           A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 525 AISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 584

Query: 259 LP 260
           LP
Sbjct: 585 LP 586

 Score = 40.4 bits (93), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 41/66 (62%), Gaps = 2/66 (3%)

Query: 368 LPSNDQGKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQV 427
           +P +DQ  +  +V+   A++Y+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V
Sbjct: 270 IPLHDQYYRPLNVK--DALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERV 327

Query: 428 TVLFQN 433
           + LF+ 
Sbjct: 328 STLFRG 333

>YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Component
            of the Sin3p-Rpd3p histone deacetylase complex, involved
            in transcriptional repression and activation of diverse
            processes, including mating-type switching and meiosis;
            involved in the maintenance of chromosomal integrity
          Length = 1536

 Score = 1505 bits (3897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 774/1284 (60%), Positives = 926/1284 (72%), Gaps = 71/1284 (5%)

Query: 188  DAYYRPLNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKG 247
            DA YRPLNVKDALSYLEQVK+QF+SRPD+YN FLDIMKDFKSQAIDTPGVI+RVSTLF+G
Sbjct: 213  DADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRG 272

Query: 248  YPGLIQGFNTFLPQGYRIECSANPDEPIRVTTPMGSSSVAGTIENAVAGFPAQPRIXXXX 307
            YP LIQGFNTFLPQGYRIECS+NPD+PIRVTTPMG+++V   I  +  G      +    
Sbjct: 273  YPILIQGFNTFLPQGYRIECSSNPDDPIRVTTPMGTTTVNNNISPSGRGTTDAQELGSFP 332

Query: 308  XXXXXXXXXXPEHVLPGVQVXXXXXXXXXXXXXXXXXXXXXXXXADYQLPLQPAAGQ--- 364
                      P +V P V                             Q P  PA  Q   
Sbjct: 333  ESDGNGVQQ-PSNV-PMVPSSVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQ 390

Query: 365  -QSQLPSNDQGKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEV 423
             QS +P  D  KK  DVEFSQAI+YVNKIK RFA+QPDIYKHFLEILQTYQREQKPINEV
Sbjct: 391  SQSLVPQED-AKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEV 449

Query: 424  YAQVTVLFQNAXXXXXXXXXXXXXSSPSANRXXXXXXXXXXXSPA--------------- 468
            YAQVT LFQNA             SS SAN+                             
Sbjct: 450  YAQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQAQAQAQAQA 509

Query: 469  ------------FGLSAYYNETSPPTSR----QNLPPLGSFSPPPNGAVPHNYYRDQQ-- 510
                        +  S YY     P++R    QNLPP+GSFSPP NG+  H  Y+DQQ  
Sbjct: 510  QVEQQKQQQQFLYPASGYYGH---PSNRGIPQQNLPPIGSFSPPTNGSTVHEAYQDQQHM 566

Query: 511  --PQTLGLPPVAQVENHIDQRSPPHIATQGIAGEPMPVSNLRSQITAQSPSELAXXXXXX 568
              P  + LP + Q          P++  QGIA E  P+S+LR+ +T Q            
Sbjct: 567  QPPHFMPLPSIVQ--------HGPNMVHQGIANENPPLSDLRTSLTEQYAPSSIQHQQQH 618

Query: 569  XXXXXPTANIPDGQYLDIAVRPEIDLDPSIVPVVPEPTAPIEDSLTLVEETSFFDRAKKF 628
                 P AN    QY DI VRPEIDLDPSIVPVVPEPT PIE++++L EE +FF++AK++
Sbjct: 619  PQSISPIANT---QYGDIPVRPEIDLDPSIVPVVPEPTEPIENNISLNEEVTFFEKAKRY 675

Query: 629  IGNKQIYTEFLKILNLFSQDLLDVDELVGRVEHYLGGNKELFVWFKNFVGFQDKPKHIEN 688
            IGNK +YTEFLKILNL+SQD+LD+D+LV +V+ YLG NKELF WFKNFVG+Q+K K IEN
Sbjct: 676  IGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFTWFKNFVGYQEKTKCIEN 735

Query: 689  IVHEKHRLDLDLCEACGPSYKKLPKSDTFMPCSGRDEMCWAVLNDEWVGHPVWASEDSGF 748
            IVHEKHRLDLDLCEA GPSYK+LPKSDTFMPCSGRD+MCW VLNDEWVGHPVWASEDSGF
Sbjct: 736  IVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGF 795

Query: 749  IAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMSEEEKATFKLPPGL 808
            IAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQ LETI +KI NM+E EKA FKLPPGL
Sbjct: 796  IAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGL 855

Query: 809  GHTSLTIYKKVIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKV 868
            GHTS+TIYKKVIRKVYDKERGFEIIDALHE+PA+  PVVLKRLKQKDEEWRRAQREWNKV
Sbjct: 856  GHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKV 915

Query: 869  WRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEIGSIKTDQTNKRMHWLTPKPKDQL 928
            WRELEQKV++KSLDHLGLTFKQADKKLLTTKQLISEI SIK DQTNK++HWLTPKPK QL
Sbjct: 916  WRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQL 975

Query: 929  DYYVPDKSVFFDILSLTDTFINHNSSYSNPDKIRLKDLFKIFVSLFFSIPMYEVNEAV-S 987
            D+  PDK++F+DIL L DTFI H ++YSNPDK RLKDL K F+SLFFSI   ++ E++ S
Sbjct: 976  DFDFPDKNIFYDILCLADTFITHTTAYSNPDKERLKDLLKYFISLFFSISFEKIEESLYS 1035

Query: 988  RRGNLDDDKEDSTQKMESDNLNNSKRPREDEISLSEVLHRAKNQRFKSRAADXX----XX 1043
             + N+     +S+   +  ++ + KRP + E+SL ++LHR++ Q+ K R+ D        
Sbjct: 1036 HKQNV----SESSGSDDGSSIASRKRPYQQEMSLLDILHRSRYQKLK-RSNDEDGKVPQL 1090

Query: 1044 XXXXXXXXXXXXXXXXIRQEAKKPWLLGNLVEEVNAQGLINNRKTFNMFANTNIYVFFRH 1103
                            I +EAK PWL GNLVEE N+QG+I NR  FN+FANTNIY+FFRH
Sbjct: 1091 SEPPEEEPNTIEEEELIDEEAKNPWLTGNLVEEANSQGIIQNRSIFNLFANTNIYIFFRH 1150

Query: 1104 LTTLYERLEEVKKMNDAVTKEINSRKVVQFAKDLNLISQQLKEMGLDFEGADAYEQLRHL 1163
             TT+YERL E+K+MN+ VTKEIN+R  V FAKDL+L+S QL EMGLDF G DAY+Q+  L
Sbjct: 1151 WTTIYERLLEIKQMNERVTKEINTRSTVTFAKDLDLLSSQLSEMGLDFVGEDAYKQVLRL 1210

Query: 1164 CKRLIEGDIEHQWFEESLRQAYNNKAFKLYTVDKVIQSLVKHAHTILTDSKTSEIMTSFE 1223
             +RLI GD+EHQWFEESLRQAYNNKAFKLYT+DKV QSLVKHAHT++TD+KT+EIM  F 
Sbjct: 1211 SRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFV 1270

Query: 1224 KDRTQINTSAKDQILYRLQVRSYMSSTENMFRIEYNKQSKNVRIQFIAVDDLTLAEPRSL 1283
            KDR    TSAKDQI+YRLQVRS+MS+TENMFRIE++K++ +V IQ+IA+DDLTL EP++ 
Sbjct: 1271 KDRNASTTSAKDQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKAD 1330

Query: 1284 EEKWRYYVTSYSLSHPTEGISQEELQLPFLEKVLETEEDYGSDVDNFSID-KFSPEGVSK 1342
            E+KW+YYVTSY+L HPTEGI  E+L++PFLE+++E    +G D+D   +D +FSPEG+S 
Sbjct: 1331 EDKWKYYVTSYALPHPTEGIPHEKLKIPFLERLIE----FGQDIDGTEVDEEFSPEGISV 1386

Query: 1343 STLKIKIDPETYLLDIEAGSYDVFSRKSVNRFPVIVDSNDYTTKKEKKKNMVIQFLESKK 1402
            STLKIKI P TY L IE GSYDVF+RK+ N++P I + N       +KK ++ +FL+   
Sbjct: 1387 STLKIKIQPITYQLHIENGSYDVFTRKATNKYPTIANDNTQKGMVSQKKELISKFLDCAV 1446

Query: 1403 GWKKNLDDDQVKAIQEKLARVKEN 1426
            G + NLD+ Q  ++Q+K   +K++
Sbjct: 1447 GLRNNLDEAQKLSMQKKWENLKDS 1470

>KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_6.29
            YOL004W
          Length = 1479

 Score = 1483 bits (3838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 770/1323 (58%), Positives = 920/1323 (69%), Gaps = 99/1323 (7%)

Query: 141  VGLSFASFDNPLPP----QQQTILSSSHFQVLPPHXXXXXXXXXXXXXXXHDAYYRPLNV 196
             G+S ASFDNPLPP    Q Q    + H +                     DA YRPLNV
Sbjct: 160  TGVSVASFDNPLPPLNQQQSQPSFPAMHMR----DQQQQQQMAAAPAAAEDDASYRPLNV 215

Query: 197  KDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPGLIQGFN 256
            KDALSYLEQVK QFNSRPD+YN FLDIMKDFKSQ IDTPGVI+RVSTLF+GYP LIQGFN
Sbjct: 216  KDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGYPSLIQGFN 275

Query: 257  TFLPQGYRIECSANPDEPIRVTTPMGSSSV---AGTIENAVAGFPAQPRIXXXXXXXXXX 313
            TFLP GYRI+C +NP++PI+VTTP+GSS++     +++ A +    Q  +          
Sbjct: 276  TFLPTGYRIDCPSNPNDPIKVTTPIGSSTLHEMTRSVQRANSNLQQQQALSQ-------- 327

Query: 314  XXXXPEHVLPGVQVXXXXXXXXXXXXXXXXXXXXXXXXADYQLPLQPAAGQQSQLPSNDQ 373
                  +++   Q+                        A+    +Q    Q  Q      
Sbjct: 328  -----NNMMQQAQIPIGSISNN----------------ANLNAAVQSVDDQAKQ-----A 361

Query: 374  GKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 433
             KK ADVEFSQAINYVNKIKNRFA+QPDIYK+FLEILQTYQREQKPINEVYAQVT+LFQN
Sbjct: 362  NKKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQN 421

Query: 434  AXXXXXXXXXXXXXSSPSANRXXXXXXXXXXXSPAFGLSAYYNETSPP------TSRQNL 487
            A             SS                      S  Y    PP       ++Q+L
Sbjct: 422  APDLLDDFKKFLPDSSKEQQYTGQLPQQIPNQEQLEEFSGSY--ARPPNAPLDMVAQQSL 479

Query: 488  PPLGSFSPPPNGAVPHNYYRDQQPQTLGLPPVAQVENHIDQRS--PPHIATQGIAGEPMP 545
            PP+GSFSPP N  +   + + Q+P  + LP + Q E  ID  +   P ++TQGI+ + +P
Sbjct: 480  PPIGSFSPPANTGISM-HDQSQRPHMMALPSMLQHEQIIDMNNHPKPAVSTQGISNDEIP 538

Query: 546  VSNLRSQITAQSPS-----------------ELAXXX-------------XXXXXXXXPT 575
            VS++R    AQ P+                 +LA                          
Sbjct: 539  VSDVR---MAQYPNGAVPDYGQYPTHPQMKPDLATQRHILQQQEIQQQQLMLQQQQEQEL 595

Query: 576  ANIPDGQYLDIAVRPEIDLDPSIVPVVPEPTAPIEDSLTLVEETSFFDRAKKFIGNKQIY 635
                  QY++  VRPEIDLDPSIVPVVPEPT PIE + TL+EETSFFD+AKKFI NKQIY
Sbjct: 596  LEQQQQQYVEAPVRPEIDLDPSIVPVVPEPTEPIESNFTLIEETSFFDKAKKFINNKQIY 655

Query: 636  TEFLKILNLFSQDLLDVDELVGRVEHYLGGNKELFVWFKNFVGFQDKPKHIENIVHEKHR 695
            TEFLK+LNLFSQDL+ VD+LV +VE+Y+G +KELF WF+NFVG+Q  PK IENIVHEKHR
Sbjct: 656  TEFLKVLNLFSQDLISVDDLVNKVEYYIGSSKELFEWFRNFVGYQGNPKIIENIVHEKHR 715

Query: 696  LDLDLCEACGPSYKKLPKSDTFMPCSGRDEMCWAVLNDEWVGHPVWASEDSGFIAHRKNQ 755
            LDLDLCEACGPSYK+LPKSDTFMPCSGRD+MCW VLNDEWVGHPVWASEDSGFIAHRKNQ
Sbjct: 716  LDLDLCEACGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQ 775

Query: 756  YEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMSEEEKATFKLPPGLGHTSLTI 815
            YEETLFKIEEERHEYD+YIESNLRTIQTLE I +KI+NMSEEEK  FKL PGLGHTSLTI
Sbjct: 776  YEETLFKIEEERHEYDYYIESNLRTIQTLEAIVNKISNMSEEEKKNFKLEPGLGHTSLTI 835

Query: 816  YKKVIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQK 875
            YKKVIRKVYDKERGFEIIDALHE+PAIA P+VLKRLKQKDEEWRRAQREWNKVWRELEQK
Sbjct: 836  YKKVIRKVYDKERGFEIIDALHEHPAIAAPIVLKRLKQKDEEWRRAQREWNKVWRELEQK 895

Query: 876  VYYKSLDHLGLTFKQADKKLLTTKQLISEIGSIKTDQTNKRMHWLTPKPKDQLDYYVPDK 935
            VY+KSLDHLGLTFKQADKKLLT KQLISEI SIK DQ NKR+HWLTPKPK QL++ + D 
Sbjct: 896  VYFKSLDHLGLTFKQADKKLLTIKQLISEISSIKVDQNNKRIHWLTPKPKSQLNFDIKDF 955

Query: 936  SVFFDILSLTDTFINHNSSYSNPDKIRLKDLFKIFVSLFFSIPMYEVNEAVSRRGNLDDD 995
             + FDILSL++ FINH+S+YS  DK RL D  K F+SLFFS+P+ E+N A+ +R N  + 
Sbjct: 956  EILFDILSLSENFINHSSTYSTSDKERLNDFLKSFISLFFSVPLNEINNALDKRNNQKNS 1015

Query: 996  KEDSTQKMESDNLNNSKRPRED-EISLSEVLHRAKNQRFK--SRAADXXXXXXXXX---- 1048
            ++ +   +     N  KR   D E+S+S++LHR K Q+ K  +R +D             
Sbjct: 1016 EKVTDSALPDGTENQKKRSIHDIELSMSDILHRTKYQKMKLSNRGSDSQEENNIDTIIDE 1075

Query: 1049 -XXXXXXXXXXXIRQEAKKPWLLGNLVEEVNAQGLINNRKTFNMFANTNIYVFFRHLTTL 1107
                        IRQ+AK+PWLLG+++++ N QG+I +RK FN+FANTNIYVF RH TTL
Sbjct: 1076 ESDERLAEEADLIRQDAKRPWLLGDIIDKTNTQGIITDRKKFNLFANTNIYVFLRHWTTL 1135

Query: 1108 YERLEEVKKMNDAVTKEINSRKVVQFAKDLNLISQQLKEMGLDFEGADAYEQLRHLCKRL 1167
            YERL E+K+MN  VTKEIN+RK V+FA+DL L+S QLK MGLDF   D+YE+L  L KRL
Sbjct: 1136 YERLLELKEMNGEVTKEINNRKSVKFAEDLGLVSTQLKNMGLDFVDKDSYEELLRLSKRL 1195

Query: 1168 IEGDIEHQWFEESLRQAYNNKAFKLYTVDKVIQSLVKHAHTILTDSKTSEIMTSFEKDRT 1227
            IE DIEHQWFEESLRQAYNN+AFKLYTVDKV+Q+LVKH HT++TD KT+E+M  FEKDR 
Sbjct: 1196 IENDIEHQWFEESLRQAYNNRAFKLYTVDKVVQALVKHGHTLMTDYKTTEVMKLFEKDRL 1255

Query: 1228 QINTSAKDQILYRLQVRSYMSSTENMFRIEYNKQSKNVRIQFIAVDDLTLAEPRSLEEKW 1287
               TSAKDQILYRLQ RS+MS+TE MFRIEYNK  +N+ IQ+IA+DDLTL E  + EEKW
Sbjct: 1256 SSATSAKDQILYRLQARSHMSNTEYMFRIEYNKDDRNICIQYIALDDLTLKEGNTEEEKW 1315

Query: 1288 RYYVTSYSLSHPTEGISQEELQLPFLEKVLETEEDYGSDVDNF--SIDKFSPEGVSKSTL 1345
            +YYVTSYSL HPTEGI  E LQ+PFL+K+LE +++   + D    S  K+SPEGVS S  
Sbjct: 1316 KYYVTSYSLPHPTEGIDHESLQIPFLQKILEFDQEELENNDEENKSNGKYSPEGVSNSMY 1375

Query: 1346 KIKIDPETYLLDIEAGSYDVFSRKSVNRFPVIVDSNDYTTKKEKKKNMVIQFLESKKGWK 1405
            KIKI P  Y LDI+ GS+D+FSRKS+N++PV V+ +  + K  KKKN++  FLES  GWK
Sbjct: 1376 KIKIHPGNYALDIQTGSFDIFSRKSLNKYPVKVNEDHESLKLNKKKNILNTFLESNNGWK 1435

Query: 1406 KNL 1408
            K+L
Sbjct: 1436 KHL 1438

>ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YOL004W (SIN3)
          Length = 1377

 Score = 1458 bits (3774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 751/1264 (59%), Positives = 891/1264 (70%), Gaps = 88/1264 (6%)

Query: 191  YRPLNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPG 250
            YRPLNVKDALSYLEQVK+QF+SRPDVYNHFLDIMKDFKSQAIDTPGVI+RVSTLF GYP 
Sbjct: 129  YRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYPA 188

Query: 251  LIQGFNTFLPQGYRIECSANPDEPIRVTTPMGSSS---VAGTIENAVAGFPAQPRIXXXX 307
            LIQGFNTFLP GY IEC ++P++PI+VTTP G+     + G   N   G   +PR+    
Sbjct: 189  LIQGFNTFLPHGYNIECPSDPNDPIKVTTPFGTIGEIPITGAGGNHAHGANTEPRLQSTQ 248

Query: 308  XXXXXXXXXXPEHVLPGVQVXXXXXXXXXXXXXXXXXXXXXXXXADYQLPLQPAAGQQSQ 367
                          +P V                               P   A    +Q
Sbjct: 249  N-------------VPTVYRSAEGS------------------------PAAIATPATTQ 271

Query: 368  LPSNDQGKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQV 427
                   KK  DVEFS AI+YVNKIK RFAEQPDIYKHFLEILQTYQREQKPINEVYAQV
Sbjct: 272  EQYGTGPKKAGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQV 331

Query: 428  TVLFQNAXXXXXXXXXXXXXSSPSANRXXXXXXXXXXXSPAFG-----LSAYYNETSPPT 482
            TVLFQNA             SS +              +P FG     L      T P  
Sbjct: 332  TVLFQNAPDLLDDFKKFLPDSS-APQLQSHQQINGAMVAPGFGHAQSGLQQALPGTQPLM 390

Query: 483  SRQNLPPLGSFSPPPNGAVPHNYYRDQQPQTLGLPPVAQVENHIDQRSPPHIATQGIAGE 542
             +QNLPPLG+FS P           D  P  + LP V      + Q    HI TQG++ +
Sbjct: 391  HQQNLPPLGNFSTP----------GDHHP--MSLPSVQGPNVGLSQGQSGHIVTQGVSNQ 438

Query: 543  PMPVSNLRSQITAQSPSELAXXXXXXXXXXXPTANIPDGQYLDIAVRPEIDLDPSIVPVV 602
             +PVS+LR    A                      + D QY++  VRPEIDLDPS+VPV+
Sbjct: 439  HIPVSDLRGAPDAS-------------FRASEYNQVQDVQYMEPTVRPEIDLDPSLVPVI 485

Query: 603  PEPTAPIEDSLTLVEETSFFDRAKKFIGNKQIYTEFLKILNLFSQDLLDVDELVGRVEHY 662
            PEP  P+ED L LVEE +FFD+AKKFIGNKQIYTEFLKILNL+SQDLL+ ++LV  V HY
Sbjct: 486  PEPIKPLEDELNLVEEATFFDKAKKFIGNKQIYTEFLKILNLYSQDLLEKEKLVEDVSHY 545

Query: 663  LGGNKELFVWFKNFVGFQDKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKSDTFMPCSG 722
            L G+ ELF WFK+FVG+Q++PKHIEN++HEKHRLDLDLCEACGPSYK+LPK+DTFMPCSG
Sbjct: 546  LSGSPELFDWFKSFVGYQERPKHIENVIHEKHRLDLDLCEACGPSYKRLPKADTFMPCSG 605

Query: 723  RDEMCWAVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQ 782
            RDEMCW VLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIEEERHEYDFYIE+NLRTIQ
Sbjct: 606  RDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQ 665

Query: 783  TLETIASKIANMSEEEKATFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEYPAI 842
            TLETIA+KIANM+ EEKA FKLPPGLGHTS+TIYKKVIRKVYDK+RGFEIIDALHE+PAI
Sbjct: 666  TLETIANKIANMTPEEKAAFKLPPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHEHPAI 725

Query: 843  AVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLI 902
             VP+VLKRLKQKDEEWRRAQREWNKVWRELEQKV+YKSLDHLGLTFKQADKKLLT KQLI
Sbjct: 726  TVPLVLKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLI 785

Query: 903  SEIGSIKTDQTNKRMHWLTPKPKDQLDYYVPDKSVFFDILSLTDTFINHNSSYSNPDKIR 962
            SEI SIK DQ+NKR+H LTPK K QL Y   +  VF DILSL   F+ +N++YS  D  R
Sbjct: 786  SEISSIKVDQSNKRIHPLTPKAKSQLSYDFKEPEVFQDILSLVMVFLANNNTYSPSDNER 845

Query: 963  LKDLFKIFVSLFFSIPMYEVNEAVSRRGNLD------DDKEDSTQKMESDNLNNSKRPRE 1016
            LKD FK F+SLFFS P++E+ E + +R + +      DD   S +  +++  +  KR R+
Sbjct: 846  LKDFFKGFISLFFSYPLHEIEEGLLKRSSQNGTISHGDDTRKSKEDPKTEKHSARKRVRD 905

Query: 1017 D-EISLSEVLHRAKNQRFKSRAADXXXXXXXXXXXXXXXXXXXXIRQEAKKPWLLGNLVE 1075
            D E  L ++L+R K Q  K                         +RQEAKKPWLLG++V+
Sbjct: 906  DTEHLLRDILYRNKQQ--KVNKGPQNDQSSEEFEKESDIEEKEIVRQEAKKPWLLGSIVD 963

Query: 1076 EVNAQGLINNRKTFNMFANTNIYVFFRHLTTLYERLEEVKKMNDAVTKEINSRKVVQFAK 1135
            E +  G +++R TFNMFANTNIYVFFRHLTT+YERL EVKK+N  VTKEI++RKVVQFAK
Sbjct: 964  EADNHGHVSDRVTFNMFANTNIYVFFRHLTTMYERLVEVKKINGEVTKEISNRKVVQFAK 1023

Query: 1136 DLNLISQQLKEMGLDFEGADAYEQLRHLCKRLIEGDIEHQWFEESLRQAYNNKAFKLYTV 1195
            DLNLIS QL +MGLDF+GADAYE+L  L + LI G++EHQWFEESLRQAY NKAFKLYT+
Sbjct: 1024 DLNLISTQLTDMGLDFKGADAYEELLRLSRSLISGELEHQWFEESLRQAYKNKAFKLYTI 1083

Query: 1196 DKVIQSLVKHAHTILTDSKTSEIMTSFEKDRTQINTSAKDQILYRLQVRSYMSSTENMFR 1255
            DKVIQ+LVKHAHTIL D KT EIM  F+ DRT  +TS KDQILYRLQVRS MS+ ENMFR
Sbjct: 1084 DKVIQALVKHAHTILMDHKTVEIMLLFDNDRTSTSTSTKDQILYRLQVRSNMSNIENMFR 1143

Query: 1256 IEYNKQSKNVRIQFIAVDDLTLAEPRSLEEKWRYYVTSYSLSHPTEGISQEELQLPFLEK 1315
            IEYN  + +  IQF+AV+DLTL EP+SL +KW+YY+TSYSLSHPTEGIS + L+ PFLEK
Sbjct: 1144 IEYNTTTSHASIQFVAVEDLTLDEPKSLRDKWQYYLTSYSLSHPTEGISHDNLRTPFLEK 1203

Query: 1316 VLETEEDYGSDVDNFSIDKFSPEGVSKSTLKIKIDPETYLLDIEAGSYDVFSRKSVNRFP 1375
            ++E +E Y  D D    +++SPEGV+ S +K+KIDP TY +++E G +D+FSRKSVN+FP
Sbjct: 1204 IIERDEGYIDDGD----ERYSPEGVASSNMKVKIDPLTYSMEVEPGCHDIFSRKSVNKFP 1259

Query: 1376 VIVDSNDYTTKKEKKKNMVIQ-FLESKKGWKKNLDDDQVKAIQEKLARVKENGSLDDFNE 1434
              V   D   KK  +  +V++ FL  ++GWK+ L   +    + +L  VK NG+LDD+ E
Sbjct: 1260 TRV---DVKKKKSAELKLVLEGFLNGERGWKRGLTTKRTAEAERRLEYVKNNGTLDDYAE 1316

Query: 1435 ASQT 1438
               T
Sbjct: 1317 EIST 1320

 Score = 42.7 bits (99), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 39/67 (58%), Gaps = 1/67 (1%)

Query: 367 QLPSNDQGKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQ 426
           Q+P+ D G     +    A++Y+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +
Sbjct: 120 QVPAQD-GSAYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIER 178

Query: 427 VTVLFQN 433
           V+ LF  
Sbjct: 179 VSTLFHG 185

>NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6.29
            YOL004W
          Length = 1434

 Score = 1451 bits (3757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 755/1278 (59%), Positives = 901/1278 (70%), Gaps = 94/1278 (7%)

Query: 187  HDAYYRPLNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFK 246
             D  YRPLNVKDALSYLEQVKYQF+ RPD+YN FLDIMKDFKSQ+IDTPGVI+RVS LF+
Sbjct: 203  QDLAYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFR 262

Query: 247  GYPGLIQGFNTFLPQGYRIECSANPDEPIRVTTPMGSSSVAGTIENAVAGFPAQPRIXXX 306
            GYP L+QGFNTFLPQGYRIEC+ +PD PIRVTTPMG+S+++        G PA       
Sbjct: 263  GYPMLVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGTSTLS--------GGPAM----EA 310

Query: 307  XXXXXXXXXXXPEHVLPGVQVXXXXXXXXXXXXXXXXXXXXXXXXADYQLPLQPAAGQQS 366
                         H  P +                                 Q +  QQ+
Sbjct: 311  PSSSESNLQQQQHHQSPTIPSLAAST-------------------------FQESNFQQT 345

Query: 367  QLPSNDQGKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQ 426
              P  DQ  K A+VEFSQAINYVNKIKNRFA+QPDIYK FLEILQTYQREQKPINEVY+Q
Sbjct: 346  PQPE-DQSAKNAEVEFSQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQ 404

Query: 427  VTVLFQNAXXXXXXXXXXXXXSSPSA-------NRXXXXXXXXXXXSPAFGLSAYYNETS 479
            VTVLFQ+A             SS +        N            +P      Y N   
Sbjct: 405  VTVLFQHAPDLLDDFKKFLPESSGTTSTSELPQNAGIQQRAAIPTPNPKHQQYGYPNNYY 464

Query: 480  P--PTSRQNLPPLGSFSPPPNGAVPHNYYRDQQ-PQTLGLPPVAQVENHIDQRSPPHIAT 536
            P    ++QNLPP+GSF+PP NG     Y    Q     GLP +   +  + Q+  P +  
Sbjct: 465  PNGTGTQQNLPPIGSFAPP-NGTASREYAPGNQFVGPGGLPSMIPNDQALQQQQQPGLV- 522

Query: 537  QGIAGEPMPVSNLRSQITAQS-------PSELAXXXXXXXXXXXPTANIPDGQYLDIA-V 588
             G   E +PVSNLRS +T Q         +++            P A     QY + A +
Sbjct: 523  HGYTNEAIPVSNLRSPLTDQQYPNLLNMQNQMTPGQMDINNATAPMAQ----QYTNEAPI 578

Query: 589  RPEIDLDPSIVPVVPEPTAPIEDSLTLVEETSFFDRAKKFIGNKQIYTEFLKILNLFSQD 648
            RPEIDLDPSIVPV+PEPT P+E +++LVEET+FF++AKKFIG KQ+YTEFLKILNL+SQD
Sbjct: 579  RPEIDLDPSIVPVIPEPTEPLEYNVSLVEETNFFEKAKKFIGTKQVYTEFLKILNLYSQD 638

Query: 649  LLDVDELVGRVEHYLGGNKELFVWFKNFVGFQDKPKHIENIVHEKHRLDLDLCEACGPSY 708
            LL  DEL  +VE+YLG N+ELF WFKNFVGFQ+KP  IENIVHEKH+LDLDLCEACGPSY
Sbjct: 639  LLTTDELCVKVEYYLGSNEELFTWFKNFVGFQEKPLIIENIVHEKHKLDLDLCEACGPSY 698

Query: 709  KKLPKSDTFMPCSGRDEMCWAVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERH 768
            KKLPK+DTFMPCSGRDEMCW VLNDEWVGHPVWASEDSGFIAHRKNQYEE+LFK EEERH
Sbjct: 699  KKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEESLFKTEEERH 758

Query: 769  EYDFYIESNLRTIQTLETIASKIANMSEEEKATFKLPPGLGHTSLTIYKKVIRKVYDKER 828
            EYDF IESNLRTIQTLETIA+KI NM+ EEK  FKLPPGLGHTS TIYKKVIRKVYDK+R
Sbjct: 759  EYDFCIESNLRTIQTLETIANKIGNMTNEEKKNFKLPPGLGHTSSTIYKKVIRKVYDKDR 818

Query: 829  GFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTF 888
            GFEIID LHE PA+ VPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTF
Sbjct: 819  GFEIIDLLHEEPALTVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTF 878

Query: 889  KQADKKLLTTKQLISEIGSIKTDQTNKRMHWLTPKPKDQLDYYVPDKSVFFDILSLTDTF 948
            KQADKKLLTTKQL+SEI SIK DQTNKR+HWLTPKPK QL++   D  +F DIL LT  F
Sbjct: 879  KQADKKLLTTKQLLSEISSIKVDQTNKRIHWLTPKPKSQLEFQFDDNDIFVDILGLTSVF 938

Query: 949  INHNSSYSNPDKIRLKDLFKIFVSLFFSIPMYEVNEAVSRRGNLDDDKEDSTQKMESDNL 1008
            INH+S+YSNP+K R+KD  ++FVSLFFSIP+ +VNEA+S R +   +KE  T K  S N+
Sbjct: 939  INHSSTYSNPEKERMKDFLRVFVSLFFSIPLDKVNEALSDRSHWLQEKEKKT-KESSRNI 997

Query: 1009 NNS-----------KRPREDEISLSEVLHRAKNQRFKSRAA----------DXXXXXXXX 1047
            +++           KRP   +I L+++L + K Q+ + +A           D        
Sbjct: 998  DSTTSSSSSGSNSKKRPLNIDIPLADILRKHKYQKIRKQAKESNEENAQEEDDENIVGDS 1057

Query: 1048 XXXXXXXXXXXXIRQEAKKPWLLGNLVEEVNAQGLINNRKTFNMFANTNIYVFFRHLTTL 1107
                        I +E K+PWLLGN++E  +  G I+NRK FNMFANTNIYVFFR  T +
Sbjct: 1058 NEELNEQDENEIILEEIKRPWLLGNIIETASNHGTISNRKVFNMFANTNIYVFFRLWTVI 1117

Query: 1108 YERLEEVKKMNDAVTKEINSRKVVQFAKDLNLISQQLKEMGLDFEGADAYEQLRHLCKRL 1167
            YERL E+K++N+ VTKE+NSR++ QFAKDLNLIS QLK+MGLDF G ++Y++L  L KRL
Sbjct: 1118 YERLYEMKQINEKVTKEVNSRRISQFAKDLNLISTQLKDMGLDFVGVNSYQELLVLSKRL 1177

Query: 1168 IEGDIEHQWFEESLRQAYNNKAFKLYTVDKVIQSLVKHAHTILTDSKTSEIMTSFEKDRT 1227
            I+ DIEHQWFEESLRQA+NNKAFKLYTVDKVIQSLVKHAHTIL D KTSEIM  FEKDR 
Sbjct: 1178 IQNDIEHQWFEESLRQAFNNKAFKLYTVDKVIQSLVKHAHTILGDVKTSEIMVLFEKDRL 1237

Query: 1228 QINTSAKDQILYRLQVRSYMSSTENMFRIEYNKQSKNVRIQFIAVDDLTLAEPRSLEEKW 1287
              +TSAK+QILYRLQ R++M++TENMFRIE+N++  +V IQ+IA++DLT+ +P+S+E+ W
Sbjct: 1238 CSSTSAKEQILYRLQTRAHMTNTENMFRIEFNEEKNHVCIQYIALEDLTIKQPKSMEKNW 1297

Query: 1288 RYYVTSYSLSHPTEGISQEELQLPFLEKVLETEEDYGSDVDNFSIDKFSPEGVSKSTLKI 1347
             YYVTSYSL HPTEG+ Q+EL++PFLEK LE E D   D      +K SPEGVS S LKI
Sbjct: 1298 EYYVTSYSLPHPTEGVPQDELKIPFLEKTLELEVDEEGD------NKSSPEGVSSSKLKI 1351

Query: 1348 KIDPETYLLDIEAGSYDVFSRKSVNRFPVIVDSNDYTTKKEKKKNMVIQFLESKKGWKKN 1407
            KIDP++Y L+IE GS+D+FSRKS+N +P   D     TKK K  + + +FL+ K GWKKN
Sbjct: 1352 KIDPKSYALEIEPGSFDLFSRKSMNVYPTYSDE----TKKRKSIDQMTKFLDGKNGWKKN 1407

Query: 1408 LDDDQVKAIQEKLARVKE 1425
            L       I++ + + +E
Sbjct: 1408 LTTADSTNIEDLVKKSRE 1425

>KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6.29
            YOL004W
          Length = 1492

 Score = 1446 bits (3743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 763/1331 (57%), Positives = 916/1331 (68%), Gaps = 96/1331 (7%)

Query: 188  DAYYRPLNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKG 247
            D+ YRPLNVKDALSYLEQVK QFNSRP +YN FLDIMKDFKSQ IDTPGVI+RVSTLFKG
Sbjct: 215  DSPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKG 274

Query: 248  YPGLIQGFNTFLPQGYRIECSANPDEPIRVTTPMGSSSVAGTIENAVAGFPAQPRIXXXX 307
            +P LIQGFNTFLPQGYRIECS+NP+EPI+VTTPMG   V   +  +      QP I    
Sbjct: 275  FPALIQGFNTFLPQGYRIECSSNPNEPIKVTTPMG---VLENVRGSDITADQQPAIGQ-- 329

Query: 308  XXXXXXXXXXPEHVLPGVQVXXXXXXXXXXXXXXXXXXXXXXXXADYQLPLQPAAGQQSQ 367
                          LP  Q                         A   LP   AA    Q
Sbjct: 330  --------------LPTTQ-------------SPIQASLPPPQSAHLHLPSTVAAATTVQ 362

Query: 368  LPSN----DQGKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEV 423
              +N    ++ KK  DVEFSQAI+YVNKIKNRF++QPDIYK+FLEILQTYQREQKPINEV
Sbjct: 363  QSANVHAENEPKKANDVEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEV 422

Query: 424  YAQVTVLFQNAXXXXXXXXXXXXXSSPSANRXXXXXXXXXXXSPAFGLSA--YYNETS-- 479
            YAQVTVLF NA             SS S  +                ++    YN T   
Sbjct: 423  YAQVTVLFHNAPDLLDDFKKFLPDSSASNEQQPKQSPYSPQVYSGADMARGYMYNNTGVY 482

Query: 480  -PPTSRQ---NLPPLGSFSPPPNG-------AVPHNYYRDQQPQTLGLPPVAQVENHIDQ 528
             PP   Q   NLPP+GSFSPP NG       A+PH    D+Q    G+P +A    H  Q
Sbjct: 483  YPPQVNQPQSNLPPIGSFSPPANGVAPTTGTAIPH---ADEQHVVAGVPAMAP---HEQQ 536

Query: 529  RSPPHIATQGI------AGEPMPVSNLRSQITAQSPSELAXXXXXXXXXXXPTANIPDGQ 582
             +P  I   GI       G  +P  N    I+    ++                      
Sbjct: 537  HAPSMINNDGIQISNMRGGGTVPALNQYGMISPHDYTQQQAKQVQQFQEDQQQQQQQSMM 596

Query: 583  YL------DIAVRPEIDLDPSIVPVVPEPTAPIEDSLTLVEETSFFDRAKKFIGNKQIYT 636
                    D+ VRPEIDLDPSIVPVVPEPT PIE++L+L EETSFF++ KK IGN+QIY 
Sbjct: 597  MDEQYGSGDMQVRPEIDLDPSIVPVVPEPTEPIENNLSLSEETSFFEKVKKNIGNRQIYI 656

Query: 637  EFLKILNLFSQDLLDVDELVGRVEHYLGGNKELFVWFKNFVGFQDKPKHIENIVHEKHRL 696
            EFLK+LNLFSQDL+ VDELV +VE+YL G  ELF WFKNFVG+QDKPK IEN++HEKHRL
Sbjct: 657  EFLKVLNLFSQDLIAVDELVTKVENYLAGQPELFEWFKNFVGYQDKPKIIENVIHEKHRL 716

Query: 697  DLDLCEACGPSYKKLPKSDTFMPCSGRDEMCWAVLNDEWVGHPVWASEDSGFIAHRKNQY 756
            DLDLCEA GPSYKKLPKSDTFMPCSGRD+MCW VLNDEWVGHPVWASEDSGFIAHRKNQY
Sbjct: 717  DLDLCEAYGPSYKKLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQY 776

Query: 757  EETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMSEEEKATFKLPPGLGHTSLTIY 816
            EETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANM+EEEK  FKLPPGLGHTSLTIY
Sbjct: 777  EETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKNMFKLPPGLGHTSLTIY 836

Query: 817  KKVIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKV 876
            KK+IRKVYDKERGFEIID LHE+PAI VP+VLKRLKQKDEEWRRAQREWNKVWRELEQKV
Sbjct: 837  KKIIRKVYDKERGFEIIDELHEHPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKV 896

Query: 877  YYKSLDHLGLTFKQADKKLLTTKQLISEIGSIKTDQTNKRMHWLTPKPKDQLDYYVPDKS 936
            Y+KSLDHLGLTFKQADKKLLTTKQLISEI SIK DQ NKRMHWLTPKPK QLDY   D  
Sbjct: 897  YFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQNNKRMHWLTPKPKKQLDYQFNDMD 956

Query: 937  VFFDILSLTDTFINHNSSYSNPDKIRLKDLFKIFVSLFFSIPMYEVNEAVSRRGNLDDDK 996
            + FDI+ LTD F++H S+YSNPDK RLKDLF++F+SLFF IP   ++ A+  +   D+ K
Sbjct: 957  IIFDIVGLTDVFVDHCSTYSNPDKERLKDLFRVFISLFFFIPRDLISAALDTKS--DEGK 1014

Query: 997  EDSTQKMESDNLNNSKRPRED-EISLSEVLHRAKNQRFKSRAADXXXXXXXXXXXXXXXX 1055
               T+  ++D  ++ KRPR D E+SLS++LHRAK Q+ K+   +                
Sbjct: 1015 STDTKFEKAD--DSKKRPRPDVELSLSDILHRAKYQKLKN--GEGLGMSEDDDEEKLAKE 1070

Query: 1056 XXXXIRQEAKKPWLLGNLVEEVNAQGLINNRKTFNMFANTNIYVFFRHLTTLYERLEEVK 1115
                  + A KPWL+G++VE  N+ GL+ +R  +N+F NTN+Y+F RH +TLY RL E+K
Sbjct: 1071 AEEMSEKNASKPWLVGDIVERANSHGLVTDRAVYNLFGNTNVYIFIRHWSTLYGRLLELK 1130

Query: 1116 KMNDAVTKEINSRKVVQFAKDLNLISQQLKEMGLDFEGADAYEQLRHLCKRLIEGDIEHQ 1175
            +M++ VTKEIN+RKVVQFA+DLNL+S QL++MGLDF+G +AY++   L KRLI  ++EHQ
Sbjct: 1131 QMDERVTKEINNRKVVQFAEDLNLLSTQLRDMGLDFDGKNAYQETLKLSKRLIRNELEHQ 1190

Query: 1176 WFEESLRQAYNNKAFKLYTVDKVIQSLVKHAHTILTDSKTSEIMTSFEKDRTQINTSAKD 1235
            WFEESLRQAYNNKAFKLYTVDKV+ SLVKHAHT++TD+K+SE+M  FEKDR Q +T  KD
Sbjct: 1191 WFEESLRQAYNNKAFKLYTVDKVVHSLVKHAHTLMTDNKSSELMELFEKDRLQSSTCVKD 1250

Query: 1236 QILYRLQVRSYMSSTENMFRIEYNKQSKNVRIQFIAVDDLTLAEPRSLEEKWRYYVTSYS 1295
            QILYRL  RS+MSSTENMFR++YNK +++V IQ+I +DD+TL + +   E+W YY+TSY+
Sbjct: 1251 QILYRLLTRSHMSSTENMFRVQYNKDTRHVSIQYIGLDDVTLEDAKDDNERWNYYMTSYA 1310

Query: 1296 LSHPTEGISQEELQLPFLEKVLETEEDYGSDVDNFSIDKFSPEGVSKSTLKIKIDPETYL 1355
            L HPTEGI Q++L +PFLE++LE E D   DV+  S D+++P G S S LKI IDP+TY 
Sbjct: 1311 LPHPTEGIMQDKLVVPFLERILEFENDM-LDVEAGS-DRYNPVGTSYSKLKINIDPKTYK 1368

Query: 1356 LDIEAGSYDVFSRKSVNRFPVIVDSNDYTTKKEKKKNMVIQFLESKKGWKKNLDDDQVKA 1415
            L I+ GSYD+FSR S+N +P+  DS  Y    EK+K    +FL+ + GWKK+L DD +  
Sbjct: 1369 LIIQDGSYDIFSRSSINEYPIRPDSKGYVQMVEKRKETAQKFLDGRFGWKKDLSDDVINT 1428

Query: 1416 IQ--EKLARVKENGSLDDFNEASQTQQASEIIAPSKVEQSKESTVADVNSLPKELVE--- 1470
            ++  +K+A + E           +T+    +  P   E+  E+TV  +   P  L E   
Sbjct: 1429 VEPTKKIALLSE-----------ETKDVGTLSTPVTTEKGAENTVHGLQ--PVALAENSN 1475

Query: 1471 AEDRGNDTTAD 1481
            A   G  T  D
Sbjct: 1476 ASTMGTSTVGD 1486

>Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON}
            (46639..51129) [4491 nt, 1497 aa]
          Length = 1496

 Score = 1421 bits (3679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 717/1163 (61%), Positives = 859/1163 (73%), Gaps = 39/1163 (3%)

Query: 360  PAAGQQSQLPSNDQGKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKP 419
            P     + +    Q +K ADVEFSQA++YVNKIKNRFA+QPDIYKHFLEILQTYQREQKP
Sbjct: 341  PGTTVANNIQGTTQIEKPADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKP 400

Query: 420  INEVYAQVTVLFQNAXXXXXXXXXXXXXSSPSAN----RXXXXXXXXXXXSPAFGLS-AY 474
            I+EVYAQVTVLFQNA             SSPS                   P +G++  Y
Sbjct: 401  ISEVYAQVTVLFQNAPDLLDDFKKFLPDSSPSVTTQQPVQPQQQALPQQQQPMYGVNNGY 460

Query: 475  YNETSPPTSRQNLPPLGSFSPPPNGAVP---HNYYRDQQPQTLGLPPVAQV-ENHIDQRS 530
            Y     P++ QNLPPLG+FSPP NGAVP     +  + Q   + LP + Q    H    +
Sbjct: 461  YQAGKIPSANQNLPPLGNFSPPSNGAVPGRPEEFSTEAQHHMMALPSMLQAPTEHAQLHA 520

Query: 531  PPHIATQGIAGEPMPVSNLRSQITAQ------SPSELAXXXXXXXXXXXPTAN------- 577
              HIA   +  E +P+S+LRSQI         +P ELA                      
Sbjct: 521  QQHIAP--MTNEAIPISDLRSQIIDNNHVHNYTPIELAQLQQQQQQQQQQQQQQQQQQMQ 578

Query: 578  IPDGQYLDIAVRPEIDLDPSIVPVVPEPTAPIEDSLTLVEETSFFDRAKKFIGNKQIYTE 637
            +      +  VRPEIDLDPSIVPV+PEPT PIE+SL+LVEE +FFD+AKKFIGNKQ+Y E
Sbjct: 579  LEAAYATEGIVRPEIDLDPSIVPVIPEPTEPIEESLSLVEEANFFDKAKKFIGNKQVYVE 638

Query: 638  FLKILNLFSQDLLDVDELVGRVEHYLGGNKELFVWFKNFVGFQDKPKHIENIVHEKHRLD 697
            FLKILNL+SQD+L +D+L+ +V++YLG NKELF WFKNFVGFQDKPKHIEN+VHEKH+LD
Sbjct: 639  FLKILNLYSQDILSLDDLIEKVDYYLGSNKELFDWFKNFVGFQDKPKHIENVVHEKHKLD 698

Query: 698  LDLCEACGPSYKKLPKSDTFMPCSGRDEMCWAVLNDEWVGHPVWASEDSGFIAHRKNQYE 757
            LDLCEACGPSYKKLPK+DTFMPCSGRDEMCW VLNDEWVGHPVWASEDSGFIAHRKNQYE
Sbjct: 699  LDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE 758

Query: 758  ETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMSEEEKATFKLPPGLGHTSLTIYK 817
            ETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANM+EEEK  FKLP GLGHTS TIY+
Sbjct: 759  ETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKQAFKLPIGLGHTSTTIYQ 818

Query: 818  KVIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVY 877
            KVIRKVYDKERGFEIIDALHEYP++AVPVVLKRLKQKD+EWRRAQREWNKVWRELEQKV+
Sbjct: 819  KVIRKVYDKERGFEIIDALHEYPSVAVPVVLKRLKQKDKEWRRAQREWNKVWRELEQKVF 878

Query: 878  YKSLDHLGLTFKQADKKLLTTKQLISEIGSIKTDQTNKRMHWLTPKPKDQLDYYVPDKSV 937
            +KSLDHLGLTFKQ+DKKLLTTKQL++EI SIK DQTNKR+HWLTPKPK QLDY V DK V
Sbjct: 879  FKSLDHLGLTFKQSDKKLLTTKQLLAEISSIKVDQTNKRIHWLTPKPKSQLDYEVKDKRV 938

Query: 938  FFDILSLTDTFINHNSSYSNPDKIRLKDLFKIFVSLFFSIPMYEVNEAVSRRGNLDDDKE 997
             FDIL L D FINH SSYSNPDK RL+D  + ++ LFFSIP+ E+ +AV     +D+ K+
Sbjct: 939  LFDILRLADVFINHTSSYSNPDKERLRDFLQSYIGLFFSIPIREIKDAV--EAAIDNGKQ 996

Query: 998  DSTQKMESDNLNNSKRPREDEISLSEVLHRAKNQRFK-SRAADXXXXXXXXXXXXXXXXX 1056
                +  S   N++KRPR+ EI LS++L+R++ QR K S  +                  
Sbjct: 997  LDENEQNSSKKNSNKRPRDVEICLSDILNRSRYQRLKHSLDSSEASLGAVSPGQNEQDDM 1056

Query: 1057 XXXIRQEAKKPWLLGNLVEEVNAQGLINNRKTFNMFANTNIYVFFRHLTTLYERLEEVKK 1116
               IRQEAKKPWLLG+LVEE N+QGLI NRK +NMFAN N+YVF R+L T+Y+RL EVK 
Sbjct: 1057 DEMIRQEAKKPWLLGSLVEEANSQGLIQNRKIYNMFANVNMYVFMRNLITIYDRLHEVKD 1116

Query: 1117 MNDAVTKEINSRKVVQFAKDLNLISQQLKEMGLDFEGADAYEQLRHLCKRLIEGDIEHQW 1176
            +ND VTKEIN RKVVQFAKDLNLIS QLK MGLDF G D+Y QL  L KRLIEGD+EHQW
Sbjct: 1117 INDVVTKEINGRKVVQFAKDLNLISAQLKNMGLDFSGGDSYTQLLLLSKRLIEGDLEHQW 1176

Query: 1177 FEESLRQAYNNKAFKLYTVDKVIQSLVKHAHTILTDSKTSEIMTSFEKDRTQINTSAKDQ 1236
            FEESLRQAY N+AFKLYT+DKVIQSLVKHAH I+TDSK+S++M  FEKDR   +T++KDQ
Sbjct: 1177 FEESLRQAYRNRAFKLYTIDKVIQSLVKHAHAIMTDSKSSDVMALFEKDRISSSTTSKDQ 1236

Query: 1237 ILYRLQVRSYMSSTENMFRIEYNKQSKNVRIQFIAVDDLTLAEPRSLEEKWRYYVTSYSL 1296
            ILYRLQ RS+MS+TE+MFRIEYN +  ++ IQ+IA+DDLTL EP++LE+KW+YY+TSYSL
Sbjct: 1237 ILYRLQTRSHMSTTEHMFRIEYNTKKSSISIQYIALDDLTLEEPKTLEDKWKYYITSYSL 1296

Query: 1297 SHPTEGISQEELQLPFLEKVLETEEDYGSDVDNFSIDKFSPEGVSKSTLKIKIDPETYLL 1356
            SHPTEGI QEE+++PFL+KV+E+E+ +  D D+    K+SPEGVSKS L IKIDPETY L
Sbjct: 1297 SHPTEGIPQEEIKIPFLDKVIESEQVHMEDEDDNP--KYSPEGVSKSNLMIKIDPETYRL 1354

Query: 1357 DIEAGSYDVFSRKSVNRFPVIVDSNDYTTKKEKKKNMVIQFLESKKGWKKNLDDDQVKAI 1416
            ++E GS+D+FSRKSVN+FPV V S  Y  KK+ ++N    FL  K GWK+ L  D +  I
Sbjct: 1355 EVEPGSFDIFSRKSVNKFPVDVFSESYKVKKQTRRNRCKNFLNGKHGWKRQLSSDAISKI 1414

Query: 1417 QEKLARVKENGSLDDFNEASQTQQAS-EIIAPSKVEQSKESTVADVNSLP--------KE 1467
            ++K   +K NG+    + ++ ++  S  + A    ++ +EST     S P          
Sbjct: 1415 EQKFNDLK-NGTFQQRSRSATSETTSVPLNASDSTQKEQESTGTSETSQPALQKVPINSA 1473

Query: 1468 LVEAEDRGNDTTADEVDPEVVAH 1490
              + E+RGNDTT +EV+ E V H
Sbjct: 1474 EPDQEERGNDTTTEEVESESVVH 1496

 Score =  200 bits (509), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 132/218 (60%), Gaps = 23/218 (10%)

Query: 72  HVTLPSISDLSGESAHNGKDGLTSSNTPLRLPSVQSTYGSKAPGAGQEVNGTIMESTVNP 131
           HV LPS S+++ E+  N       SN      +  ST  +   G   E + ++    +  
Sbjct: 25  HVVLPSFSNINPENTTNISQ---QSNNKSTNTTPSSTSNTPNTGVKLENSSSLSRPNL-- 79

Query: 132 APAQGRQNSVGLSFASFDNPLPPQQQTILSSSHFQVLPPHXXXXXXXXXXXXXXXHDAYY 191
                 + S  LS ASFDNPLPP              P                   +YY
Sbjct: 80  -----PKTSTTLSVASFDNPLPPA-------------PAAHLQQQQQQQQQQQQADGSYY 121

Query: 192 RPLNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPGL 251
           RPLNVKDAL+YLEQVK QFNSRPD+YNHFLDIMKDFKSQ+IDTPGVI+RVSTLF+GYP L
Sbjct: 122 RPLNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNL 181

Query: 252 IQGFNTFLPQGYRIECSANPDEPIRVTTPMGSSSVAGT 289
           IQGFNTFLPQGY IECS+NPD+PI+VTTP+GS  V  +
Sbjct: 182 IQGFNTFLPQGYTIECSSNPDDPIKVTTPLGSQIVTNS 219

 Score = 53.1 bits (126), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 39/62 (62%)

Query: 199 ALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPGLIQGFNTF 258
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 366 AVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNAPDLLDDFKKF 425

Query: 259 LP 260
           LP
Sbjct: 426 LP 427

 Score = 39.3 bits (90), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 31/48 (64%)

Query: 385 AINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 432
           A+ Y+ ++K +F  +PDIY HFL+I++ ++ +      V  +V+ LF+
Sbjct: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFR 176

>CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004w SIN3
            transcription regulatory protein
          Length = 1493

 Score = 1395 bits (3612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 725/1312 (55%), Positives = 885/1312 (67%), Gaps = 122/1312 (9%)

Query: 191  YRPLNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPG 250
            YRPLNVKDALSYLEQVK+QF++RPD+YN FLDIMKDFKSQ IDTPGVI+RVS+LFKGYP 
Sbjct: 185  YRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFKGYPN 244

Query: 251  LIQGFNTFLPQGYRIECSANPDEPIRVTTPMGSSSVAGTIENAVAGFPAQPRIXXXXXXX 310
            LIQGFNTFLPQGYRIECS NP++PI+VTTPMGSS+         +  P+  +        
Sbjct: 245  LIQGFNTFLPQGYRIECSNNPNDPIKVTTPMGSSTTVLNTAPQKSPSPSDIQTNNQQTQA 304

Query: 311  XXXXXXXPEHVLPGVQVXXXXXXXXXXXXXXXXXXXXXXXXADYQLPLQPAAGQQSQLPS 370
                        P                                +P Q   GQ      
Sbjct: 305  IAQEAQLQSQATP--------------------------------IPTQHDVGQNF---- 328

Query: 371  NDQGKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVL 430
                KK ADVEFSQAI YVNKIK RFA+QPDIYK FLEILQTYQREQKPI+EVYAQVT+L
Sbjct: 329  -GSAKKPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTIL 387

Query: 431  FQNAXXXXXXXXXXXXXSSPSANRXXXXXXXXXXXS--------------PAFGLSA--- 473
            FQNA             SS S +            S               A G++A   
Sbjct: 388  FQNAPDLLDDFKKFLPDSSASGSEETQVQQQQHYQSLSDKMGGNAEAANYAASGMNAQTG 447

Query: 474  YYNETSPPTS---------RQNLPPLGSFSPPPNGAVPHNYYRDQQPQT----LGLPPVA 520
            YY       S         +QNLPP+GSFSPP NG       +   P+T    + LP + 
Sbjct: 448  YYEPVKGGVSYNTQQNQHQQQNLPPIGSFSPPTNGPFVDQTQQSANPETQKGVMSLPSMM 507

Query: 521  Q-----------------VENHIDQRSPPHIATQGI-AGEPMPVSNLRSQITAQS--PSE 560
                              + +  D  S   + +Q I + + +PVSNLR+ +  Q+  P  
Sbjct: 508  NNAEAVKEQAIKQAHSRLISDSHDHNSQQQVLSQNIHSNDDIPVSNLRTTVVEQNYHPET 567

Query: 561  LAXXXXXXXXXXXPTANIPDGQYL----DIAVRPEIDLDPSIVPVVPEPTAPIEDSLTLV 616
            +               ++ DG Y+    ++ VRPEIDLDPS+VPVVPEPT PIE+SL L+
Sbjct: 568  IYQQQGNAQQ------HMVDGGYVGTPSELVVRPEIDLDPSLVPVVPEPTEPIENSLNLM 621

Query: 617  EETSFFDRAKKFIGNKQIYTEFLKILNLFSQDLLDVDELVGRVEHYLGGNKELFVWFKNF 676
            EET+FF+R KK IGNKQIY EFLKILNLFS DLL VDELV +VE+Y+G NKELF WFK F
Sbjct: 622  EETNFFERVKKSIGNKQIYNEFLKILNLFSLDLLTVDELVDKVEYYIGANKELFDWFKVF 681

Query: 677  VGFQDKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKSDTFMPCSGRDEMCWAVLNDEWV 736
            VG+QDKPK IENIVHEKH+LDLDLCEA GPSYKKLPK+DTFMPCSGRD+MCW VLNDEWV
Sbjct: 682  VGYQDKPKRIENIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDDMCWEVLNDEWV 741

Query: 737  GHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMSE 796
            GHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD+YIESNLRTIQTLETIA+KIANM++
Sbjct: 742  GHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLETIANKIANMTD 801

Query: 797  EEKATFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDE 856
             EKA F+LPPGLGHTS+TIYKKVIRKVYDKERGFEIIDALH YPAI+VP++L+RLKQKDE
Sbjct: 802  AEKAQFRLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHNYPAISVPIILRRLKQKDE 861

Query: 857  EWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEIGSIKTDQTNKR 916
            EWRRAQREWNK+WR+LEQKVY+KSLDHLGLTFKQADKKLLTTKQLISEI  IK DQ +KR
Sbjct: 862  EWRRAQREWNKIWRDLEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEINGIKVDQNSKR 921

Query: 917  MHWLTPKPKDQLDYYVPDKSVFFDILSLTDTFINHNSSYSNPDKIRLKDLFKIFVSLFFS 976
            +HWLTPKPK+QLDY  PD  + FDI++L   F  + + YSNPDK R+KD+ ++FVS FFS
Sbjct: 922  IHWLTPKPKNQLDYDFPDYDILFDIIALGFVFTINTNLYSNPDKERIKDMLRVFVSQFFS 981

Query: 977  IPMYEVNEAVSRRGNLDDDKEDS---TQKM----------ESDNLNNSKRPREDEISLSE 1023
            IP+ EV++A+ RRG  DD+  DS   + KM          E D  ++ KRP ++++++S+
Sbjct: 982  IPLKEVSDALERRGFSDDNNNDSDKGSGKMDQIAEEIGETEQDTSSSKKRPFDNDLNMSD 1041

Query: 1024 VLHRAKNQRFKSRA---ADXXXXXXXXXXXXXXXXXXXXIRQEAKKPWLLGNLVEEVNAQ 1080
            +LH+ K Q+ K                               E +K WL+G++V+  N +
Sbjct: 1042 ILHKTKQQKTKMNKEMDGSKSPSEDLGTDRNVGTIEDSGSLSEHRKQWLVGDVVDSANKE 1101

Query: 1081 GLINNRKTFNMFANTNIYVFFRHLTTLYERLEEVKKMNDAVTKEINSRKVVQFAKDLNLI 1140
              ++NR  +N+FANTNIY+FFRHL TLYERL EVK++ND + KEI SR+V  FAKDL LI
Sbjct: 1102 TPMDNRNIYNLFANTNIYIFFRHLVTLYERLSEVKQINDEINKEIKSRRVTTFAKDLGLI 1161

Query: 1141 SQQLKEMGLDFEGADAYEQLRHLCKRLIEGDIEHQWFEESLRQAYNNKAFKLYTVDKVIQ 1200
            S QL E+GLDF  +DAY+QL  L KRLIEGDIEHQWFEES+RQAYNN+AFKLYT+DKV+Q
Sbjct: 1162 STQLSELGLDFNSSDAYQQLLTLSKRLIEGDIEHQWFEESIRQAYNNRAFKLYTIDKVVQ 1221

Query: 1201 SLVKHAHTILTDSKTSEIMTSFEKDRTQINTSAKDQILYRLQVRSYMSSTENMFRIEYNK 1260
            S VKHAHT+++DSKTSEIM  FE  R    T+ KDQILYR+Q RS+MSSTENMFRIEY +
Sbjct: 1222 SFVKHAHTLISDSKTSEIMLLFENQRNNTLTTTKDQILYRIQCRSHMSSTENMFRIEYKR 1281

Query: 1261 QSKNVRIQFIAVDDLTLAEPRSLEEKWRYYVTSYSLSHPTEGISQEELQLPFLEKVLETE 1320
            + ++  IQ+IA+DDLTL   +S EE W YYVTSYSLS+PTEG+  E L++PFLEKV+E +
Sbjct: 1282 EKRHASIQYIALDDLTLKTAKSPEEAWNYYVTSYSLSNPTEGVPHENLEVPFLEKVIEFD 1341

Query: 1321 EDYGSDVDNFSIDKFSPEGVSKSTLKIKIDPETYLLDIEAGSYDVFSRKSVNRFPVIVDS 1380
            ++Y  D  N S   +S  G+SKS L I ID E Y L ++ GS DV+SR ++ ++P++   
Sbjct: 1342 QEYSKDNGNNST--YSLAGISKSNLHIDIDREKYNLILQGGSSDVYSRATIQKYPIVASD 1399

Query: 1381 NDYTTKKEKKKNMVIQFLESKKGWKKNLDDDQVKAIQEKLARVKENGSLDDF 1432
                    +K   + + L    G   N +DD    + EK   +  NG++D +
Sbjct: 1400 ESRAANISEKTQEIRKVLSHYDG---NSNDD----VNEKFNYILANGTIDGY 1444

>KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1433

 Score = 1385 bits (3586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 778/1497 (51%), Positives = 956/1497 (63%), Gaps = 150/1497 (10%)

Query: 39   NGMNQAVETSTVGLTGGKTPEMTKQEIKVESKPH-VTLPSISDL-SGESAHNGKDGLTSS 96
            +G  Q    ++ G +    P      +    +PH   LPS+S L +G  A  G +     
Sbjct: 31   SGGMQGQAANSTGESKANAP------VDASQQPHQFVLPSLSGLDAGTRAEYGSE----- 79

Query: 97   NTPLRLPSVQSTYGSKAPGAGQEVNGTIMESTVNPAPAQGRQNSVGLSFASFDNPLPPQQ 156
              P RLPS+Q          G                      S G S AS +NPLP QQ
Sbjct: 80   --PQRLPSLQGAQPQSISSGG----------------------SKGFSVASLNNPLPAQQ 115

Query: 157  QTILSSSHFQVLPPHXXXXXXXXXXXXXXXHDAYYRPLNVKDALSYLEQVKYQFNSRPDV 216
            Q + S                          D  YRPLN KDALSYLEQVK+QFN+RPDV
Sbjct: 116  QMLHSQQ--------QQQLLQQGVLPLEHVQDPSYRPLNFKDALSYLEQVKFQFNNRPDV 167

Query: 217  YNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPGLIQGFNTFLPQGYRIECSANPDEP-- 274
            YNHFLDIMKD+KSQAIDT GVI+R+STLFKGYP LIQG NTFLPQGY+IEC+ NP++P  
Sbjct: 168  YNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPILIQGLNTFLPQGYKIECTLNPNDPHS 227

Query: 275  IRVTTPMGSS-----SVAGTIENAVAGFPAQPRIXXXXXXXXXXXXXXPEHVLPGVQVXX 329
            I+VTTP  ++     +   T    V G P+   +              P  V P ++   
Sbjct: 228  IKVTTPFDNARELNLATMATGNGIVEGHPS--LMPSDDVSPPKLVGHEPAAVQPKLENAP 285

Query: 330  XXXXXXXXXXXXXXXXXXXXXXADYQLPLQPAAGQQSQLPSNDQGKKTADVEFSQAINYV 389
                                     Q P  P   +Q Q    +  + + DVEFS AI+YV
Sbjct: 286  TNLPVPTTFNQNLPQHEQQNQQHGSQSPAMPQQQRQDQQFMGN--RPSGDVEFSHAISYV 343

Query: 390  NKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAXXXXXXXXXXXXXSS 449
            NKIK RFA+QP+IYKHFLEILQTYQREQKPI+EVYAQVT LFQNA             ++
Sbjct: 344  NKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQNAPDLLDDFKKFLPDAT 403

Query: 450  PS-------ANRXXXXXXXXXXXSPAFGLSAYYNETSPPTSRQNLP--PLGSFSP----- 495
             +         +                 S Y N +     RQ     P G+  P     
Sbjct: 404  AAHEQQQLLLQQQQQQQQQLQQQQIQQHQSHYQNASQDLDQRQQHTHQPFGNTVPFYQTQ 463

Query: 496  -------PPNGAV-PHNYYRDQQPQTLGLPPV---------AQVENHIDQRSPPHIATQG 538
                   PP G+  P    R+  PQ L LP V          QV +H     P H+  Q 
Sbjct: 464  QGRPQNLPPLGSFSPPINGRENDPQ-LNLPAVQPPAMEFASQQVPHH-----PSHVVPQV 517

Query: 539  IAGEPMPVSNLRSQITAQ-SPSELAXXXXXXXXXXXPTANIPDGQYLDIAVRPEIDLDPS 597
            I G  +P+S+LR  +    +P  L                  D Q+++   RPEIDLDPS
Sbjct: 518  IPGGTLPLSDLRGAMDGNFAPQPLQSQ---------------DVQFIEPTSRPEIDLDPS 562

Query: 598  IVPVVPEPTAPIEDSLTLVEETSFFDRAKKFIGNKQIYTEFLKILNLFSQDLLDVDELVG 657
            +VPV+PEP  P+E+ LTL+EETSFFDRAKK++GNKQ+YTEFLKILNLFSQDL+  +ELV 
Sbjct: 563  LVPVIPEPIKPLENDLTLIEETSFFDRAKKYMGNKQVYTEFLKILNLFSQDLIGTEELVD 622

Query: 658  RVEHYLGGNKELFVWFKNFVGFQDKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKSDTF 717
            +VEHYLGG+ ELF WFK+FV + +KPKHIEN++HEKHRLDLDLCEAC PSYKKLPK+DTF
Sbjct: 623  KVEHYLGGSPELFDWFKSFVNYVEKPKHIENVIHEKHRLDLDLCEACFPSYKKLPKADTF 682

Query: 718  MPCSGRDEMCWAVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESN 777
            MPCSGRDEMCW VLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD+YIE+N
Sbjct: 683  MPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEAN 742

Query: 778  LRTIQTLETIASKIANMSEEEKATFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALH 837
            LRTIQ LETIA+KI+NM+ EEK  FKLPPGLGHTS+TIYKKVIRKVYDK+RGFEIIDALH
Sbjct: 743  LRTIQLLETIANKISNMTPEEKQAFKLPPGLGHTSMTIYKKVIRKVYDKDRGFEIIDALH 802

Query: 838  EYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLT 897
            E PA++VP++LKRLKQKDEEWRRAQREWNKVWRELEQKV+YKSLDHLGLTFKQADKKLLT
Sbjct: 803  ENPAVSVPIILKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLT 862

Query: 898  TKQLISEIGSIKTDQTNKRMHWLTPKPKDQLDYYVPDKSVFFDILSLTDTFINHNSSYSN 957
             KQLISEI SIK DQTNKR++  TPKPK QLDY + DK V FDIL L + FI+H+S+YSN
Sbjct: 863  AKQLISEISSIKVDQTNKRIYPFTPKPKSQLDYDLKDKGVLFDILCLVNNFIDHSSTYSN 922

Query: 958  PDKIRLKDLFKIFVSLFFSIPMYEVNEAVSRRGNLDDDKEDSTQKMESDNLNNS---KRP 1014
            PDK +L   FK F+S+FFSI   E+              E+ST   +SD ++NS   KR 
Sbjct: 923  PDKEKLAAFFKGFLSVFFSISYQEI--------------ENST-PADSDAVSNSNPRKRL 967

Query: 1015 REDEISLSEVLHRAKNQRFKSR---AADXXXXXXXXX--XXXXXXXXXXXIRQEAKKPWL 1069
             E E  L E+L R+K++  K R   A D                      IRQEAKKPWL
Sbjct: 968  WESEQPLKELL-RSKHKHHKKRDTSAEDDSISDDQNSPEKSPQEIEDEEVIRQEAKKPWL 1026

Query: 1070 LGNLVEEVNAQGLINNRKTFNMFANTNIYVFFRHLTTLYERLEEVKKMNDAVTKEINSRK 1129
            LGN+++E N  G ++NRK FN+FANTN+YVFFRHLTT+Y+RL EVK MN+ VT+EINSR 
Sbjct: 1027 LGNILDEANDHGYVSNRKIFNLFANTNVYVFFRHLTTMYQRLSEVKNMNEEVTREINSRN 1086

Query: 1130 VVQFAKDLNLISQQLKEMGLDFEGADAYEQLRHLCKRLIEGDIEHQWFEESLRQAYNNKA 1189
            VVQFAKDLNL+S QL +MGLDF+G DAY+QL  LCKRLI  D++HQWFEESLRQAY NKA
Sbjct: 1087 VVQFAKDLNLVSTQLSDMGLDFKGKDAYDQLLTLCKRLIRNDMDHQWFEESLRQAYKNKA 1146

Query: 1190 FKLYTVDKVIQSLVKHAHTILTDSKTSEIMTSFEKDRTQINTSAKDQILYRLQVRSYMSS 1249
            FK+YTVDKVIQSLVKHAH+I+TD+K++EIM  FEKDR    TS K+QILYRLQVRSYM  
Sbjct: 1147 FKIYTVDKVIQSLVKHAHSIITDAKSAEIMILFEKDRRCTATSTKEQILYRLQVRSYMGL 1206

Query: 1250 TENMFRIEYNKQSKNVRIQFIAVDDLTLAEPRSLEEKWRYYVTSYSLSHPTEGISQEELQ 1309
            TENMFR+E NK S +V IQ++A+DDLTL EP SL+++W YY+TSY+LSHPTEGI  EE++
Sbjct: 1207 TENMFRVEINKDSCHVCIQYVAIDDLTLKEPESLKDRWHYYLTSYALSHPTEGIPHEEIK 1266

Query: 1310 LPFLEKVLETEE--DYGSDVDNFSIDKFSPEGVSKSTLKIKIDPETYLLDIEAGSYDVFS 1367
            +PFLEK L+ +E  D GS       ++ SP G S S L+I+++PE+Y L IE GS D+F+
Sbjct: 1267 VPFLEKTLQDDEEADEGS-------EERSPSGHSLSNLRIQVNPESYELQIEPGSKDIFT 1319

Query: 1368 RKSVNRFPVIVDSNDYTTKKEKKKNMVIQFLESKKGWKKNLDDDQVKAIQEKLARVKENG 1427
            R +VNRF    ++N  T  KE+K+  ++  L+  +GWKK +  + V      L  V+ +G
Sbjct: 1320 RFAVNRFLNSSENNSNTDLKEEKRKTLMSQLDGSRGWKKGMSQELVDKTLTALNYVRLHG 1379

Query: 1428 SLDDFNEASQTQQASEIIAPSKVEQSKESTVA-DVNSLPKELVEAEDRGNDTTADEV 1483
              +  N+     Q +        +   ES+VA + +SL     + E +  +TTA+++
Sbjct: 1380 KHESLNKNPALVQGTR-------DPRHESSVAKEASSLESHADDTELKAGETTAEDI 1429

>SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] {ON}
            similar to uniprot|Q75CF0 Ashbya gossypii ACL004W
            ACL004Wp and some similarites with YOL004W uniprot|P22579
            Saccharomyces cerevisiae YOL004W SIN3 DNA binding protein
            involved in transcriptional regulation
          Length = 1415

 Score = 1339 bits (3466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 704/1126 (62%), Positives = 842/1126 (74%), Gaps = 57/1126 (5%)

Query: 374  GKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 433
             KK  DVEFS AI+YVNKIK RFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN
Sbjct: 333  AKKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 392

Query: 434  AXXXXXXXXXXXXXSSPSANRXXXXXXXXXXXSPAFGLSAYYNETSPPTSRQNLPPLGSF 493
            A             +S   +            +P  G   +Y + +P   +QNLPPLGSF
Sbjct: 393  APDLLDDFKKFLPDASAPQS--------TTTPAPVNG-GTFYPQAAP---QQNLPPLGSF 440

Query: 494  SPPPNGAVPHNYYRDQQPQTLGLPPVAQVENHIDQRSPPHIATQGIAGEPMPVSNLRSQI 553
            SPP +G+        ++ + +GLP V      I  +   HI TQG++ + +P+S +R+  
Sbjct: 441  SPPSSGSA-------REGEHVGLPAVQPPSMDISGQPQQHIITQGMSNDDIPISEVRNTA 493

Query: 554  TAQSPSELAXXXXXXXXXXXPTANIPDGQYLDIAVRPEIDLDPSIVPVVPEPTAPIEDSL 613
                 S+L               N  + QY++   RPEIDLDPS+VPV+PEP  P+E+ +
Sbjct: 494  DGAYRSDLR--------------NSGEVQYMEPVARPEIDLDPSLVPVIPEPIEPMENEV 539

Query: 614  TLVEETSFFDRAKKFIGNKQIYTEFLKILNLFSQDLLDVDELVGRVEHYLGGNKELFVWF 673
            +LVEETSFFD+AKKFIGNKQIYTEFLKILNL+SQDLLD DELV +VE+YLGGNKELF WF
Sbjct: 540  SLVEETSFFDKAKKFIGNKQIYTEFLKILNLYSQDLLDRDELVEKVEYYLGGNKELFDWF 599

Query: 674  KNFVGFQDKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKSDTFMPCSGRDEMCWAVLND 733
            KNFVG++ KPKHIENIVHEKHRLDLDLCEACGPSYKKLPK+DTFMPCSGRDEMCW VLND
Sbjct: 600  KNFVGYEKKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKADTFMPCSGRDEMCWEVLND 659

Query: 734  EWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIAN 793
            EWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIE+NLRTIQTLETIA+KIAN
Sbjct: 660  EWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIEANLRTIQTLETIANKIAN 719

Query: 794  MSEEEKATFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQ 853
            M+ EEKATFKL PGLGHTS+TIYKKVIRKVYDK+RGFEIIDALHE P+IAVP+VLKRLKQ
Sbjct: 720  MTPEEKATFKLSPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHETPSIAVPIVLKRLKQ 779

Query: 854  KDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEIGSIKTDQT 913
            KDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQL+SEI +IK DQ 
Sbjct: 780  KDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLVSEISTIKVDQA 839

Query: 914  NKRMHWLTPKPKDQLDYYVPDKSVFFDILSLTDTFINHNSSYSNPDKIRLKDLFKIFVSL 973
            NKR+H LTPKPK QLDY+  D+ V +DIL+L   FI+ N++YSNPDK ++ D  K F+ L
Sbjct: 840  NKRIHPLTPKPKSQLDYHFKDREVLYDILNLAKVFIDCNTTYSNPDKEKMFDFLKSFLVL 899

Query: 974  FFSIPMYEVNEAVSRRG---NLDDDKEDSTQKMESDNLNNSKRPREDEISLSEVLHRAKN 1030
            FFS PMYEV  A +RR     + D +E+S Q  E+ +L+  KR RE+E  L +VL R K 
Sbjct: 900  FFSYPMYEVETAFARRRGDIGVQDGEENSGQ--ENSDLSR-KRTREEENLLKDVLRRNKY 956

Query: 1031 QRFKSRAADXXXXXXX--XXXXXXXXXXXXXIRQEAKKPWLLGNLVEEVNAQGLINNRKT 1088
            Q+ ++ A +                      IRQEAKKPWLLG++V+E N  G + NRKT
Sbjct: 957  QKGRNFAEEEPIPEESEFAEKTVEEKEEEEIIRQEAKKPWLLGSIVDEANEHGFVENRKT 1016

Query: 1089 FNMFANTNIYVFFRHLTTLYERLEEVKKMNDAVTKEINSRKVVQFAKDLNLISQQLKEMG 1148
            FNMFANTNIYVFFRHL TLY RL EVK +N+AVT+EI +RKVVQFAKDLNLIS QL +MG
Sbjct: 1017 FNMFANTNIYVFFRHLATLYTRLSEVKDINEAVTEEIKNRKVVQFAKDLNLISTQLSDMG 1076

Query: 1149 LDFEGADAYEQLRHLCKRLIEGDIEHQWFEESLRQAYNNKAFKLYTVDKVIQSLVKHAHT 1208
            LDFEGADAY Q+  L KRLIEGDIEHQWFEESLRQAY NKAFK+YT+DKV+QSLVKHAHT
Sbjct: 1077 LDFEGADAYGQVLTLSKRLIEGDIEHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHT 1136

Query: 1209 ILTDSKTSEIMTSFEKDRTQINTSAKDQILYRLQVRSYMSSTENMFRIEYNKQSKNVRIQ 1268
            I+TD KT EIM  FEKDRT +NTSAK+QILYRLQVRS+M++ ENMFRIEYN+QS +  IQ
Sbjct: 1137 IITDPKTVEIMILFEKDRTCLNTSAKEQILYRLQVRSHMTTAENMFRIEYNRQSTHASIQ 1196

Query: 1269 FIAVDDLTLAEPRSLEEKWRYYVTSYSLSHPTEGISQEELQLPFLEKVLETEEDYGSDVD 1328
            F+AVDDLTL EP+SLE++W+YYVTSYSLSHPTEGIS EELQ PFLEK+LE EE++  +  
Sbjct: 1197 FVAVDDLTLEEPKSLEDRWKYYVTSYSLSHPTEGISHEELQPPFLEKILEKEEEFQCEN- 1255

Query: 1329 NFSIDKFSPEGVSKSTLKIKIDPETYLLDIEAGSYDVFSRKSVNRFPVIVDSNDYTTKKE 1388
                 ++SPEGVS S LK+KI+PETY LD++ GSYD FSRKS+N+FP+ ++++ Y +K+ 
Sbjct: 1256 ----GEYSPEGVSSSNLKVKINPETYSLDVQPGSYDFFSRKSINKFPIEINNDTYKSKRG 1311

Query: 1389 KKKNMVIQFLESKKGWKKNLDDDQVKAIQEKLARVKENGSLDDFNEASQTQQASEIIAPS 1448
            +K   +  +L   KGWK+ L   +V   Q ++  VK  G+L       +++  ++I+   
Sbjct: 1312 EKAKCLTSYLNGAKGWKRGLVASKVLKAQTEIEYVKTKGTLVGL----ESKDKNDIVKND 1367

Query: 1449 KVEQSKESTVADVNSLPKE-------LVEAEDRGNDTTADEVDPEV 1487
               ++K  T +       E         E E +GNDTT +E + E+
Sbjct: 1368 IDGENKSYTFSTGQLHDHEEDKPISHQEEPESKGNDTTTEEFEGEI 1413

 Score =  180 bits (456), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 92/149 (61%), Positives = 105/149 (70%), Gaps = 12/149 (8%)

Query: 139 NSVGLSFASFDNPLPPQQQTILSSSHFQVLPPHXXXXXXXXXXXXXXXHDAYYRPLNVKD 198
           +  G S AS +NPLP QQQ                              D  YRPLNVKD
Sbjct: 116 SGTGFSVASLNNPLPEQQQQQQQQQ----------QQQQQQQQQQQQPQDPSYRPLNVKD 165

Query: 199 ALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPGLIQGFNTF 258
           ALSYLEQVK+QFN+RPDVYNHFLDIMKDFKSQAIDTPGVI+RVS LF+GYP LIQGFNTF
Sbjct: 166 ALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYPNLIQGFNTF 225

Query: 259 LPQGYRIECSANPDE--PIRVTTPMGSSS 285
           LPQGY+IECS+NP++  PI+VTTP G++ 
Sbjct: 226 LPQGYKIECSSNPNDPHPIKVTTPFGTTG 254

 Score = 53.5 bits (127), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 42/73 (57%)

Query: 199 ALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPGLIQGFNTF 258
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 344 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 403

Query: 259 LPQGYRIECSANP 271
           LP     + +  P
Sbjct: 404 LPDASAPQSTTTP 416

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 32/48 (66%)

Query: 385 AINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 432
           A++Y+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LFQ
Sbjct: 166 ALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQ 213

>Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON}
            similar to Ashbya gossypii ACL004W
          Length = 1474

 Score = 1303 bits (3371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 690/1174 (58%), Positives = 834/1174 (71%), Gaps = 91/1174 (7%)

Query: 357  PLQPAAGQQSQLPSNDQGKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQRE 416
            P  P    Q Q  +   GKKT DVEFS AI+YVNKIK RFA+QPDIYKHFLEILQTYQRE
Sbjct: 331  PTMPQRQPQDQFGTG--GKKTGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQRE 388

Query: 417  QKPINEVYAQVTVLFQNAXXXXXXXXXXXXXSSPSANRXXXXXXXXXXXSPAFGLSAYYN 476
            QKPINEVYAQVTVLFQNA             +S    +           + A   S++Y+
Sbjct: 389  QKPINEVYAQVTVLFQNAPDLLDDFKKFLPDASAPQAQQQHLAQSHPQLNGALTPSSFYH 448

Query: 477  ETSPPTSRQ------------------------------NLPPLGSFSPPPNGAVPHNYY 506
                   +                               NLPPLGSFS P          
Sbjct: 449  SQQQQGPQPQQDQSQSQHPVQQQQQQQQQQQQQTVIHQQNLPPLGSFSTP---------- 498

Query: 507  RDQQPQTLGLPPVAQVEN-HIDQRSPPHIATQGIAGEPMPVSNLRSQI-TAQSPSELAXX 564
             D  P  L   P+ Q  N +++Q  P HI TQG++ + +P+S+LR+   T+  P+E +  
Sbjct: 499  GDHHPMNL---PLVQAPNMNLNQGHPAHIITQGMSNQKIPISDLRTTADTSYRPAEYSQG 555

Query: 565  XXXXXXXXXPTANIPDGQYLDIAVRPEIDLDPSIVPVVPEPTAPIEDSLTLVEETSFFDR 624
                           D QY++   RPEIDLDPS+VPV+PEP  P+ED L LVEE SFFD+
Sbjct: 556  Q--------------DTQYMETNARPEIDLDPSLVPVIPEPIKPLEDELNLVEEASFFDK 601

Query: 625  AKKFIGNKQIYTEFLKILNLFSQDLLDVDELVGRVEHYLGGNKELFVWFKNFVGFQDKPK 684
            AKK+IGNKQIYTEFLKILNL+SQDLLD + LV +V HYL G  ELF WFK+FVG+Q+KPK
Sbjct: 602  AKKYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFDWFKSFVGYQEKPK 661

Query: 685  HIENIVHEKHRLDLDLCEACGPSYKKLPKSDTFMPCSGRDEMCWAVLNDEWVGHPVWASE 744
            HIENIVHEKHRLDLDLCEACGPSYK+LPK+DTFMPCSGRDEMCW VLNDEWVGHPVWASE
Sbjct: 662  HIENIVHEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASE 721

Query: 745  DSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMSEEEKATFKL 804
            DSGFIAHRKNQYE+TLFKIEEERHEYDFYIE+NLRTIQTLETIA+KIANM+ EEKATFKL
Sbjct: 722  DSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKL 781

Query: 805  PPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQRE 864
            PPGLGHTS+TIYKKVIRKVYDK+RG+EIIDALHEYPAI VP+VLKRLKQKDEEWRRAQRE
Sbjct: 782  PPGLGHTSVTIYKKVIRKVYDKDRGYEIIDALHEYPAITVPIVLKRLKQKDEEWRRAQRE 841

Query: 865  WNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEIGSIKTDQTNKRMHWLTPKP 924
            WNKVWRELEQKV++KSLDHLGLTFKQADKKLLT KQLISEI SIK DQ NKR+H LTPK 
Sbjct: 842  WNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQNNKRIHPLTPKA 901

Query: 925  KDQLDYYVPDKSVFFDILSLTDTFINHNSSYSNPDKIRLKDLFKIFVSLFFSIPMYEVNE 984
            K QLD+   D  VF+DIL+L   F+ +N++YS PDK RLKD FK F+SLF S P+ ++ +
Sbjct: 902  KSQLDHDFTDPEVFYDILNLAIVFLENNNTYSAPDKERLKDFFKGFISLFCSYPVPQIEK 961

Query: 985  AVSRRG--------NLDDDKEDSTQKMESDNLNNSKRPRED-EISLSEVLHRAKNQRFKS 1035
            A+++R         N + +     Q+ + D     KR RED +  L +VL R K Q  K 
Sbjct: 962  ALAKRDAASSSQSSNSNTETYSEKQQEDGDMKLPKKRNREDSDRLLRDVLFRNKQQ--KG 1019

Query: 1036 RAADXXXXXXXXXXXXXXXXXXXXIRQEAKKPWLLGNLVEEVNAQGLINNRKTFNMFANT 1095
                                    IRQEAK PWLLG++V+E +  G + NRKTFN+FANT
Sbjct: 1020 GRNSPRGDSSISAEKESDMEEEEIIRQEAKNPWLLGSIVDEADNHGHVENRKTFNLFANT 1079

Query: 1096 NIYVFFRHLTTLYERLEEVKKMNDAVTKEINSRKVVQFAKDLNLISQQLKEMGLDFEGAD 1155
            NIYVFFRHL T+YERL EVKKMND VTKEI +RKVVQFAKDLNLIS QL +MGLDF+G D
Sbjct: 1080 NIYVFFRHLATIYERLVEVKKMNDEVTKEIANRKVVQFAKDLNLISTQLTDMGLDFKGED 1139

Query: 1156 AYEQLRHLCKRLIEGDIEHQWFEESLRQAYNNKAFKLYTVDKVIQSLVKHAHTILTDSKT 1215
            AYE+L  L + LI GD+EHQWFEESLRQAY NKAFK+YTVDKVIQ+LVKHAH I+TD+KT
Sbjct: 1140 AYEKLLQLSRSLIAGDLEHQWFEESLRQAYKNKAFKIYTVDKVIQALVKHAHAIITDNKT 1199

Query: 1216 SEIMTSFEKDRTQINTSAKDQILYRLQVRSYMSSTENMFRIEYNKQSKNVRIQFIAVDDL 1275
             EIM  FEKDRT ++TS KDQILYRLQVRS MS+ ENMFRIEYN+ + +V IQF+AVDDL
Sbjct: 1200 VEIMMLFEKDRTSLSTSTKDQILYRLQVRSNMSNIENMFRIEYNRLTAHVCIQFVAVDDL 1259

Query: 1276 TLAEPRSLEEKWRYYVTSYSLSHPTEGISQEELQLPFLEKVLETEEDYGSDVDNFSIDKF 1335
            TL EP+SL++KW+YY+TSYSLSHPTEGIS + L+ PFLEK++E+EED   D D    +K+
Sbjct: 1260 TLEEPKSLKDKWQYYLTSYSLSHPTEGISHDNLRSPFLEKIIESEEDIIEDKD----EKY 1315

Query: 1336 SPEGVSKSTLKIKIDPETYLLDIEAGSYDVFSRKSVNRFPVIVDSNDYTTKKEKKKNMVI 1395
            SPEGV+ S LK+KIDP TY +++E GS+D+FSRK+VN+FPV VD      +K+K   + +
Sbjct: 1316 SPEGVATSNLKVKIDPITYSMEVEFGSHDIFSRKAVNKFPVRVD-----IRKKKSSELKL 1370

Query: 1396 Q---FLESKKGWKKNLDDDQVKAIQEKLARVKENGSLDDFNEASQTQQASEI----IAPS 1448
            +   FL S  GWKK+L   Q+  ++++L  VK NG+L+++++ S     S +    +A  
Sbjct: 1371 ELERFLNSNSGWKKDLSAKQIAEVEKRLEFVKLNGNLEEYSDDSAVASTSAVSGSDLAKE 1430

Query: 1449 KVEQSK-ESTV--ADVNSLPKELVEAEDRGNDTT 1479
             + +S+ ESTV  A + +  +  ++ E    D+T
Sbjct: 1431 DIARSQSESTVVSASMATCAQSTLKTEKDKPDST 1464

 Score =  190 bits (482), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 130/219 (59%), Gaps = 26/219 (11%)

Query: 70  KPHVTLPSISDL---SGESAHNGKDGLTSSNTPLRLPSVQSTYGSKAPGAGQEVNGTIME 126
           K H TLPSIS     SGE  H   DG        RLP +Q+T  + A        G    
Sbjct: 59  KGHYTLPSISAGLPGSGEHQHQQHDGS-------RLPPMQNTLAAAASAPPGGGGGGGGG 111

Query: 127 STVNPAPAQGRQNSVGLSFASFDNPLPPQQQTILSSSHFQVLPPHXXXXXXXXXXXXXXX 186
                        S G S +S DNPLP Q+    S    Q                    
Sbjct: 112 V------------SNGFSMSSLDNPLPQQEFQEQSQHQQQQ----HHHHQLDQLQSPAHQ 155

Query: 187 HDAYYRPLNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFK 246
             + YRPLNVKDALSYLEQVK+QFNSRPDVYNHFLDIMKDFKSQAIDTPGVI+RVSTLF+
Sbjct: 156 DGSSYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQ 215

Query: 247 GYPGLIQGFNTFLPQGYRIECSANPDEPIRVTTPMGSSS 285
           GYP LIQGFNTFLPQGY IECS++P++PI+VTTP G++ 
Sbjct: 216 GYPTLIQGFNTFLPQGYNIECSSDPNDPIKVTTPFGTTG 254

 Score = 52.8 bits (125), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 39/62 (62%)

Query: 199 ALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPGLIQGFNTF 258
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 357 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 416

Query: 259 LP 260
           LP
Sbjct: 417 LP 418

 Score = 42.7 bits (99), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 37/64 (57%)

Query: 369 PSNDQGKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVT 428
           P++  G     +    A++Y+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+
Sbjct: 152 PAHQDGSSYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVS 211

Query: 429 VLFQ 432
            LFQ
Sbjct: 212 TLFQ 215

>Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL004W
            (REAL)
          Length = 1555

 Score = 1241 bits (3210), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 620/1028 (60%), Positives = 767/1028 (74%), Gaps = 32/1028 (3%)

Query: 469  FGLSAYYNE-TSPPTSRQNLPPLGSFSPPPNGAVPHNYYRDQQ----PQTLGLPPVAQVE 523
            +  S+YYN  T+    +QNLPP+GSFSPP NG+  H+ Y+DQQ    P  + LP + Q  
Sbjct: 540  YPASSYYNHSTNRGVPQQNLPPIGSFSPPTNGSTVHDNYQDQQHMQPPHLVPLPSMVQ-- 597

Query: 524  NHIDQRSPPHIATQGIAGEPMPVSNLRSQITAQSPSELAXXXXXXXXXXXPTANIPDGQY 583
                    P++  QGIA E +P+S+LR+ +T Q                 P   I D QY
Sbjct: 598  ------HGPNMVHQGIANENLPISDLRTSLTDQYAPSTFQQQQQNPPSISP---ITDLQY 648

Query: 584  LDIAVRPEIDLDPSIVPVVPEPTAPIEDSLTLVEETSFFDRAKKFIGNKQIYTEFLKILN 643
             D+ VRPEIDLDPSIVPVVPEPT PIED+++L EE +FF++AK++IGNK +YTEFLKILN
Sbjct: 649  GDVPVRPEIDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILN 708

Query: 644  LFSQDLLDVDELVGRVEHYLGGNKELFVWFKNFVGFQDKPKHIENIVHEKHRLDLDLCEA 703
            L+SQD+LD+D+LV +V+ YLG NKELF WFKNFVG+Q+K K IENIVHEKHRLDLDLCEA
Sbjct: 709  LYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEA 768

Query: 704  CGPSYKKLPKSDTFMPCSGRDEMCWAVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKI 763
             GPSYK+LPKSDTFMPCSGRD+MCW +LNDEWVGHPVWASEDSGFIAHRKNQYEETLFKI
Sbjct: 769  FGPSYKRLPKSDTFMPCSGRDDMCWEILNDEWVGHPVWASEDSGFIAHRKNQYEETLFKI 828

Query: 764  EEERHEYDFYIESNLRTIQTLETIASKIANMSEEEKATFKLPPGLGHTSLTIYKKVIRKV 823
            EEERHEYDFYIESNLRTIQ LETI +KI NM+E EK+ FKLPPGLGHTS+TIYKKVIRKV
Sbjct: 829  EEERHEYDFYIESNLRTIQCLETIVNKIENMTESEKSDFKLPPGLGHTSMTIYKKVIRKV 888

Query: 824  YDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDH 883
            YDKERGFEIIDALHE+PA+  PVVLKRLKQKDEEWRRAQREWNKVWRELEQKV++KSLDH
Sbjct: 889  YDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDH 948

Query: 884  LGLTFKQADKKLLTTKQLISEIGSIKTDQTNKRMHWLTPKPKDQLDYYVPDKSVFFDILS 943
            LGLTFKQADKKLLTTKQLISEI SIK DQTNK++HWLTPKPK QLD+  PDK +F+DIL 
Sbjct: 949  LGLTFKQADKKLLTTKQLISEINSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILY 1008

Query: 944  LTDTFINHNSSYSNPDKIRLKDLFKIFVSLFFSIPMYEVNEAVSRRGNLDDDKEDSTQKM 1003
            L D+FI+H ++YSNPDK RLKDL K F+SLFFSIP+ ++ +A+       ++  +S+   
Sbjct: 1009 LADSFISHTTAYSNPDKERLKDLLKYFISLFFSIPLEKIEKALQFHK---ENVSESSGSD 1065

Query: 1004 ESDNLNNSKRPREDEISLSEVLHRAKNQRFKSRAADXXXXXXXXXX----XXXXXXXXXX 1059
            +  +  + KRP + E+SL ++LHR + Q+ K R+ D                        
Sbjct: 1066 DGGSSTSRKRPYQQEMSLLDILHRNRYQKLK-RSNDEEGKIPQLSEPLDEESNTIEEEEL 1124

Query: 1060 IRQEAKKPWLLGNLVEEVNAQGLINNRKTFNMFANTNIYVFFRHLTTLYERLEEVKKMND 1119
            I +EA+ PWL GNLVEE N+QG+I NR  FN+FANTNIY+FFRH TT+YERL E+K+MN 
Sbjct: 1125 ISEEARNPWLTGNLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNG 1184

Query: 1120 AVTKEINSRKVVQFAKDLNLISQQLKEMGLDFEGADAYEQLRHLCKRLIEGDIEHQWFEE 1179
             +TKE+N+R  V FAKDL+L+S QL EMGLDF G DAY+Q+  L +RLI GD+EHQWFEE
Sbjct: 1185 KITKEVNTRSTVTFAKDLDLLSNQLPEMGLDFIGEDAYKQVLRLSRRLINGDLEHQWFEE 1244

Query: 1180 SLRQAYNNKAFKLYTVDKVIQSLVKHAHTILTDSKTSEIMTSFEKDRTQINTSAKDQILY 1239
            SLRQAYNNKAFKLYT+DKV QSLVKHAHT++ D KT+EIM  F KDR    TSAKDQI+Y
Sbjct: 1245 SLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMADVKTAEIMALFVKDRNAFTTSAKDQIIY 1304

Query: 1240 RLQVRSYMSSTENMFRIEYNKQSKNVRIQFIAVDDLTLAEPRSLEEKWRYYVTSYSLSHP 1299
            RLQVRSYMS+ ENMFRIE NK+S +V +Q+IA+DDLTL EP++ E+KW+YYVTSY L HP
Sbjct: 1305 RLQVRSYMSNIENMFRIELNKRSLHVSVQYIALDDLTLKEPKADEDKWKYYVTSYGLPHP 1364

Query: 1300 TEGISQEELQLPFLEKVLETEEDYGSDVDNFSID-KFSPEGVSKSTLKIKIDPETYLLDI 1358
            TEGIS E+L++PFLE+++E    +G D D   +D +FSPEG+S STL+IKI P TY L I
Sbjct: 1365 TEGISHEKLKIPFLERLIE----FGQDTDGREVDEEFSPEGISLSTLRIKIQPITYKLHI 1420

Query: 1359 EAGSYDVFSRKSVNRFPVIVDSNDYTTKKEKKKNMVIQFLESKKGWKKNLDDDQVKAIQE 1418
            E GSYDVF+RK+VN++P I + + +     +K  ++ +FLE+    + +L++     +QE
Sbjct: 1421 ENGSYDVFTRKAVNKYPTIANDDVHKEMVVQKTALISRFLENAIRSRNDLNEATKSGMQE 1480

Query: 1419 KLARVKE-NGSLDDFNEASQTQQASEIIAPSKVEQSKESTVADVNSLPKELVEAEDRGND 1477
            KLA +K     ++D NE  + +   ++ A  K EQ K    +D N +   +  A   GN 
Sbjct: 1481 KLALLKGVTAKVNDENEVKELKTEEDLAA--KQEQPKNLPTSDANVITSSISNAPQYGNA 1538

Query: 1478 TTADEVDP 1485
               +   P
Sbjct: 1539 EAGESPGP 1546

 Score =  283 bits (724), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 153/258 (59%), Positives = 170/258 (65%), Gaps = 21/258 (8%)

Query: 188 DAYYRPLNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKG 247
           D  YRPLNVKDALSYLEQVK+QF+SRPD+YN FLDIMKDFKSQAIDTPGVI+RVSTLF+G
Sbjct: 221 DPDYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRG 280

Query: 248 YPGLIQGFNTFLPQGYRIECSANPDEPIRVTTPMGSSSV--------AGTIENAVAGFPA 299
           YP LIQGFNTFLPQGYRIECS NPD+PIRVTTPMG+++V         GT++       +
Sbjct: 281 YPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPSGRGTVDGQEPSSLS 340

Query: 300 QPRIXXXXXXXXXXXXXXPEHVLPGVQVXXXXXXXXXXXXXXXXXXXXXXXXADYQLPLQ 359
           +P                P H LP V                          +    P  
Sbjct: 341 EP----------DGNAIQPFHNLPMVPSNVYRSEQSQDQKQSLPLSANSVGLSSIHPPEI 390

Query: 360 PAAGQQSQ---LPSNDQGKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQRE 416
           P   Q  Q   LP  +  KK  DVEFSQAI+YVNKIK RFA+QPDIYKHFLEILQTYQRE
Sbjct: 391 PPHHQILQGQSLPVQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQRE 450

Query: 417 QKPINEVYAQVTVLFQNA 434
           QKPINEVYAQVT LFQNA
Sbjct: 451 QKPINEVYAQVTHLFQNA 468

 Score = 52.8 bits (125), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 40/62 (64%)

Query: 199 ALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPGLIQGFNTF 258
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LF+  P L++ F  F
Sbjct: 419 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 478

Query: 259 LP 260
           LP
Sbjct: 479 LP 480

 Score = 38.5 bits (88), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 37/63 (58%)

Query: 370 SNDQGKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTV 429
           SND+      +    A++Y+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ 
Sbjct: 217 SNDEDPDYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVST 276

Query: 430 LFQ 432
           LF+
Sbjct: 277 LFR 279

>Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL004W
            (REAL)
          Length = 1561

 Score = 1233 bits (3189), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 617/1026 (60%), Positives = 765/1026 (74%), Gaps = 39/1026 (3%)

Query: 474  YYNETSPPTSRQNLPPLGSFSPPPNGAVPHNYYRDQQ----PQTLGLPPVAQVENHIDQR 529
            Y + T+    +QNLPP+GSFSPP NG+  H  ++DQQ    P  + LP + Q        
Sbjct: 552  YSHSTNGGIPQQNLPPIGSFSPPTNGSTTHEGFQDQQHMQPPHLMPLPSMVQ-------- 603

Query: 530  SPPHIATQGIAGEPMPVSNLRSQITAQ-SPSELAXXXXXXXXXXXPTANIPDGQYLDIAV 588
              P++  QGI  E +P+S+LR+ +T Q +PS                + I D QY D+ V
Sbjct: 604  QGPNMVHQGIVNENIPLSDLRTSLTDQYAPSNFQQQQQQQPS----ISPIIDSQYGDVPV 659

Query: 589  RPEIDLDPSIVPVVPEPTAPIEDSLTLVEETSFFDRAKKFIGNKQIYTEFLKILNLFSQD 648
            RPEIDLDPSIVPVVPEPT PIED+++L EE +FF++AK++IGNK +YTEFLKILNL+SQD
Sbjct: 660  RPEIDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQD 719

Query: 649  LLDVDELVGRVEHYLGGNKELFVWFKNFVGFQDKPKHIENIVHEKHRLDLDLCEACGPSY 708
            +LD+D+LV +V+ YLG NKELF WFKNFVG+Q+K K IEN+VHEKHRLDLDLCEA GPSY
Sbjct: 720  ILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCEAFGPSY 779

Query: 709  KKLPKSDTFMPCSGRDEMCWAVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERH 768
            K+LPKSDTFMPCSGRD+MCW VLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERH
Sbjct: 780  KRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERH 839

Query: 769  EYDFYIESNLRTIQTLETIASKIANMSEEEKATFKLPPGLGHTSLTIYKKVIRKVYDKER 828
            EYDFYIESNLRTIQ LETI +KI NM+E EKA FKLPPGLGHTS+TIYKKVIRKVYDKER
Sbjct: 840  EYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKER 899

Query: 829  GFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTF 888
            GFEIIDALHE+PA+  PVVLKRLKQKDEEWRRAQREWNKVWRELEQKVY+KSLDHLGLTF
Sbjct: 900  GFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTF 959

Query: 889  KQADKKLLTTKQLISEIGSIKTDQTNKRMHWLTPKPKDQLDYYVPDKSVFFDILSLTDTF 948
            KQADKKLLTTKQLISEI SIK DQTNK++HWLTPKPK QLD+  PDK +F+DIL L D+F
Sbjct: 960  KQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSF 1019

Query: 949  INHNSSYSNPDKIRLKDLFKIFVSLFFSIPMYEVNEAV-SRRGNLDDDKEDSTQKMESDN 1007
            I H ++YSNPDK RLKDL   F+SLFFSIP+ ++ EA+ S + NL D          +  
Sbjct: 1020 IAHTTAYSNPDKERLKDLLNYFISLFFSIPLEKIEEALQSYKQNLSDSSGSDDGDSSTPR 1079

Query: 1008 LNNSKRPREDEISLSEVLHRAKNQRFKSRAADXXXXXXXXXX----XXXXXXXXXXIRQE 1063
                KRP + E+SL ++LHR+K Q+ K R+ D                        I +E
Sbjct: 1080 ----KRPYQQEMSLLDILHRSKYQKLK-RSNDEDGKVPQLSEPLDEESNAIEEEELINEE 1134

Query: 1064 AKKPWLLGNLVEEVNAQGLINNRKTFNMFANTNIYVFFRHLTTLYERLEEVKKMNDAVTK 1123
            AK PWL GNLVEE N+QG+I NR  FN+FAN+NIY+FFRH TT+YERL E+K+MN+ VTK
Sbjct: 1135 AKNPWLTGNLVEEANSQGIIQNRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMNEKVTK 1194

Query: 1124 EINSRKVVQFAKDLNLISQQLKEMGLDFEGADAYEQLRHLCKRLIEGDIEHQWFEESLRQ 1183
            EI+ R +V FAKDL+L+S QL EMGLDF G DAY+Q+  L +RLI G++EHQWFEE LRQ
Sbjct: 1195 EISKRSMVTFAKDLDLLSSQLSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFEEGLRQ 1254

Query: 1184 AYNNKAFKLYTVDKVIQSLVKHAHTILTDSKTSEIMTSFEKDRTQINTSAKDQILYRLQV 1243
            AYNNKAFKLYT+DKVIQ LVKHAHT++TD+KT+EIM  F KDR    TSAKDQI+YRLQ 
Sbjct: 1255 AYNNKAFKLYTIDKVIQLLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQA 1314

Query: 1244 RSYMSSTENMFRIEYNKQSKNVRIQFIAVDDLTLAEPRSLEEKWRYYVTSYSLSHPTEGI 1303
            RSYMS+TENMFR+E+++++ +V +Q+IA+DDLTL EPR+ E+KW+YYVTSY+L HPTEGI
Sbjct: 1315 RSYMSNTENMFRMEFDRRNLHVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPHPTEGI 1374

Query: 1304 SQEELQLPFLEKVLETEEDYGSDVDNFSID-KFSPEGVSKSTLKIKIDPETYLLDIEAGS 1362
            S E+L++PFLE+++E    YG D D   +D KFSPEG+S STLKIKI P TY L IE+GS
Sbjct: 1375 SHEKLKIPFLERLIE----YGQDTDGREVDEKFSPEGLSVSTLKIKIQPVTYKLHIESGS 1430

Query: 1363 YDVFSRKSVNRFPVIVDSNDYTTKKEKKKNMVIQFLESKKGWKKNLDDDQVKAIQEKLAR 1422
            YDVF+RK+ N++P + + + +     KK  ++ +FL++    + +L++ +  ++QEKL  
Sbjct: 1431 YDVFTRKAANKYPTVANDDIHKEMVVKKTGLISKFLDNAIRLRNDLNETKKLSMQEKLDS 1490

Query: 1423 VK---ENGSLDDFNEASQTQQASEIIAPSKVEQSKESTVADVNSLPKELVEAEDRGNDTT 1479
            +K       +DD    ++ ++A E    +K EQ +    +D++ LP  +       N   
Sbjct: 1491 LKGATTKADVDDKITVAKNEKAIE----AKEEQQENLPTSDMHVLPSSIANVPQDDNTEV 1546

Query: 1480 ADEVDP 1485
                 P
Sbjct: 1547 TGNTGP 1552

 Score =  191 bits (486), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 95/103 (92%)

Query: 188 DAYYRPLNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKG 247
           D  YRPLNVKDALSYLEQVK+QFNSRPD+YN FLDIMKDFKSQAIDTPGVI+RVSTLF+G
Sbjct: 64  DPDYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRG 123

Query: 248 YPGLIQGFNTFLPQGYRIECSANPDEPIRVTTPMGSSSVAGTI 290
           YP LIQGFNTFLPQGYRIECS NPD+PIRVTTPMG+++V   +
Sbjct: 124 YPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNV 166

 Score =  115 bits (289), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 67/90 (74%), Gaps = 1/90 (1%)

Query: 365 QSQ-LPSNDQGKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEV 423
           QSQ L + +  KK  DVEFSQAI+YVNKIK RFA+QPDIYKHFLEILQTYQREQKPINEV
Sbjct: 238 QSQPLTAQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEV 297

Query: 424 YAQVTVLFQNAXXXXXXXXXXXXXSSPSAN 453
           YAQVT LFQNA             SS SAN
Sbjct: 298 YAQVTHLFQNAPDLLEDFKKFLPDSSASAN 327

 Score = 53.1 bits (126), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 43/72 (59%), Gaps = 3/72 (4%)

Query: 199 ALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPGLIQGFNTF 258
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LF+  P L++ F  F
Sbjct: 259 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 318

Query: 259 LPQGYRIECSAN 270
           LP       SAN
Sbjct: 319 LPDS---SASAN 327

 Score = 36.6 bits (83), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 36/63 (57%)

Query: 370 SNDQGKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTV 429
           +ND+      +    A++Y+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+ 
Sbjct: 60  TNDEDPDYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVST 119

Query: 430 LFQ 432
           LF+
Sbjct: 120 LFR 122

 Score = 33.1 bits (74), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 45/98 (45%), Gaps = 15/98 (15%)

Query: 595 DPSIVPVVPEPTAPIEDS--LTLVEET------------SFFDRAK-KFIGNKQIYTEFL 639
           +PS +P + +P  PI  S  LT  E+             S+ ++ K +F     IY  FL
Sbjct: 222 NPSGLPSIHQPELPIPQSQPLTAQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFL 281

Query: 640 KILNLFSQDLLDVDELVGRVEHYLGGNKELFVWFKNFV 677
           +IL  + ++   ++E+  +V H      +L   FK F+
Sbjct: 282 EILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFL 319

>Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL004W
            (REAL)
          Length = 1566

 Score = 1230 bits (3182), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 611/993 (61%), Positives = 754/993 (75%), Gaps = 40/993 (4%)

Query: 467  PAFGLSAYYNETSPPTSRQNLPPLGSFSPPPNGAVPHNYYRDQQ----PQTLGLPPVAQV 522
            PA     + N    P  +QNLPP+GSFSPP NG+  H  Y+DQQ    P  + LP + Q 
Sbjct: 554  PASSYYGHSNNRGIP--QQNLPPIGSFSPPTNGSTVHENYQDQQHMQPPHLMPLPSMVQ- 610

Query: 523  ENHIDQRSPPHIATQGIAGEPMPVSNLRSQITAQ-SPSELAXXXXXXXXXXXPTANIPDG 581
                      +I  QGIA E +P+S+LR+ +T Q +PS +            P AN    
Sbjct: 611  -------HGANIVHQGIANENLPLSDLRTSLTEQYAPSNIQQQQQQHPQSISPIAN---S 660

Query: 582  QYLDIAVRPEIDLDPSIVPVVPEPTAPIEDSLTLVEETSFFDRAKKFIGNKQIYTEFLKI 641
            QY D+ VRPEIDLDPSIVPVVPEPT PIED+++L EE +FF++AK++IGNK +YTEFLKI
Sbjct: 661  QYGDVPVRPEIDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKI 720

Query: 642  LNLFSQDLLDVDELVGRVEHYLGGNKELFVWFKNFVGFQDKPKHIENIVHEKHRLDLDLC 701
            LNL+SQD+LD+D+LV +V+ YLG NKELF WFKNFVG+Q++ K IENIVHEKHRLDLDLC
Sbjct: 721  LNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQERTKFIENIVHEKHRLDLDLC 780

Query: 702  EACGPSYKKLPKSDTFMPCSGRDEMCWAVLNDEWVGHPVWASEDSGFIAHRKNQYEETLF 761
            EA GPSYK+LPKSDTFMPCSGRD+MCW VLNDEWVGHPVWASEDSGFIAHRKNQYEETLF
Sbjct: 781  EAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLF 840

Query: 762  KIEEERHEYDFYIESNLRTIQTLETIASKIANMSEEEKATFKLPPGLGHTSLTIYKKVIR 821
            KIEEERHEYDFYIESNLRTIQ LETI +KI NM+E EK  FKLPPGLGHTS+TIYKKVIR
Sbjct: 841  KIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKVNFKLPPGLGHTSMTIYKKVIR 900

Query: 822  KVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSL 881
            KVYDKERGFEIIDALHE+PA+  PVVLKRLKQKDEEWRRAQREWNKVWRELEQKV++KSL
Sbjct: 901  KVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSL 960

Query: 882  DHLGLTFKQADKKLLTTKQLISEIGSIKTDQTNKRMHWLTPKPKDQLDYYVPDKSVFFDI 941
            DHLGLTFKQADKKLLTTKQLISEI SIK DQTNK++HWLTPKPK QLD+  PDK++F DI
Sbjct: 961  DHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFCDI 1020

Query: 942  LSLTDTFINHNSSYSNPDKIRLKDLFKIFVSLFFSIPMYEVNEAVSRRGNLDDDKEDSTQ 1001
            L L D+FI+H ++YSNPDK RLKDL K F+SLFFSI + E+ E++           +S+ 
Sbjct: 1021 LYLADSFISHTTAYSNPDKERLKDLLKYFISLFFSISLEEIEESLQA---YKQSVSESSG 1077

Query: 1002 KMESDNLNNSKRPREDEISLSEVLHRAKNQRFKSRAADXXXXXXXXXXX----XXXXXXX 1057
              +  +  + KR  + E++L ++LHR++ Q+ K R+ D                      
Sbjct: 1078 SDDGGSSVSRKRSYQQEMTLLDILHRSRYQKLK-RSKDEDGKVPQLSEAPDEESNIIEEE 1136

Query: 1058 XXIRQEAKKPWLLGNLVEEVNAQGLINNRKTFNMFANTNIYVFFRHLTTLYERLEEVKKM 1117
              I +EAK PWL GNLVEE N+QG+I NR  FN+FANTNIY+FFRH TT+YERL E+K+M
Sbjct: 1137 ELINEEAKNPWLTGNLVEEANSQGMIQNRGIFNLFANTNIYIFFRHWTTIYERLLEIKQM 1196

Query: 1118 NDAVTKEINSRKVVQFAKDLNLISQQLKEMGLDFEGADAYEQLRHLCKRLIEGDIEHQWF 1177
            N+ VTKEIN+R  V FAKDL+L+S QL EMGLDF G DAY+Q+  L +RLI GD+EHQWF
Sbjct: 1197 NEKVTKEINTRSTVTFAKDLDLLSNQLSEMGLDFIGEDAYKQVLKLSRRLINGDLEHQWF 1256

Query: 1178 EESLRQAYNNKAFKLYTVDKVIQSLVKHAHTILTDSKTSEIMTSFEKDRTQINTSAKDQI 1237
            EESLRQAYNN+AFKLYT+DKV QSLVKHAHT++TD+KT+EIM  F KDR    TSAK QI
Sbjct: 1257 EESLRQAYNNRAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNVTTTSAKGQI 1316

Query: 1238 LYRLQVRSYMSSTENMFRIEYNKQSKNVRIQFIAVDDLTLAEPRSLEEKWRYYVTSYSLS 1297
            +YRLQVRS+MS+TENMFRIE++K++ +V IQ+IA+DDLTL EP+  E+KW+YYVTSY+L 
Sbjct: 1317 IYRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKEDEDKWKYYVTSYALP 1376

Query: 1298 HPTEGISQEELQLPFLEKVLETEEDYGSDVDNFSID-KFSPEGVSKSTLKIKIDPETYLL 1356
            HPTEG+  E+L++PFLE+++E    +G D+D   +D KFSPEG+S STLKIKI P TY L
Sbjct: 1377 HPTEGVLHEKLKIPFLERLIE----FGQDIDGKDVDEKFSPEGISVSTLKIKIQPTTYKL 1432

Query: 1357 DIEAGSYDVFSRKSVNRFPVIVDSNDYTTKKEKKKNMVIQFLESKKGWKKNLDDDQVKAI 1416
            DIE GSYDVF+RKS N++P + + + +     +KK ++ +FL+     + +L++ Q  ++
Sbjct: 1433 DIENGSYDVFTRKSANKYPTVANDDTHKEVVVQKKELISRFLDCAVHLRNDLNESQKISM 1492

Query: 1417 QEKLARVKE-------NGSLDD--FNEASQTQQ 1440
            QEK   +K+       +G + D    EA++T+Q
Sbjct: 1493 QEKFESLKDTTAKLNVDGQVVDTKIEEATKTKQ 1525

 Score =  278 bits (711), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 157/271 (57%), Positives = 173/271 (63%), Gaps = 15/271 (5%)

Query: 191 YRPLNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPG 250
           YRPLNVKDALSYLEQVK+QF+SRPD+YN FLDIMKDFKSQAIDTPGVI+RVSTLF+GYP 
Sbjct: 229 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 288

Query: 251 LIQGFNTFLPQGYRIECSANPDEPIRVTTPMGSSSVAGTIENAVAG-FPAQ-----PRIX 304
           LIQGFNTFLPQGYRIECS NPD+PIRVTTPMG+++V   I     G   AQ     P   
Sbjct: 289 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNISPPERGTIDAQEPSSLPEAD 348

Query: 305 XXXXXXXXXXXXXPEHVLPGVQVXXXXXXX-XXXXXXXXXXXXXXXXXADYQLP-LQPAA 362
                        P +V    Q                            +Q+P +QP A
Sbjct: 349 GNGTQRSHNVPMVPSNVYHSEQNQDQQQVLPLSATSTGLPSIQQSEIPVHHQIPQIQPLA 408

Query: 363 GQQSQLPSNDQGKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINE 422
            Q+         KK  DVEFSQAI+YVNKIK RFA+QPDIYKHFLEILQTYQREQKPINE
Sbjct: 409 VQED-------VKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINE 461

Query: 423 VYAQVTVLFQNAXXXXXXXXXXXXXSSPSAN 453
           VYAQVT LFQNA             SS SAN
Sbjct: 462 VYAQVTHLFQNAPDLLEDFKKFLPDSSASAN 492

>TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1512

 Score = 1222 bits (3161), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 582/855 (68%), Positives = 699/855 (81%), Gaps = 4/855 (0%)

Query: 580  DGQY-LDIAVRPEIDLDPSIVPVVPEPTAPIEDSLTLVEETSFFDRAKKFIGNKQIYTEF 638
            DG Y  DI+VRPEIDLDPSIVPV+PEP  PIEDSL+LVEET+FFD+AKKFI NKQIY EF
Sbjct: 613  DGGYPQDISVRPEIDLDPSIVPVIPEPVEPIEDSLSLVEETNFFDKAKKFINNKQIYMEF 672

Query: 639  LKILNLFSQDLLDVDELVGRVEHYLGGNKELFVWFKNFVGFQDKPKHIENIVHEKHRLDL 698
            LKILNL+SQ++L+V+ELV +V++YLG NKELF WFK FVG+QDKPKHIENIVHEKH+LDL
Sbjct: 673  LKILNLYSQNILNVNELVEKVQYYLGSNKELFDWFKGFVGYQDKPKHIENIVHEKHKLDL 732

Query: 699  DLCEACGPSYKKLPKSDTFMPCSGRDEMCWAVLNDEWVGHPVWASEDSGFIAHRKNQYEE 758
            DLCEA GPSYKKLPK+DTFMPCSGRDEMCW VLND+WVGHPVWASEDSGFIAHRKNQYEE
Sbjct: 733  DLCEAYGPSYKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWASEDSGFIAHRKNQYEE 792

Query: 759  TLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMSEEEKATFKLPPGLGHTSLTIYKK 818
            TLFKIEEERHEYDFYIESNLRTIQTLETIASKIANM+EEE+A FKLP GLGHTS+TIY+K
Sbjct: 793  TLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEERANFKLPIGLGHTSVTIYQK 852

Query: 819  VIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYY 878
            VIRKVY KERGFE+IDALHEYPA+AVP++LKRLKQKDEEWRRAQREWNKVWREL+QKVYY
Sbjct: 853  VIRKVYGKERGFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQREWNKVWRELQQKVYY 912

Query: 879  KSLDHLGLTFKQADKKLLTTKQLISEIGSIKTDQTNKRMHWLTPKPKDQLDYYVPDKSVF 938
            KSLDHLGLTFKQADKKLLTTKQLISEI SIK DQTNK++HWLTPKPK QLDY V D+ + 
Sbjct: 913  KSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKLHWLTPKPKSQLDYKVADRQIL 972

Query: 939  FDILSLTDTFINHNSSYSNPDKIRLKDLFKIFVSLFFSIPMYEVNEAVSRRGNLDDDKED 998
            +DIL LTD FINH S+YSNPDK RL+D  + F+SLFF IP+ ++  A+  R  LDD K D
Sbjct: 973  YDILKLTDVFINHTSNYSNPDKERLRDFLQSFISLFFFIPLADIKAAIKIRSPLDDTKTD 1032

Query: 999  STQKM-ESDNLNNSKRPREDEISLSEVLHRAKNQRFKSRAADXXXXXXXXXXXXXXXXXX 1057
            S +   +SD     +   +D+IS  ++L + K Q+ K +  D                  
Sbjct: 1033 SEESSGDSDKFPKKRSIEDDDISFHDILDKVKYQKVK-QGLDKNETFSNDISSATSVDDD 1091

Query: 1058 XXIRQEAKKPWLLGNLVEEVNAQGLINNRKTFNMFANTNIYVFFRHLTTLYERLEEVKKM 1117
              IRQEA+KPWLLG++V++ N+ G+I NR  +N+F NTNIYVF RHL TLYERL E K+M
Sbjct: 1092 ELIRQEAQKPWLLGSIVDDANSLGIIQNRSKYNIFGNTNIYVFIRHLITLYERLNEAKQM 1151

Query: 1118 NDAVTKEINSRKVVQFAKDLNLISQQLKEMGLDFEGADAYEQLRHLCKRLIEGDIEHQWF 1177
            N  VT+EI +R +V FAKDLNL+S QLK MGLDFEG D+Y+QL  L  RLIEG++EH WF
Sbjct: 1152 NAEVTEEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSYKQLLDLSTRLIEGNLEHHWF 1211

Query: 1178 EESLRQAYNNKAFKLYTVDKVIQSLVKHAHTILTDSKTSEIMTSFEKDRTQINTSAKDQI 1237
            EESLRQA+ NKAFKLYT+DKV QS+VKHAHTI++D+KT+EIM   EKDR+   TS+KDQI
Sbjct: 1212 EESLRQAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAEIMMLMEKDRSCATTSSKDQI 1271

Query: 1238 LYRLQVRSYMSSTENMFRIEYNKQSKNVRIQFIAVDDLTLAEPRSLEEKWRYYVTSYSLS 1297
            LYRLQ RS+MS+T+NMFRIE+NK S N+ IQ+I +DDLTL EP++ EEKW+YY+TSY+LS
Sbjct: 1272 LYRLQARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTLGEPKTAEEKWKYYITSYALS 1331

Query: 1298 HPTEGISQEELQLPFLEKVLETEEDYGSDVDNFSIDKFSPEGVSKSTLKIKIDPETYLLD 1357
            HPTEG+ QEE+Q+PFLEK+LETEE Y  + +  + DK+SP+GVS+S LKIKI PE Y L+
Sbjct: 1332 HPTEGVPQEEIQIPFLEKILETEEAYAEEEEVIN-DKYSPKGVSQSDLKIKISPENYALE 1390

Query: 1358 IEAGSYDVFSRKSVNRFPVIVDSNDYTTKKEKKKNMVIQFLESKKGWKKNLDDDQVKAIQ 1417
            IE GS+D FSR S+N++P+ V S+DY  KK+   + V  FL  K GWK++L +D++  I 
Sbjct: 1391 IEPGSFDTFSRLSMNKYPIDVTSDDYKNKKKLSIDRVNAFLNGKFGWKQSLSEDEINNIN 1450

Query: 1418 EKLARVKENGSLDDF 1432
             K + +K+ GSL ++
Sbjct: 1451 LKYSHIKKYGSLKNY 1465

 Score =  188 bits (478), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 111/147 (75%), Gaps = 7/147 (4%)

Query: 146 ASFDNPLPPQQQTILSSSHFQVLPPHXXXXXXXXXXXXXXXHDA------YYRPLNVKDA 199
           ASFDNPLP + +T  + S  +   P+               +D+      +YRPLNVKDA
Sbjct: 92  ASFDNPLPVKTETTPAISA-ETSIPNVNTTYSATAGTTASANDSKESDEQFYRPLNVKDA 150

Query: 200 LSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPGLIQGFNTFL 259
           L+YLEQVK QF+SRPD+YNHFLDIMKDFKSQ+IDTPGVI+RVSTLF+GYP LIQGFNTFL
Sbjct: 151 LTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPSLIQGFNTFL 210

Query: 260 PQGYRIECSANPDEPIRVTTPMGSSSV 286
           PQGY IEC+ NP++PI+VTTP+GS ++
Sbjct: 211 PQGYTIECTNNPNDPIKVTTPIGSETI 237

 Score =  105 bits (263), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 52/78 (66%), Positives = 64/78 (82%), Gaps = 1/78 (1%)

Query: 357 PLQPAAGQQSQLPSNDQGKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQRE 416
           P+QP     +Q  +    +K ADVEFSQA++YVNKIKNRF ++PDIYK FLEILQTYQ+E
Sbjct: 330 PIQPNMHNMTQ-DTMKITEKPADVEFSQAVSYVNKIKNRFVDEPDIYKTFLEILQTYQKE 388

Query: 417 QKPINEVYAQVTVLFQNA 434
           QKPI+EVY+QVT+LFQNA
Sbjct: 389 QKPIHEVYSQVTILFQNA 406

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 37/62 (59%)

Query: 199 ALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPGLIQGFNTF 258
           A+SY+ ++K +F   PD+Y  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 357 AVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQNAPDLLDDFKKF 416

Query: 259 LP 260
           LP
Sbjct: 417 LP 418

 Score = 40.0 bits (92), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 32/48 (66%)

Query: 385 AINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 432
           A+ Y+ ++K +F+ +PDIY HFL+I++ ++ +      V  +V+ LF+
Sbjct: 150 ALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFR 197

>TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6.29
            YOL004W
          Length = 1739

 Score = 1208 bits (3125), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 586/914 (64%), Positives = 716/914 (78%), Gaps = 13/914 (1%)

Query: 583  YLDIAVRPEIDLDPSIVPVVPEPTAPIEDSLTLVEETSFFDRAKKFIGNKQIYTEFLKIL 642
            Y + AVRPEIDLDPS+VP+VPEPT PIED+L LVEET+FFD+ KK+IGNK IY EFLK+L
Sbjct: 825  YEENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAEFLKVL 884

Query: 643  NLFSQDLLDVDELVGRVEHYLGGNKELFVWFKNFVGFQDKPKHIENIVHEKHRLDLDLCE 702
            NL+S DLL+VDELV ++++YL  N+ELF WFKNFVG+ +KPKHIENIVHEKH+LDLDLCE
Sbjct: 885  NLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLDLDLCE 944

Query: 703  ACGPSYKKLPKSDTFMPCSGRDEMCWAVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK 762
            ACGPSYKKLPK+DT MPCSGRDEMCW +LNDEWVGHPVWASEDSGFIAHRK   ++   +
Sbjct: 945  ACGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTKKPYLR 1004

Query: 763  IEEERHEYDFYIESNLRTIQTLETIASKIANMSEEEKATFKLPPGLGHTSLTIYKKVIRK 822
            ++++ HEYDFYIESNLRTIQTLETIASKIANM+E EK  FKLP GLGHT+ TIYKKVIRK
Sbjct: 1005 LKKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYKKVIRK 1064

Query: 823  VYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLD 882
            VYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKV++KSLD
Sbjct: 1065 VYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLD 1124

Query: 883  HLGLTFKQADKKLLTTKQLISEIGSIKTDQTNKRMHWLTPKPKDQLDYYVPDKSVFFDIL 942
            HLGLTFKQADKKLLTTKQLISEI SIK DQT+KRMHWLTPKPK QLD+ +PDK + FDIL
Sbjct: 1125 HLGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDIIFDIL 1184

Query: 943  SLTDTFINHNSSYSNPDKIRLKDLFKIFVSLFFSIPMYEVNEAVSRRGNLDDDKEDSTQK 1002
            S  + F+ H S+YSNP+K RL D  K F SLFFSIP+ E+ EA+S+R   + + E    K
Sbjct: 1185 SFVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRDITEKNDEKLEDK 1244

Query: 1003 MESDNLNNSKRPRED-EISLSEVLHRAKNQRFK-SRAADXXXXXXXXXXXXXXXXXXXXI 1060
             ++   N+ KR   D  +SL ++L R K QR K    +D                    +
Sbjct: 1245 QKNGEENSKKRTSRDITLSLEDILQRTKYQRLKYGDDSDEVDGHGNRHDDQKLLEEEELL 1304

Query: 1061 RQEAKKPWLLGNLVEEVNAQGLINNRKTFNMFANTNIYVFFRHLTTLYERLEEVKKMNDA 1120
            RQEAKKPWLLG LVEE NAQG I +R  FNMF+NTN+Y+F RHLTT+YERL E+K+MND 
Sbjct: 1305 RQEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLTTMYERLHEIKQMNDK 1364

Query: 1121 VTKEINSRKVVQFAKDLNLISQQLKEMGLDFEGADAYEQLRHLCKRLIEGDIEHQWFEES 1180
            V++EI+ RK+ +FAKDLNLIS QL EMGLDF   D Y+QL  LCKRLI GD+EHQWFEES
Sbjct: 1365 VSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCKRLILGDLEHQWFEES 1424

Query: 1181 LRQAYNNKAFKLYTVDKVIQSLVKHAHTILTDSKTSEIMTSFEKDRTQINTSAKDQILYR 1240
            LRQA+NNKAFKLYT+DKV Q+LVKHAHTI++D KT+EIM  FEKDRT+ +TS+KDQILYR
Sbjct: 1425 LRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKDRTKNSTSSKDQILYR 1484

Query: 1241 LQVRSYMSSTENMFRIEYNKQSKNVRIQFIAVDDLTLAEPRSLEEKWRYYVTSYSLSHPT 1300
            LQ R+ M+  ENMFRIEYN  +K++ IQ+IA+DDLT+ + ++LEEKW+YY+TSY+LSHPT
Sbjct: 1485 LQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEEKWKYYITSYALSHPT 1544

Query: 1301 EGISQEELQLPFLEKVLETEEDYGSDVDN-----FSIDKFSPEGVSKSTLKIKIDPETYL 1355
            EGI QE +Q+PFLE+++E E+ Y  +  +      S+ K+SPEG+S STLKIKIDP+ Y 
Sbjct: 1545 EGIFQENIQIPFLERIIEEEQLYEDEETDDQKQTKSLMKYSPEGISGSTLKIKIDPQNYC 1604

Query: 1356 LDIEAGSYDVFSRKSVNRFPVIVDSNDYTTKKEKKKNMVIQFLESKKGWKKNLDDDQVKA 1415
            L+IE GS+D+FSRKS+N+FPV +  +       K KN V +FL SK GWK+ +  DQ+++
Sbjct: 1605 LNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNSKMGWKRAISKDQMES 1664

Query: 1416 IQEKLARVKENGSLDDFNEAS--QTQQASEIIAPSKVEQSKESTVAD-VNSLPKELVEAE 1472
            I+ K   +  NG+L+ + E S  +    ++I   SK+   K  TV +  N +P +  + E
Sbjct: 1665 IESKWDHLSNNGNLEGYQEKSILKDVNGTDI---SKISPMKTFTVTESANGVPNDKADGE 1721

Query: 1473 DRGNDTTADEVDPE 1486
            +RGNDTTA+EV  E
Sbjct: 1722 ERGNDTTAEEVGNE 1735

 Score =  192 bits (488), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 86/108 (79%), Positives = 96/108 (88%)

Query: 188 DAYYRPLNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKG 247
           D  YRPLNVKDALSYLEQVK+QFNSRPDVYNHFLDIMKDFKSQAIDTPGVI RVS+LF  
Sbjct: 296 DNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHD 355

Query: 248 YPGLIQGFNTFLPQGYRIECSANPDEPIRVTTPMGSSSVAGTIENAVA 295
           YP LIQGFNTFLPQGYRIECS+NP+ PI V TPMG+++V+G +E +V 
Sbjct: 356 YPSLIQGFNTFLPQGYRIECSSNPNLPITVITPMGTTTVSGVLETSVT 403

 Score =  126 bits (317), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 82/134 (61%), Gaps = 11/134 (8%)

Query: 375 KKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNA 434
           ++T DVEFSQAI+YVNKIKNRFA QP IYKHFLEILQTYQREQKPINEVY+QVTVLFQ A
Sbjct: 538 RRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEA 597

Query: 435 XXXXXXXXXXXXXSSPSANRXXXXXXXXXXXSPAFGLSAYYNETSP---PTSR---QNLP 488
                        SS + N               F  +  +N+  P   P S    QNLP
Sbjct: 598 PDLLEDFKKFLPDSSANNNGSIVTSQEEN-----FMYANGFNQQQPHLTPHSEIQAQNLP 652

Query: 489 PLGSFSPPPNGAVP 502
           PLGSFS  PNG  P
Sbjct: 653 PLGSFSTQPNGVFP 666

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 40/62 (64%)

Query: 199 ALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPGLIQGFNTF 258
           A+SY+ ++K +F ++P +Y HFL+I++ ++ +      V  +V+ LF+  P L++ F  F
Sbjct: 548 AISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLLEDFKKF 607

Query: 259 LP 260
           LP
Sbjct: 608 LP 609

 Score = 41.6 bits (96), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 41/71 (57%), Gaps = 5/71 (7%)

Query: 368 LPSNDQGKKTADVEF-----SQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINE 422
           +P+N Q     D ++       A++Y+ ++K +F  +PD+Y HFL+I++ ++ +      
Sbjct: 285 MPNNTQDSPKEDNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPG 344

Query: 423 VYAQVTVLFQN 433
           V A+V+ LF +
Sbjct: 345 VIARVSSLFHD 355

 Score = 33.9 bits (76), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 39/82 (47%), Gaps = 12/82 (14%)

Query: 75  LPSISDLSGESAHNGKDGLTSSNTPLRLPSVQSTYGSKAPGAGQEVNGT--IMESTVNPA 132
           LPSISDL+ ES     + + + +  L+ PS+  +    +   G   + T  I     NP 
Sbjct: 79  LPSISDLNVES-----NVMVNQHQQLQHPSISPSQNMTSMNTGIMNSNTSGISRHNSNPT 133

Query: 133 PAQGRQNSVGLSFASFDNPLPP 154
           P      S  L  +SFDNPLPP
Sbjct: 134 PK-----SNPLKVSSFDNPLPP 150

>KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} similar to
            uniprot|Q75CF0 Ashbya gossypii ACL004W ACL004Wp and
            weakly similar to YOL004W uniprot|P22579 Saccharomyces
            cerevisiae YOL004W SIN3 DNA binding protein involved in
            transcriptional regulation
          Length = 1519

 Score = 1169 bits (3023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 580/963 (60%), Positives = 710/963 (73%), Gaps = 35/963 (3%)

Query: 473  AYYNETSPPTSRQNLPPLGSFSPPPNGAVPHNYYRDQQPQTLGLPPVAQVENHI--DQRS 530
             +Y ++       NLPPLG+FS     +   N +         LP + Q   HI      
Sbjct: 559  GFYPQSGVLMQPTNLPPLGNFSASGQASPAENSHM--------LPSMHQ---HIAGGHVI 607

Query: 531  PPHIATQGIAGEPMPVSNLRSQITAQSPSELAXXXXXXXXXXXPTANIPDGQYLDIAV-R 589
            P H+ TQG++ + +PVS +RS  T                   P   +   QY++  + R
Sbjct: 608  PQHVVTQGMSNQDIPVSEMRS--TMNGTYNQVEYIQGAPGYPQPLEGV---QYMEAPMAR 662

Query: 590  PEIDLDPSIVPVVPEPTAPIEDSLTLVEETSFFDRAKKFIGNKQIYTEFLKILNLFSQDL 649
            PEIDLDPS+VPVVPEP  P ED++ L +E +FF+R K+FIGNKQ+Y EFLKILNL+SQDL
Sbjct: 663  PEIDLDPSLVPVVPEPIQPPEDAIALGDEVTFFERVKRFIGNKQVYAEFLKILNLYSQDL 722

Query: 650  LDVDELVGRVEHYLGGNKELFVWFKNFVGFQDKPKHIENIVHEKHRLDLDLCEACGPSYK 709
            L   ELV +VE YL  +KELF WFK+FVG+Q+KPKHIENIVHEKHRLDLDLCEACGPSYK
Sbjct: 723  LTTSELVSKVEFYLHSSKELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSYK 782

Query: 710  KLPKSDTFMPCSGRDEMCWAVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHE 769
            KLPK DTFMPCSGRDEMCW VLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFK+EEERHE
Sbjct: 783  KLPKDDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKVEEERHE 842

Query: 770  YDFYIESNLRTIQTLETIASKIANMSEEEKATFKLPPGLGHTSLTIYKKVIRKVYDKERG 829
            YDFYIESNLRTIQTLETIA+KIANM+ EEK  FKLPPGLGHTSLTIYKKV+RKVYDK+RG
Sbjct: 843  YDFYIESNLRTIQTLETIANKIANMTNEEKNNFKLPPGLGHTSLTIYKKVVRKVYDKDRG 902

Query: 830  FEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFK 889
            FEIIDALHE+PA+ VP+VLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFK
Sbjct: 903  FEIIDALHEHPAVTVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFK 962

Query: 890  QADKKLLTTKQLISEIGSIKTDQTNKRMHWLTPKPKDQLDYYVPDKSVFFDILSLTDTFI 949
            QADKKLLTTKQL+SEI SIK DQTNKR+H LTPKPK QLD+ + D+ V +DIL L  TF+
Sbjct: 963  QADKKLLTTKQLLSEISSIKVDQTNKRIHPLTPKPKSQLDFEINDREVLYDILDLVFTFV 1022

Query: 950  NHNSSYSNPDKIRLKDLFKIFVSLFFSIPMYEVNEAVSRRGNLDDDKEDSTQKMESDNLN 1009
              N+SYSN DKI+L   FK F+SLFFS P+ +VNEAVS R ++ D +       +SD+  
Sbjct: 1023 KTNASYSNSDKIKLDHFFKAFISLFFSYPIKDVNEAVSERSSITDQENGEEDSNKSDSEK 1082

Query: 1010 NSKRPREDEIS--LSEVLHRAKNQRFKSRAADXXXXXXXXXXXXXXXXXXXXIRQEAKKP 1067
            ++KR   DE S  + ++L R KN    ++ ++                    + +EA KP
Sbjct: 1083 SNKRTLSDEDSYLMKDILRRTKN----AKTSNSEENQNSSSVKSNEEDETELLAKEAAKP 1138

Query: 1068 WLLGNLVEEVNAQGLINNRKTFNMFANTNIYVFFRHLTTLYERLEEVKKMNDAVTKEINS 1127
            WLLG+L++E N  G++++R  FN+F NT IYVFFRHL TLYERL EVKK++  VT EI +
Sbjct: 1139 WLLGSLIDEANNSGIVSDRHIFNLFTNTTIYVFFRHLNTLYERLLEVKKIDAEVTDEIKN 1198

Query: 1128 RKVVQFAKDLNLISQQLKEMGLDFEGADAYEQLRHLCKRLIEGDIEHQWFEESLRQAYNN 1187
            RK+VQFA DLNLIS QL +MGL F+   AY +L  L KRLI GD++HQWFEESLRQAY N
Sbjct: 1199 RKIVQFASDLNLISTQLADMGLAFKDTKAYGELLRLSKRLITGDLDHQWFEESLRQAYKN 1258

Query: 1188 KAFKLYTVDKVIQSLVKHAHTILTDSKTSEIMTSFEKDRTQINTSAKDQILYRLQVRSYM 1247
            KAFK+YT+DKV+QSLVKHAH+I+TD K + +M  FE+DR + +T+AKDQILYRL+VR+ M
Sbjct: 1259 KAFKIYTIDKVVQSLVKHAHSIITDPKNAMVMVLFEQDRLKRDTTAKDQILYRLKVRNTM 1318

Query: 1248 SSTENMFRIEYNKQSKNVRIQFIAVDDLTLAEPRSLEEKWRYYVTSYSLSHPTEGISQEE 1307
              +ENMFRIEYN  S +V IQ++AVDDLTL EP++++EKW YYVTSYSLSHPTEGI+QE+
Sbjct: 1319 GESENMFRIEYNTDSSHVSIQYVAVDDLTLKEPQNMKEKWDYYVTSYSLSHPTEGITQED 1378

Query: 1308 LQLPFLEKVLETEEDYGSDVDNFSIDKFSPEGVSKSTLKIKIDPETYLLDIEAGSYDVFS 1367
            +  PFL K++E E +Y  D +    DKFSPEGVS+S LK+ I PETY L  E GS DVF+
Sbjct: 1379 ISQPFLGKIIEKEAEYLDDEEQN--DKFSPEGVSQSKLKVNIHPETYELTFECGSTDVFT 1436

Query: 1368 RKSVNRFPVIVDSNDYTTKKEKKKNMVIQFLESKKGWKKNLDDDQVKAIQEKLARVKENG 1427
            RKSVN+FP        +++  +  + + +FL S KGWKKNL  + +   + K+  +KE G
Sbjct: 1437 RKSVNKFP--------SSQSTQPASKMDKFLNSSKGWKKNLSTEIIGRAESKMKILKEQG 1488

Query: 1428 SLD 1430
             L+
Sbjct: 1489 KLE 1491

 Score =  180 bits (456), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 89/95 (93%)

Query: 191 YRPLNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPG 250
           YRPLNVKDALSYLEQVK+QF+SRPDVYNHFLDIMKDFKSQAIDTPGVI RV+TLF+G+P 
Sbjct: 201 YRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPN 260

Query: 251 LIQGFNTFLPQGYRIECSANPDEPIRVTTPMGSSS 285
           LIQGFNTFLP GY+IECS NP++PI+VTTP G++ 
Sbjct: 261 LIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGTTG 295

 Score =  106 bits (265), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 58/73 (79%), Gaps = 3/73 (4%)

Query: 361 AAGQQSQLPSNDQGKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPI 420
             G    LP     +KT +VEFS AI+YVNKIK RFA+QPDIYK FLEILQTYQREQKPI
Sbjct: 409 GGGMLGALPGQ---QKTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPI 465

Query: 421 NEVYAQVTVLFQN 433
           +EVYAQVT+LFQN
Sbjct: 466 HEVYAQVTILFQN 478

 Score = 49.3 bits (116), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 38/62 (61%)

Query: 199 ALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPGLIQGFNTF 258
           A+SY+ ++K +F  +PD+Y  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 430 AISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNNPDLLDDFKKF 489

Query: 259 LP 260
           LP
Sbjct: 490 LP 491

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 33/48 (68%)

Query: 385 AINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 432
           A++Y+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +VT LFQ
Sbjct: 209 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQ 256

>Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] {ON}
            YOL004W (SIN3) - DNA binding protein involved in
            transcriptional regulation [contig 185] FULL
          Length = 1541

 Score = 1160 bits (3002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 595/1018 (58%), Positives = 724/1018 (71%), Gaps = 76/1018 (7%)

Query: 485  QNLPPLGSFSPPPNGAVPHNYYRDQ---------QPQTLGLPPVAQVENHIDQRSPPHIA 535
            QNLPPLG+FSPP NG       RD          QP  L  PP  Q ++H       H+ 
Sbjct: 578  QNLPPLGNFSPPING-------RDNEAQVNLPAVQPPALDFPPQQQSQSH------RHVV 624

Query: 536  TQGIAGEPMPVSNLRSQITAQ-SPSELAXXXXXXXXXXXPTANIPDGQYLDIAVRPEIDL 594
             QG+    +PVS++R  +    +P  L                  D QY++   RPEIDL
Sbjct: 625  AQGMTNNSLPVSDMRGPVDGGFAPQPLYSQ---------------DVQYMEPTSRPEIDL 669

Query: 595  DPSIVPVVPEPTAPIEDSLTLVEETSFFDRAKKFIGNKQIYTEFLKILNLFSQDLLDVDE 654
            DPS+VPV+PEP  P+E+  TL+EETSFFD+AKK++GNKQ+YTEFLKILNLFSQDL+D DE
Sbjct: 670  DPSLVPVIPEPIRPLENDSTLIEETSFFDKAKKYMGNKQVYTEFLKILNLFSQDLIDTDE 729

Query: 655  LVGRVEHYLGGNKELFVWFKNFVGFQDKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKS 714
            LV +VEHYLGGN ELF WFK+FV + ++PKHIEN+VHEKHRLDLDLCEAC PSYKKLPK+
Sbjct: 730  LVDKVEHYLGGNSELFDWFKSFVNYVERPKHIENVVHEKHRLDLDLCEACCPSYKKLPKA 789

Query: 715  DTFMPCSGRDEMCWAVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYI 774
            DTFMPC GRDEMCW VLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD+YI
Sbjct: 790  DTFMPCCGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYI 849

Query: 775  ESNLRTIQTLETIASKIANMSEEEKATFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIID 834
            E+NLRTIQ LETIA+KI+NM+ EEK TFKLPPGLGHTS TIYKKVIRKVYDK+RGFEIID
Sbjct: 850  EANLRTIQLLETIANKISNMTVEEKKTFKLPPGLGHTSTTIYKKVIRKVYDKDRGFEIID 909

Query: 835  ALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKK 894
            ALHE PA++VP+VL+RLKQKDEEWRRAQREWNKVWRELEQKV+YKSLDHLGLTFKQADKK
Sbjct: 910  ALHENPAVSVPIVLRRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKK 969

Query: 895  LLTTKQLISEIGSIKTDQTNKRMHWLTPKPKDQLDYYVPDKSVFFDILSLTDTFINHNSS 954
            LLT KQLISEI SIK DQ NKR++  T KPK QLD+ + DK V FDIL+L DTFI+H+++
Sbjct: 970  LLTAKQLISEISSIKIDQANKRIYPFTSKPKSQLDFDISDKGVLFDILNLVDTFIDHSTT 1029

Query: 955  YSNPDKIRLKDLFKIFVSLFFSIPMYEVNEAVSRRGNLDDDKEDSTQKMESDNLNNSKRP 1014
            YSNPDK +L   F+ F+S+FFSIP+           +LD+  E+   K+E+ + +  KR 
Sbjct: 1030 YSNPDKEKLSAFFRGFLSIFFSIPL----------TDLDNPSEE--HKVENGD-STRKRS 1076

Query: 1015 REDEISLSEVLHRAKNQRFKSRAADXXXXXXXXXXXXXXXX----XXXXIRQEAKKPWLL 1070
            R+D+    ++L     Q  K  +                          +R +AKKPWLL
Sbjct: 1077 RDDDQFFRDLLKSKHKQAKKKTSQQEDESTSDDQDTAAKTSPDLEYEEAVRLDAKKPWLL 1136

Query: 1071 GNLVEEVNAQGLINNRKTFNMFANTNIYVFFRHLTTLYERLEEVKKMNDAVTKEINSRKV 1130
            GN+++E N  G ++NRKT+NMFANTNIYVFFRHLTT+Y+RL E K +N+ VTKEINSRKV
Sbjct: 1137 GNILDEANNHGFVSNRKTYNMFANTNIYVFFRHLTTMYQRLSEAKNINEEVTKEINSRKV 1196

Query: 1131 VQFAKDLNLISQQLKEMGLDFEGADAYEQLRHLCKRLIEGDIEHQWFEESLRQAYNNKAF 1190
            VQFAKDLNL S QL +MGLDF+GADAYEQL  LCKRLI+ DIEHQWFEESLRQAY NKAF
Sbjct: 1197 VQFAKDLNLASTQLSDMGLDFKGADAYEQLLALCKRLIQSDIEHQWFEESLRQAYKNKAF 1256

Query: 1191 KLYTVDKVIQSLVKHAHTILTDSKTSEIMTSFEKDRTQINTSAKDQILYRLQVRSYMSST 1250
            K+YTVDKVIQSLVKHAH+I+TD+KT+EIM  FEKDR    TS ++QILYRLQVRS M  T
Sbjct: 1257 KIYTVDKVIQSLVKHAHSIITDAKTAEIMILFEKDRKAPTTSTREQILYRLQVRSCMGLT 1316

Query: 1251 ENMFRIEYNKQSKNVRIQFIAVDDLTLAEPRSLEEKWRYYVTSYSLSHPTEGISQEELQL 1310
            ENMFRIE N  S +V IQF+AVDDLTL +P SL+++W+YY+TSYSLSHPTEG+  EE++ 
Sbjct: 1317 ENMFRIELNSTSAHVSIQFVAVDDLTLNQPNSLKDQWQYYLTSYSLSHPTEGVPHEEIKA 1376

Query: 1311 PFLEKVLETEEDYGSDVDNFSIDKFSPEGVSKSTLKIKIDPETYLLDIEAGSYDVFSRKS 1370
            PFLEK L  + D          + +SP G S S L+I+I+PE+Y L IE  S D+F+R +
Sbjct: 1377 PFLEKTLRDDGDSDE-----DSEWYSPGGQSVSQLRIQINPESYALQIEPNSKDLFTRST 1431

Query: 1371 VNRFPVIVDSNDYTTKKEKKKNMVIQFLESKKGWKKNLDDDQVKAIQEKLARVKENGSLD 1430
            VN+ P  +        K  +K++    + S+ GWKK L ++ +   +  +  VK  G L 
Sbjct: 1432 VNKHPTKIGEASGRDAKTMQKSLA-DMVNSEHGWKKGLQNESIGKAESIINFVKARGFL- 1489

Query: 1431 DFNEASQTQQASEIIAPSKVEQSKESTVADVNSLPKELVEAEDRGNDT--TADEVDPE 1486
                    ++A+ +    KVE+   ++    N    E    E  G+DT   ADE   E
Sbjct: 1490 --------EKATTVSPDPKVEKEHSAS----NGAIPEGATTEKPGDDTDLRADETTAE 1535

 Score =  176 bits (447), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 117/261 (44%), Positives = 140/261 (53%), Gaps = 63/261 (24%)

Query: 55  GKTPEMTKQEIKVESKPHVTLPSISDLSGESAHNGKDGLTSSNTPLRLPSVQSTYGSKAP 114
           G+ P++ +Q        HV LPS+S L  E+    + G ++     RLP +Q      A 
Sbjct: 154 GQPPQLPQQ--------HVVLPSLSGL--ETGGRAEYGASAQ----RLPFMQGAAPQSAS 199

Query: 115 GAGQEVNGTIMESTVNPAPAQGRQNSVGLSFASFDNPLPPQQQTILSSSHFQ-------- 166
             G                      S G S AS +NPLP QQQ        Q        
Sbjct: 200 SGG----------------------SKGFSVASLNNPLPMQQQQQQQQQQQQQQQLLQQG 237

Query: 167 VLPPHXXXXXXXXXXXXXXXHDAYYRPLNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKD 226
           VLP                  DA YRPLN KDALSYLEQVK+QFN+RPDVYNHFLDIMKD
Sbjct: 238 VLP-------------LEHVQDASYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKD 284

Query: 227 FKSQAIDTPGVIDRVSTLFKGYPGLIQGFNTFLPQGYRIECSANPDEP--IRVTTPMGSS 284
           +KSQAIDT GVI+R+STLFKGYP LIQG NTFLPQGY+IEC++NP +P  I+VTTP  ++
Sbjct: 285 YKSQAIDTLGVIERISTLFKGYPVLIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPFDTT 344

Query: 285 SVAGTIEN----AVAGFPAQP 301
                  N    AV G  A P
Sbjct: 345 RELSLDHNTGGSAVGGHLAGP 365

 Score =  105 bits (262), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 49/60 (81%), Positives = 53/60 (88%)

Query: 375 KKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNA 434
           +   DVEFS AI+YVNKIK RFA+QPDIYKHFLEILQTYQREQKPI+EVY QVT LFQNA
Sbjct: 435 RPNGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQNA 494

 Score = 53.5 bits (127), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 40/62 (64%)

Query: 199 ALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPGLIQGFNTF 258
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V++LF+  P L+  F  F
Sbjct: 445 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQNAPDLLDDFKKF 504

Query: 259 LP 260
           LP
Sbjct: 505 LP 506

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 34/53 (64%)

Query: 380 VEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 432
           + F  A++Y+ ++K +F  +PD+Y HFL+I++ Y+ +      V  +++ LF+
Sbjct: 252 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFK 304

>NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1657

 Score = 1117 bits (2889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/878 (62%), Positives = 670/878 (76%), Gaps = 21/878 (2%)

Query: 588  VRPEIDLDPSIVPVVPEPTAPIEDSLTLVEETSFFDRAKKFIGNKQIYTEFLKILNLFSQ 647
             RPEIDLDPSIVP++PEPT PIE+++TLVEETSFF++ KKFI +K IY EFLK+LNL+SQ
Sbjct: 716  TRPEIDLDPSIVPIIPEPTEPIENNITLVEETSFFEKVKKFISSKPIYMEFLKVLNLYSQ 775

Query: 648  DLLDVDELVGRVEHYLGGNKELFVWFKNFVGFQDKPKHIENIVHEKHRLDLDLCEACGPS 707
            DLL  +ELV RV++Y+G NKELF WFK FVG+ + P  IENI+HEKH+LDLDLCEA GPS
Sbjct: 776  DLLSTNELVTRVDYYIGSNKELFDWFKTFVGYSEIPSTIENIIHEKHKLDLDLCEAYGPS 835

Query: 708  YKKLPKSDTFMPCSGRDEMCWAVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEER 767
            YKKLPK+DTFMPCSGRD MCW VLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEER
Sbjct: 836  YKKLPKTDTFMPCSGRDAMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEER 895

Query: 768  HEYDFYIESNLRTIQTLETIASKIANMSEEEKATFKLPPGLGHTSLTIYKKVIRKVYDKE 827
            HEYDF+IESNLRTIQTLETIA+KI NM+ EEK  FKLP GLGHTS TIYKKVIRKVYDKE
Sbjct: 896  HEYDFHIESNLRTIQTLETIANKINNMTAEEKKNFKLPVGLGHTSSTIYKKVIRKVYDKE 955

Query: 828  RGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLT 887
            RGFEIIDALHE+PA AVP++L+RLK+KDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLT
Sbjct: 956  RGFEIIDALHEHPAFAVPIILRRLKEKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLT 1015

Query: 888  FKQADKKLLTTKQLISEIGSIKTDQTNKRMHWLTPKPKDQLDYYVPDKSVFFDILSLTDT 947
            FKQADKKLLTTKQLISEI SI+ DQ NKR+HWLTPKPK QLD+   D  +  DIL L + 
Sbjct: 1016 FKQADKKLLTTKQLISEISSIQVDQNNKRIHWLTPKPKSQLDFTFNDHDILVDILDLANV 1075

Query: 948  FINHNSSYSNPDKIRLKDLFKIFVSLFFSIPMYEVNEAVSRRGNLDDDKEDSTQKMESDN 1007
            FI+H S+YSN +K RLKD  ++F+ LFFSIP  E+++ +S + +   +K  S+    S++
Sbjct: 1076 FIDHTSTYSNSEKERLKDFLRVFIGLFFSIPSSEIDKKLSGKNDEKFEKGSSSSSSTSNS 1135

Query: 1008 LNNS-KRPREDEISLSEVLHRAKNQRFKSRAADXXXXXXXXXXXXXXXXXXX-------- 1058
              ++ KR  E +I L++VL + K Q+ K +  +                           
Sbjct: 1136 TPSAKKRSLELDIPLADVLRKYKYQKIKEKVINELENNSNEYDERDEEFDEELKRQQQEQ 1195

Query: 1059 -----XIRQEAKKPWLLGNLVEEVNAQGLINNRKTFNMFANTNIYVFFRHLTTLYERLEE 1113
                  I +E KKPWLLG+++++ +  GLI NR  FN+FANTNIYVFFRH TT+YERL E
Sbjct: 1196 EEEDHMIDEEMKKPWLLGSVIDKTSEHGLIENRHIFNLFANTNIYVFFRHWTTIYERLLE 1255

Query: 1114 VKKMNDAVTKEINSRKVVQFAKDLNLISQQLKEMGLDFEGADAYEQLRHLCKRLIEGDIE 1173
            +K++ND VT+EINSRKV  FAKDL LIS QL  MGLDF+ +D+Y++L +L KRLI+ DIE
Sbjct: 1256 LKQINDKVTREINSRKVTPFAKDLGLISTQLTMMGLDFKTSDSYKELLNLTKRLIKNDIE 1315

Query: 1174 HQWFEESLRQAYNNKAFKLYTVDKVIQSLVKHAHTILTDSKTSEIMTSFEKDRTQINTSA 1233
            HQWFEESLRQAYNNKAFKLYT DKVIQ+LVKHA++ILTDSK SEIM  FEKDR + +T+ 
Sbjct: 1316 HQWFEESLRQAYNNKAFKLYTADKVIQALVKHANSILTDSKASEIMALFEKDRLRSSTTT 1375

Query: 1234 KDQILYRLQVRSYMSSTENMFRIEYNKQSKNVRIQFIAVDDLTLAEPRSLEEKWRYYVTS 1293
            +DQI+YRLQ R++M++TENMFRIE+N+ + +V IQ+IAV+DLTL    + +E W YYVTS
Sbjct: 1376 RDQIIYRLQTRTHMTNTENMFRIEFNENTNHVCIQYIAVEDLTLKPSPTTKETWEYYVTS 1435

Query: 1294 YSLSHPTEGISQEELQLPFLEKVLETEEDYGSDVDNFS-----IDKFSPEGVSKSTLKIK 1348
            Y+L HPTEG+ QE L++PFLEK L  E +   D+DN +     I+K SPEG+S S LKIK
Sbjct: 1436 YALPHPTEGVPQEGLKVPFLEKNLNLELENAQDLDNETEKNEFIEKISPEGISTSKLKIK 1495

Query: 1349 IDPETYLLDIEAGSYDVFSRKSVNRFPVIVDSNDYTTKKEKKKNMVIQFLESKKGWKKNL 1408
            ID ETY LD+E GS+DVFSRKS+N+FP   D+    +  ++K     +FL SK+GW    
Sbjct: 1496 IDQETYNLDVEPGSFDVFSRKSLNKFP--TDAKKIESSIKEKSEAFNKFLSSKRGWNNQF 1553

Query: 1409 DDDQVKAIQEKLARVKENGSLDDFNEASQTQQASEIIA 1446
              DQV  I+E   + +E G      +   T+  + +IA
Sbjct: 1554 KPDQVAGIEEGWKKFQETGEFIPIPKPITTESTTGVIA 1591

 Score =  178 bits (452), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 81/98 (82%), Positives = 88/98 (89%)

Query: 188 DAYYRPLNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKG 247
           D  YRPLNVKDALSYLEQVK QFNS+P +YN FLDIMKDFKSQ IDTPGVI+RVSTLFKG
Sbjct: 267 DPEYRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKG 326

Query: 248 YPGLIQGFNTFLPQGYRIECSANPDEPIRVTTPMGSSS 285
           YP LIQGFNTFLPQGY I CS NPD+P+RVTTPMG+S+
Sbjct: 327 YPVLIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGTST 364

 Score = 98.2 bits (243), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 52/56 (92%)

Query: 379 DVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNA 434
           +VEFSQAINYVNKIK R+A+QP IYKHFLEILQTYQRE+KPI+EVY QVTVLF +A
Sbjct: 464 EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDA 519

 Score = 48.5 bits (114), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 40/63 (63%)

Query: 199 ALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPGLIQGFNTF 258
           A++Y+ ++K ++  +P +Y HFL+I++ ++ +      V ++V+ LF   P L++ F  F
Sbjct: 470 AINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKF 529

Query: 259 LPQ 261
           LP+
Sbjct: 530 LPE 532

 Score = 34.3 bits (77), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 30/48 (62%)

Query: 385 AINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 432
           A++Y+ ++K +F  QP IY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 278 ALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFK 325

>CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa]
           {ON} weakly similar to uniprot|P22579 Saccharomyces
           cerevisiae YOL004w SIN3 transcription regulatory protein
          Length = 937

 Score =  255 bits (651), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 152/376 (40%), Positives = 214/376 (56%), Gaps = 18/376 (4%)

Query: 607 APIEDSLTLVEETSFFDRAKKFIGNKQIYTEFLKILNLFSQDLLDVDELVGRVEHYLGGN 666
            PI+    + E   +F   +  + ++ IY EFLK++NLF+Q L+D++    R   + G +
Sbjct: 195 TPIDRPTNMAEFLIYF---RNLVYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSH 251

Query: 667 KELFVWFKNFVG-FQDKPKHIENIVHEKHRLDL-DLCEACGPSYKKLPKSDTFMPCSGRD 724
             L   F N +  ++D  + ++  +      D+ D     GPSYK+L   +T   C GRD
Sbjct: 252 NGLKTAFGNIMSEYKDIHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRD 311

Query: 725 EMCWAVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTL 784
            +C  VLNDEWVGHPVWASE+ GFIAH+KNQYEETLFK+EEERHEYDF++ S    I   
Sbjct: 312 RLCHEVLNDEWVGHPVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFFLLSVEHLIVKF 371

Query: 785 ETIASKIANMSEEE-----KATFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEY 839
            T   K   +S+++     + +    P +   S+T  +KVIR++Y  E G  +IDA+   
Sbjct: 372 -TEYEKSLQLSKDDGRRRNRVSSPKEPMISLNSIT--EKVIRRLYGIEHGNILIDAIKTN 428

Query: 840 PAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTK 899
           P   VP +LK  K+K ++W  A+ EWNK WRE+EQK YYKSLDHLGL FK A+K+ L  K
Sbjct: 429 PEKVVPTILKTAKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNAEKRFLNDK 488

Query: 900 QLISEIGSIKTDQTNKRMHWLTPKPKDQLDYYVPDKSVFFDILSLTDTFINHNSSYSNPD 959
           QL+ E  S K D+  K  H+   + K    Y   DKSV +D+  +    +  NSS S   
Sbjct: 489 QLLLEYKSEKQDKLLKE-HYDNYEYK----YEFFDKSVLYDVKDIILCGLRSNSSTSESQ 543

Query: 960 KIRLKDLFKIFVSLFF 975
           K     +F+ F  L F
Sbjct: 544 KNLYCQIFEAFFDLLF 559

 Score =  136 bits (343), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 89/294 (30%), Positives = 149/294 (50%), Gaps = 10/294 (3%)

Query: 1083 INNRKTFNMFANTNIYVFFRHLTTLYERLEEVKKMNDAVTKEINS--RKVVQFAKDLNLI 1140
             +NR+  N+F + NI   F ++ TLYER  +VK     + K++ +  R+    AK L L+
Sbjct: 617  FSNRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTKKRRPSLLAKSLKLL 676

Query: 1141 SQQLKEMGLDFEGADAYEQLRHLCKRLIEGDIEHQWFEESLRQAYNNKAFKLYTVDKVIQ 1200
              QL + GL+    D YE ++   K+ + G+++HQWFEESLR  + NKA+KLYT+D+VI+
Sbjct: 677  PMQLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIR 736

Query: 1201 SLVKHAHTILTDSKTSEIMTSFEKDRTQINTSAKDQILYRLQVRSYMSSTENMFRIEYNK 1260
            +++    TI       +I+     +  ++ T+   Q+ YR +VR  M    +MFR+E  +
Sbjct: 737  NILGVITTISQTPSLLQILDLLVDNMKKLTTTKLQQLTYRTKVRMLMDGVGDMFRLEIVR 796

Query: 1261 QSKNVRIQFIAVDDLTLAEPRSLEEKWRYYVTSYSLSHPTEGISQEELQLPFLEKVLETE 1320
             S  +  Q+I VDDL  A+    + +   Y   Y  +  T+ +  + L  P+    L   
Sbjct: 797  DSNAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYSLNLLKR 856

Query: 1321 EDYGSDVDNFSIDKFSPEGVSKSTLKIKIDPETYLLDIEAGSYDVFSRKSVNRF 1374
            E+            F    + K  L + I+P  Y++DI  GS D+ S   + + 
Sbjct: 857  EEQNI--------PFMNGNIYKPHLSVNINPLDYVVDIAPGSIDICSSTHITKL 902

>KAFR0B02410 Chr2 complement(467555..473848) [6294 bp, 2097 aa] {ON}
           Anc_8.207 YER155C
          Length = 2097

 Score = 39.7 bits (91), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 35/85 (41%)

Query: 881 LDHLGLTFKQADKKLLTTKQLISEIGSIKTDQTNKRMHWLTPKPKDQLDYYVPDKSVFFD 940
            +H GLTF +   KL +       I S   +    R+  +     D L  Y+ D  +F  
Sbjct: 448 FNHFGLTFTKHKSKLTSESLQYCNISSTSDNLMTDRLALVVKTLLDVLPGYLLDNEIFHA 507

Query: 941 ILSLTDTFINHNSSYSNPDKIRLKD 965
            L L DT   HN   SN  KI + D
Sbjct: 508 TLQLLDTLSLHNDEVSNRLKISVAD 532

>KLTH0F19052g Chr6 (1544223..1544765) [543 bp, 180 aa] {ON} similar
           to uniprot|P42844 Saccharomyces cerevisiae YNL310C ZIM17
           Essential component of the mitochondrial import system
           zinc finger protein that may act with Pam18p to
           facilitate recognition and folding of imported proteins
           by Ssc1p (mtHSP70) in the mitochondrial matrix
          Length = 180

 Score = 35.0 bits (79), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 38/89 (42%), Gaps = 5/89 (5%)

Query: 31  TTETHNNENGMNQAVETSTVGLT-----GGKTPEMTKQEIKVESKPHVTLPSISDLSGES 85
           T +  NN +    + +  T G       G K+  +    +K+ S  H+T+  I +  GES
Sbjct: 70  TCKKCNNRSSHTMSKQAYTKGTVLIQCPGCKSRHLIADHLKIFSDDHITVEDIMNAKGES 129

Query: 86  AHNGKDGLTSSNTPLRLPSVQSTYGSKAP 114
             +  D L   + P +L SV   Y   AP
Sbjct: 130 VSSTTDDLAFEDIPEKLKSVIGHYAKNAP 158

>KLLA0E12057g Chr5 (1068487..1074933) [6447 bp, 2148 aa] {ON} similar
            to uniprot|P43583 Saccharomyces cerevisiae YFL007W BLM3
            Protein involved in assembly of proteasomal core
            particles in the nucleus required for normal resistance
            to bleomycin may be involved in protection against
            oxidative damage
          Length = 2148

 Score = 36.2 bits (82), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 45/103 (43%), Gaps = 9/103 (8%)

Query: 1361 GSYDVFSRKSVNRFPVIVDSNDYTTKKEKKKNMVIQFLESKKGWKKNLDDDQVKAIQEKL 1420
            GSY +  RK    F   +DS D   +  KK  ++IQ L  KK  +K + D   K +++ L
Sbjct: 1319 GSYSIIVRKVFKAFEAALDSTD--AEASKKLEVLIQVLSMKKIQRKMMSD--YKNLEKML 1374

Query: 1421 ARVKENGSLDDFNEASQTQQASEIIA-----PSKVEQSKESTV 1458
              +     LD +   S   Q  E ++     PS V    ES +
Sbjct: 1375 TLLLRASRLDSYFLVSLCDQVMESVSGLIKIPSAVCLFDESAI 1417

>Kpol_1025.35 s1025 complement(81457..85011) [3555 bp, 1184 aa] {ON}
            complement(81457..85011) [3555 nt, 1185 aa]
          Length = 1184

 Score = 35.4 bits (80), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 51/114 (44%), Gaps = 16/114 (14%)

Query: 1137 LNLISQQLKEMGLDFEGADAYEQLRHLCKRLIEGDIEHQWFEESLRQAYNNKAFKLYTVD 1196
            ++LISQ++   G    G  A E+L  L K+L+  D +    E  L   ++NK   LY   
Sbjct: 11   VDLISQEIAYEG----GKIAIEKLYELSKKLLGNDGDDSLNEFILHSIFSNKDILLYKNG 66

Query: 1197 KV------------IQSLVKHAHTILTDSKTSEIMTSFEKDRTQINTSAKDQIL 1238
            +V            IQS +      +T+ K  EI+T + K    I  SA + +L
Sbjct: 67   EVYIGNDLHSNFMEIQSSLSDFDARITEDKLWEILTGYNKKECSIGNSAFELLL 120

>Skud_5.293 Chr5 complement(467328..473804) [6477 bp, 2159 aa] {ON}
           YER155C (REAL)
          Length = 2159

 Score = 35.4 bits (80), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 39/89 (43%)

Query: 877 YYKSLDHLGLTFKQADKKLLTTKQLISEIGSIKTDQTNKRMHWLTPKPKDQLDYYVPDKS 936
           + K  +  GL+F +   +L  +      I S   D   +R+  +     D    ++ D+ 
Sbjct: 458 FLKMFNQYGLSFTKNKSRLTNSSTQFYNIASFMDDSMTQRLALVAKTILDVFPGFLLDEP 517

Query: 937 VFFDILSLTDTFINHNSSYSNPDKIRLKD 965
           +   I+SL DT   HN   SN  KI++ +
Sbjct: 518 MLKAIISLLDTISLHNDEISNTLKIKIAN 546

>KNAG0B06170 Chr2 complement(1212229..1216080) [3852 bp, 1283 aa] {ON}
            Anc_4.261 YLR398C
          Length = 1283

 Score = 33.9 bits (76), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 62/133 (46%), Gaps = 20/133 (15%)

Query: 1248 SSTENMFRIEYNKQSKNVRIQFIAVDDLTLAEPRSLEEKWRYYVTSYSLSHPTEGISQEE 1307
            +  ++ FR+ YN     +RI+ + V+++          K+ +   +   SHP     + E
Sbjct: 793  TKLQSQFRLTYNMILNLLRIEALKVEEMI---------KYSFSENTNQTSHP-----EHE 838

Query: 1308 LQLPFLEKVLETEEDYGSDVDNFSIDKFSPEGVSKSTLKIKIDPETYLLDIEAGSYDVFS 1367
             ++  L+  LET ED   DV +  +D+F       +T+K K +    L ++ + S D+F 
Sbjct: 839  KKIKKLQVELETVEDCKCDVCSKDLDRF-----LNATVKYKQNTSNILTEL-SKSADIFK 892

Query: 1368 RKSVNRFPVIVDS 1380
               + R  V+ D+
Sbjct: 893  VLRIGRLVVLRDA 905

>KNAG0G01710 Chr7 complement(375111..381551) [6441 bp, 2146 aa] {ON}
           Anc_8.207 YER155C
          Length = 2146

 Score = 34.3 bits (77), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 41/99 (41%)

Query: 877 YYKSLDHLGLTFKQADKKLLTTKQLISEIGSIKTDQTNKRMHWLTPKPKDQLDYYVPDKS 936
           +  + + +GLTF + D KL +      ++ S   D   +R+  +     D    ++ D  
Sbjct: 481 FLNTFNQMGLTFTKHDAKLTSQSTQYCKVSSEMDDLITERLALVIKTILDMFPGFLLDDQ 540

Query: 937 VFFDILSLTDTFINHNSSYSNPDKIRLKDLFKIFVSLFF 975
           +F   + L DT   HN    N  K+ +       +SL +
Sbjct: 541 MFQATIRLLDTISLHNDEICNSLKVAVAKKHNALMSLTY 579

>Smik_10.312 Chr10 (493175..495505) [2331 bp, 776 aa] {ON} YJR040W
            (REAL)
          Length = 776

 Score = 33.5 bits (75), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 53/99 (53%), Gaps = 16/99 (16%)

Query: 1295 SLSHPTEGISQEELQL---PFLEKVLETEEDYGSDVDNFSIDKFSPEGVSKSTLKIKIDP 1351
            S S  + GI+ + + +   P+LE   E EED        ++++++ E    S L I I+ 
Sbjct: 549  STSGISGGIADQMIMVNGFPYLED--EQEED--------TLEEYTAEQAMSSKL-ITINE 597

Query: 1352 ETYLLDIEAGSYDVFSRKSVNRFPVIVDSNDYTTKKEKK 1390
              YL ++E+  YD  S  SV+ FP+I D + +  +KEK+
Sbjct: 598  TIYLSELESLLYDSTSEFSVHGFPIIKDEDKF--EKEKR 634

>NDAI0G04800 Chr7 complement(1155030..1157450) [2421 bp, 806 aa] {ON}
            Anc_1.466 YJR040W
          Length = 806

 Score = 33.1 bits (74), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 37/73 (50%), Gaps = 10/73 (13%)

Query: 1310 LPFLEKVLETEEDYGSDVDNFSIDKFSPEGVSKSTLKIKIDPETYLLDIEAGSYDVFSRK 1369
             P  EK+ E EE          +D ++ E V  S L I +   TY+ ++EA  YD   +K
Sbjct: 596  FPLYEKLWEEEE---------FMDDYTAEDVMSSQL-ITLKETTYVSELEAILYDSNDKK 645

Query: 1370 SVNRFPVIVDSND 1382
            +V  FP+I D ++
Sbjct: 646  NVKGFPIIKDGDE 658

>TDEL0A00550 Chr1 complement(94467..95012) [546 bp, 181 aa] {ON}
           Anc_3.36 YNL310C
          Length = 181

 Score = 31.6 bits (70), Expect = 9.7,   Method: Composition-based stats.
 Identities = 26/108 (24%), Positives = 43/108 (39%), Gaps = 5/108 (4%)

Query: 34  THNNENGMNQAVETSTVGLT--GGKTPEMTKQEIKVESKPHVTLPSISDLSGESAHNGKD 91
           T ++     QA    TV +T    K   +    +K+    HVT+  I    GES  +  D
Sbjct: 77  TRSSHTMSKQAYTGGTVLITCPSCKNRHLIADHLKIFRDDHVTIEDILKAKGESVSSTTD 136

Query: 92  GLTSSNTPLRLPSVQSTYGSKAPGAGQEVNGTIMESTVNPAPAQGRQN 139
            L   + P  L +V   +   AP   + + G +   TV+  P   + +
Sbjct: 137 DLAFEDIPKELRNVIGHHAKDAP---ENLRGKLDNETVHTLPGSSKND 181

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 153,829,410
Number of extensions: 7104266
Number of successful extensions: 23250
Number of sequences better than 10.0: 169
Number of HSP's gapped: 24176
Number of HSP's successfully gapped: 249
Length of query: 1490
Length of database: 53,481,399
Length adjustment: 123
Effective length of query: 1367
Effective length of database: 39,377,481
Effective search space: 53829016527
Effective search space used: 53829016527
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 72 (32.3 bits)