Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G043906.30ON1221226411e-87
ZYRO0C07502g6.30ON1221226099e-83
KAFR0A051106.30ON1221225978e-81
Kpol_1037.216.30ON1201205872e-79
NCAS0D021206.30ON1221225863e-79
Suva_15.1696.30ON1221225821e-78
Skud_15.1576.30ON1221225821e-78
NDAI0C026706.30ON1221225785e-78
Smik_15.1656.30ON1201205786e-78
YOL005C (RPB11)6.30ON1201205776e-78
KNAG0F029106.30ON1221205751e-77
CAGL0E02453g6.30ON1201205733e-77
SAKL0E01562g6.30ON1221225724e-77
TBLA0E031506.30ON1181185663e-76
ACL005C6.30ON1221225603e-75
Kwal_56.224726.30ON1221225579e-75
KLTH0C10934g6.30ON1221225543e-74
TPHA0J004106.30ON1201205482e-73
KLLA0C06160g6.30ON1211225403e-72
TPHA0B029202.163ON1301061314e-10
CAGL0L03872g2.163ON137921245e-09
Kpol_165.22.163ON128921192e-08
KAFR0B045702.163ON131901174e-08
KNAG0I020602.163ON134901151e-07
TBLA0B012902.163ON102861121e-07
YNL113W (RPC19)2.163ON1421021123e-07
Smik_14.2142.163ON1421021114e-07
Suva_14.2252.163ON1421041106e-07
Ecym_54232.163ON127901097e-07
TDEL0F011802.163ON129901071e-06
Skud_14.2182.163ON1561041081e-06
ZYRO0B09878g2.163ON130901062e-06
AFL220C2.163ON135901052e-06
NCAS0G025502.163ON150901053e-06
SAKL0E10692g2.163ON131901044e-06
NDAI0F027502.163ON149901011e-05
KLLA0F23760g2.163ON12788941e-04
KLTH0D09350g2.163ON14671941e-04
Kwal_26.84732.163ON15071905e-04
TBLA0J007305.604ON72686661.3
YHL030W (ECM29)4.15ON186871652.2
NDAI0A031507.264ON93832615.7
Kwal_23.58927.257ON67854608.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G04390
         (122 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G04390 Chr7 complement(794577..794945) [369 bp, 122 aa] {ON...   251   1e-87
ZYRO0C07502g Chr3 complement(567967..568335) [369 bp, 122 aa] {O...   239   9e-83
KAFR0A05110 Chr1 complement(1014087..1014455) [369 bp, 122 aa] {...   234   8e-81
Kpol_1037.21 s1037 complement(44216..44578) [363 bp, 120 aa] {ON...   230   2e-79
NCAS0D02120 Chr4 complement(393640..394008) [369 bp, 122 aa] {ON...   230   3e-79
Suva_15.169 Chr15 complement(289702..290070) [369 bp, 122 aa] {O...   228   1e-78
Skud_15.157 Chr15 complement(275429..275797) [369 bp, 122 aa] {O...   228   1e-78
NDAI0C02670 Chr3 (621282..621650) [369 bp, 122 aa] {ON} Anc_6.30...   227   5e-78
Smik_15.165 Chr15 complement(283099..283461) [363 bp, 120 aa] {O...   227   6e-78
YOL005C Chr15 complement(315813..316175) [363 bp, 120 aa] {ON}  ...   226   6e-78
KNAG0F02910 Chr6 complement(551617..551985) [369 bp, 122 aa] {ON...   226   1e-77
CAGL0E02453g Chr5 complement(233352..233714) [363 bp, 120 aa] {O...   225   3e-77
SAKL0E01562g Chr5 (120177..120545) [369 bp, 122 aa] {ON} highly ...   224   4e-77
TBLA0E03150 Chr5 complement(788457..788813) [357 bp, 118 aa] {ON...   222   3e-76
ACL005C Chr3 complement(346569..346937) [369 bp, 122 aa] {ON} Sy...   220   3e-75
Kwal_56.22472 s56 (144443..144811) [369 bp, 122 aa] {ON} YOL005C...   219   9e-75
KLTH0C10934g Chr3 complement(900683..901051) [369 bp, 122 aa] {O...   218   3e-74
TPHA0J00410 Chr10 (95837..96199) [363 bp, 120 aa] {ON} Anc_6.30 ...   215   2e-73
KLLA0C06160g Chr3 complement(543239..543604) [366 bp, 121 aa] {O...   212   3e-72
TPHA0B02920 Chr2 (666060..666452) [393 bp, 130 aa] {ON} Anc_2.16...    55   4e-10
CAGL0L03872g Chr12 complement(447274..447687) [414 bp, 137 aa] {...    52   5e-09
Kpol_165.2 s165 complement(2511..2897) [387 bp, 128 aa] {ON} com...    50   2e-08
KAFR0B04570 Chr2 complement(949880..950275) [396 bp, 131 aa] {ON...    50   4e-08
KNAG0I02060 Chr9 complement(401412..401816) [405 bp, 134 aa] {ON...    49   1e-07
TBLA0B01290 Chr2 (274238..274546) [309 bp, 102 aa] {ON} Anc_2.16...    48   1e-07
YNL113W Chr14 (412771..413199) [429 bp, 142 aa] {ON}  RPC19RNA p...    48   3e-07
Smik_14.214 Chr14 (392413..392841) [429 bp, 142 aa] {ON} YNL113W...    47   4e-07
Suva_14.225 Chr14 (409562..409990) [429 bp, 142 aa] {ON} YNL113W...    47   6e-07
Ecym_5423 Chr5 complement(871715..872098) [384 bp, 127 aa] {ON} ...    47   7e-07
TDEL0F01180 Chr6 (211106..211495) [390 bp, 129 aa] {ON} Anc_2.16...    46   1e-06
Skud_14.218 Chr14 (402879..403349) [471 bp, 156 aa] {ON} YNL113W...    46   1e-06
ZYRO0B09878g Chr2 complement(771644..772036) [393 bp, 130 aa] {O...    45   2e-06
AFL220C Chr6 complement(25281..25688) [408 bp, 135 aa] {ON} Synt...    45   2e-06
NCAS0G02550 Chr7 (456827..457279) [453 bp, 150 aa] {ON} Anc_2.16...    45   3e-06
SAKL0E10692g Chr5 complement(891637..892032) [396 bp, 131 aa] {O...    45   4e-06
NDAI0F02750 Chr6 complement(673843..674292) [450 bp, 149 aa] {ON...    44   1e-05
KLLA0F23760g Chr6 complement(2218555..2218938) [384 bp, 127 aa] ...    41   1e-04
KLTH0D09350g Chr4 complement(776115..776555) [441 bp, 146 aa] {O...    41   1e-04
Kwal_26.8473 s26 complement(800017..800469) [453 bp, 150 aa] {ON...    39   5e-04
TBLA0J00730 Chr10 (169980..172160) [2181 bp, 726 aa] {ON} Anc_5....    30   1.3  
YHL030W Chr8 (40084..45690) [5607 bp, 1868 aa] {ON}  ECM29Scaffo...    30   2.2  
NDAI0A03150 Chr1 (709990..712806) [2817 bp, 938 aa] {ON} Anc_7.264     28   5.7  
Kwal_23.5892 s23 (1358818..1360854) [2037 bp, 678 aa] {ON} YIL06...    28   8.1  

>TDEL0G04390 Chr7 complement(794577..794945) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  251 bits (641), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 122/122 (100%), Positives = 122/122 (100%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60
           MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDDNY 120
           YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDDNY
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDDNY 120

Query: 121 GI 122
           GI
Sbjct: 121 GI 122

>ZYRO0C07502g Chr3 complement(567967..568335) [369 bp, 122 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 122

 Score =  239 bits (609), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 112/122 (91%), Positives = 120/122 (98%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60
           MNAPDRFELFLLGEGESKL+++PDTKAPNA+V+TFEKEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDDNY 120
           YKVEHPLFARFKMRIQT+EGYDPKDALKNACNGIINKL VLKTNFETEWNLQTLASDDN+
Sbjct: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDDNF 120

Query: 121 GI 122
           GI
Sbjct: 121 GI 122

>KAFR0A05110 Chr1 complement(1014087..1014455) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  234 bits (597), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 119/122 (97%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60
           MNAPDRFELFLLGEGESKLKI+PDTK+PNAVVITFEKEDHTLGNLIR+ELLNDTKVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDDNY 120
           YKVEHP FARFK+R+QT+EGYDPK+ALKNACN IINKL +LKTNFETEWNLQTLASD+N+
Sbjct: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120

Query: 121 GI 122
           GI
Sbjct: 121 GI 122

>Kpol_1037.21 s1037 complement(44216..44578) [363 bp, 120 aa] {ON}
           complement(44216..44578) [363 nt, 121 aa]
          Length = 120

 Score =  230 bits (587), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 110/120 (91%), Positives = 116/120 (96%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60
           MNAPD+FELFLLGEGESKL IEPDTKAPNAVVITFEKEDHTLGNLIRSELLND+KVLFAA
Sbjct: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDDNY 120
           YKVEHPLFARFK+RIQTVE YDPKDALKNACN IINKL +LKTNFETEWNLQTLASD+N+
Sbjct: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120

>NCAS0D02120 Chr4 complement(393640..394008) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  230 bits (586), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 117/122 (95%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60
           MNAPDRFELFLLGEGESKL+I+PDTKAPNAVVITFEKEDHTLGNLIRSELLND++VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDDNY 120
           YKVEHP FARFK+RIQTVEGYDPKDALKNACN II+KL VLK NFETEWNLQTLA+D+N 
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADENM 120

Query: 121 GI 122
           GI
Sbjct: 121 GI 122

>Suva_15.169 Chr15 complement(289702..290070) [369 bp, 122 aa] {ON}
           YOL005C (REAL)
          Length = 122

 Score =  228 bits (582), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 114/122 (93%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60
           MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDDNY 120
           YKVEHP FARFK+RIQT EGYDPKDALKNACN IINKL  LKTNFETEWNLQTLA+DD +
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

Query: 121 GI 122
            +
Sbjct: 121 NM 122

>Skud_15.157 Chr15 complement(275429..275797) [369 bp, 122 aa] {ON}
           YOL005C (REAL)
          Length = 122

 Score =  228 bits (582), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 114/122 (93%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60
           MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDDNY 120
           YKVEHP FARFK+RIQT EGYDPKDALKNACN IINKL  LKTNFETEWNLQTLA+DD +
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

Query: 121 GI 122
            +
Sbjct: 121 NM 122

>NDAI0C02670 Chr3 (621282..621650) [369 bp, 122 aa] {ON} Anc_6.30
           YOL005C
          Length = 122

 Score =  227 bits (578), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 115/122 (94%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60
           MNAPDRFELFLLGEGESKL I+PDTKAPNAVVITF+KEDHTLGNLIRSELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDDNY 120
           YKVEHP FA FK+RIQTVEGYDPK ALKNACN IINKL +LKTNFETEWNLQTLASD+N+
Sbjct: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120

Query: 121 GI 122
           GI
Sbjct: 121 GI 122

>Smik_15.165 Chr15 complement(283099..283461) [363 bp, 120 aa] {ON}
           YOL005C (REAL)
          Length = 120

 Score =  227 bits (578), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 113/120 (94%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60
           MNAPDRFELFLLGEGESKLKI+PDTKAPNAVVITFEKEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDDNY 120
           YKVEHP FARFK+RIQT EGYDPKDALKNACN IINKL  LKTNFETEWNLQTLA+DD +
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLATDDAF 120

>YOL005C Chr15 complement(315813..316175) [363 bp, 120 aa] {ON}
           RPB11RNA polymerase II subunit B12.5; part of central
           core; similar to Rpc19p and bacterial alpha subunit
          Length = 120

 Score =  226 bits (577), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 113/120 (94%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60
           MNAPDRFELFLLGEGESKLKI+PDTKAPNAVVITFEKEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDDNY 120
           YKVEHP FARFK+RIQT EGYDPKDALKNACN IINKL  LKTNFETEWNLQTLA+DD +
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

>KNAG0F02910 Chr6 complement(551617..551985) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  226 bits (575), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 105/120 (87%), Positives = 115/120 (95%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60
           MNAPDRFELFLLG+GESKL I+PDTK+PNA+VITF KEDHTLGNLIR+ELLND+KVLFAA
Sbjct: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDDNY 120
           YKVEHP FARFK+RIQTVEGYDPKDALKNACNGIINKL +LKTNFETEWNLQTLA+DD +
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDDTF 120

>CAGL0E02453g Chr5 complement(233352..233714) [363 bp, 120 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005c RPB11 DNA-directed RNA polymerase II
          Length = 120

 Score =  225 bits (573), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 114/120 (95%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60
           MNAPDRFELFLLGEGESKLKI+PDTKAPNAVVITFEKEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDNKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDDNY 120
           YKVEHP FARFK+RIQTVEGYDPKDAL+NAC+ IINKL  LK+NFETEWNLQTLA+DD +
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALRNACSSIINKLGALKSNFETEWNLQTLAADDAF 120

>SAKL0E01562g Chr5 (120177..120545) [369 bp, 122 aa] {ON} highly
           similar to uniprot|P38902 Saccharomyces cerevisiae
           YOL005C
          Length = 122

 Score =  224 bits (572), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 106/122 (86%), Positives = 115/122 (94%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60
           MNAPDRFELFLL EGESKL IEPDTKAPNAV+ITFEKEDHTLGNLIR+ELL D +VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDDNY 120
           YKVEHPLFARFKMRIQTVEGYDPKDALKNACN II KLA L++NFETEW+LQTLAS++NY
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEENY 120

Query: 121 GI 122
           G+
Sbjct: 121 GL 122

>TBLA0E03150 Chr5 complement(788457..788813) [357 bp, 118 aa] {ON}
           Anc_6.30 YOL005C
          Length = 118

 Score =  222 bits (566), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 106/118 (89%), Positives = 111/118 (94%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60
           MNAPDRFE FLLGEGESKL+IEPDTKAPN VVITFEKEDHTLGNLI+SELL+D KVLFAA
Sbjct: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDD 118
           YKVEHPLFARFKMRIQTVEGYDPKDAL+ ACN II KL +LKTNFETEWNLQTLASDD
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118

>ACL005C Chr3 complement(346569..346937) [369 bp, 122 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL005C
           (RPB11)
          Length = 122

 Score =  220 bits (560), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 113/122 (92%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60
           MNAPDRFELFLL EGESKLKIEPDTKA NAV+ITFEKEDHTLGN+IR+ELL D +VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDDNY 120
           YKVEHPLFARF+MRIQT EGYDPK+ALKNACN IINKLA LK+NFETEWNLQTLAS+D +
Sbjct: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASEDQF 120

Query: 121 GI 122
            +
Sbjct: 121 RL 122

>Kwal_56.22472 s56 (144443..144811) [369 bp, 122 aa] {ON} YOL005C
           (RPB11) - RNA polymerase II subunit, homologous to S.
           pombe Rpb11p subunit [contig 185] FULL
          Length = 122

 Score =  219 bits (557), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 102/122 (83%), Positives = 113/122 (92%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60
           MNAPDRFELFLL EGE+KLKI+PDTKAPNAV++TFEKEDHTL NLIR+ELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDDNY 120
           YKVEHPLFA+FKMRIQT EGYDPKDALKNACNGII+KL  L++NFETEWNLQTLAS+DNY
Sbjct: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120

Query: 121 GI 122
            +
Sbjct: 121 AM 122

>KLTH0C10934g Chr3 complement(900683..901051) [369 bp, 122 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 122

 Score =  218 bits (554), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 102/122 (83%), Positives = 113/122 (92%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60
           MNAPDRFELFLL EGE+KLKI+PDTKAPNAV++TFEKEDHTL NLIR ELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRGELLEDKGVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDDNY 120
           YKVEHPLFA+FK+RIQTVEGYDPKDALKNACNGII+KL  L++NFETEWNLQTLAS+DNY
Sbjct: 61  YKVEHPLFAQFKLRIQTVEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120

Query: 121 GI 122
            +
Sbjct: 121 AM 122

>TPHA0J00410 Chr10 (95837..96199) [363 bp, 120 aa] {ON} Anc_6.30
           YOL005C
          Length = 120

 Score =  215 bits (548), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 104/120 (86%), Positives = 111/120 (92%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60
           MNAPDRFELFLL EG+SKL+IE DTKA NAVVITFEKEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDDNY 120
           YKVEHPLFARFK+RIQT E YDPKDALK ACN IINKL +LKTNF+TEWNLQTLASDDN+
Sbjct: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDDNF 120

>KLLA0C06160g Chr3 complement(543239..543604) [366 bp, 121 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 121

 Score =  212 bits (540), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 101/122 (82%), Positives = 113/122 (92%), Gaps = 1/122 (0%)

Query: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60
           MNAPDRFELFLL EGESKLK+E DTKA +A+++TFEKEDHTLGNLIR+ELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDDNY 120
           YKVEHPLFA+FKMRIQTVEGYDPKDALKNACN IINKLA L++NFETEWNLQTLA++D Y
Sbjct: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLATED-Y 119

Query: 121 GI 122
           G+
Sbjct: 120 GM 121

>TPHA0B02920 Chr2 (666060..666452) [393 bp, 130 aa] {ON} Anc_2.163
           YNL113W
          Length = 130

 Score = 55.1 bits (131), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 55/106 (51%), Gaps = 2/106 (1%)

Query: 2   NAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDTKVLFA 59
           + P+  E+ +    E K+KI P+  +P+    +F+  +EDHTLGN +R  ++ + +V F 
Sbjct: 18  SVPEVDEVDVNAVDEDKIKILPNATSPDGTSASFQISEEDHTLGNALRHIIMKNPEVEFC 77

Query: 60  AYKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNF 105
            Y + HP      +RIQT       +AL+     +++   V++  F
Sbjct: 78  GYSIPHPSETLLNLRIQTYGNTTAVEALQKGLKDLMDMCDVVEEKF 123

>CAGL0L03872g Chr12 complement(447274..447687) [414 bp, 137 aa] {ON}
           similar to uniprot|P28000 Saccharomyces cerevisiae
           YNL113w RPC19 DNA-directed RNA polymerase I III
          Length = 137

 Score = 52.4 bits (124), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 48/92 (52%), Gaps = 2/92 (2%)

Query: 16  ESKLKIEPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDTKVLFAAYKVEHPLFARFKM 73
           ++K+K+ P   + +    +F+  +EDHTLGN +R  ++ + +V F  Y + HP      +
Sbjct: 40  KTKIKLLPQATSEDGTCASFQIAQEDHTLGNALRYIIMKNPEVEFCGYSIPHPSEELLNL 99

Query: 74  RIQTVEGYDPKDALKNACNGIINKLAVLKTNF 105
           RIQT       DAL+   + +I+    +K  F
Sbjct: 100 RIQTYGNITAVDALQKGLDDLIDLCDAVKDKF 131

>Kpol_165.2 s165 complement(2511..2897) [387 bp, 128 aa] {ON}
           complement(2511..2897) [387 nt, 129 aa]
          Length = 128

 Score = 50.4 bits (119), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 46/92 (50%), Gaps = 2/92 (2%)

Query: 16  ESKLKIEPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDTKVLFAAYKVEHPLFARFKM 73
           E K+KI P   + +    +F+   EDHTLGN +R  ++ + +V F  Y + HP      +
Sbjct: 30  EDKIKILPQATSEDGTCASFQIMDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENLLNL 89

Query: 74  RIQTVEGYDPKDALKNACNGIINKLAVLKTNF 105
           RIQT       +AL+     +++   V++  F
Sbjct: 90  RIQTYGSTTAVEALQKGLGDLMDMCDVVEEKF 121

>KAFR0B04570 Chr2 complement(949880..950275) [396 bp, 131 aa] {ON}
           Anc_2.163 YNL113W
          Length = 131

 Score = 49.7 bits (117), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 46/90 (51%), Gaps = 2/90 (2%)

Query: 18  KLKIEPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDTKVLFAAYKVEHPLFARFKMRI 75
           K+KI P   + +    +F+  +EDHTLGN +R  ++ + +V F  Y + HP      +RI
Sbjct: 35  KIKILPQATSEDGTSASFQIVEEDHTLGNALRYIIMKNPQVEFCGYSIPHPSENLLNIRI 94

Query: 76  QTVEGYDPKDALKNACNGIINKLAVLKTNF 105
           QT       DALK     +++   V++  F
Sbjct: 95  QTYGEITAVDALKKGLADLMDLCDVVEETF 124

>KNAG0I02060 Chr9 complement(401412..401816) [405 bp, 134 aa] {ON}
           Anc_2.163 YNL113W
          Length = 134

 Score = 48.9 bits (115), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 44/90 (48%), Gaps = 2/90 (2%)

Query: 18  KLKIEPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDTKVLFAAYKVEHPLFARFKMRI 75
           K+KI P+    +    +F+   EDHTLGN +R  ++ + +V F  Y + HP      +RI
Sbjct: 38  KVKILPEATTEDGTCASFQILNEDHTLGNALRYVIMKNPEVEFCGYSIPHPSENWLNVRI 97

Query: 76  QTVEGYDPKDALKNACNGIINKLAVLKTNF 105
           QT       DA K     +++   V++  F
Sbjct: 98  QTYGKITAVDAFKKGLGDLMDMCDVVEDVF 127

>TBLA0B01290 Chr2 (274238..274546) [309 bp, 102 aa] {ON} Anc_2.163
           YNL113W
          Length = 102

 Score = 47.8 bits (112), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 39/86 (45%)

Query: 20  KIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAAYKVEHPLFARFKMRIQTVE 79
           ++ P T   +A       EDHTLGN +R  L+ +  V F  Y + HP      +R+QT  
Sbjct: 10  QLPPVTPDGSAASFQIRDEDHTLGNALRYLLMRNPAVEFCGYSIPHPSEPFLNLRVQTYG 69

Query: 80  GYDPKDALKNACNGIINKLAVLKTNF 105
                DAL      +++   V++  F
Sbjct: 70  DITASDALAQGLQDLMDLCDVVEDTF 95

>YNL113W Chr14 (412771..413199) [429 bp, 142 aa] {ON}  RPC19RNA
           polymerase subunit AC19, common to RNA polymerases I and
           III
          Length = 142

 Score = 47.8 bits (112), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 50/102 (49%), Gaps = 8/102 (7%)

Query: 4   PDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAAYKV 63
           PDR ++ LL +  S    E  T A   +V    +EDHTLGN +R  ++ +  V F  Y +
Sbjct: 42  PDREKIKLLTQATS----EDGTSASFQIV----EEDHTLGNALRYVIMKNPDVEFCGYSI 93

Query: 64  EHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNF 105
            HP      +RIQT       DAL+     +++   V+++ F
Sbjct: 94  PHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKF 135

>Smik_14.214 Chr14 (392413..392841) [429 bp, 142 aa] {ON} YNL113W
           (REAL)
          Length = 142

 Score = 47.4 bits (111), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 50/102 (49%), Gaps = 8/102 (7%)

Query: 4   PDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAAYKV 63
           PDR ++ LL +  S    E  T A   +V    +EDHTLGN +R  ++ +  V F  Y +
Sbjct: 42  PDREKIKLLTQATS----EDGTSASFQIV----EEDHTLGNALRYIIMKNPDVEFCGYSI 93

Query: 64  EHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNF 105
            HP      +RIQT       DAL+     +++   V+++ F
Sbjct: 94  PHPSENLLNIRIQTYGESTAVDALQKGLKDLMDLCDVVESKF 135

>Suva_14.225 Chr14 (409562..409990) [429 bp, 142 aa] {ON} YNL113W
           (REAL)
          Length = 142

 Score = 47.0 bits (110), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 52/104 (50%), Gaps = 8/104 (7%)

Query: 2   NAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAAY 61
           + PDR ++ LL +  S    E  T A   +V    +EDHTLGN +R  ++ + +V F  Y
Sbjct: 40  DEPDREKIKLLTQATS----EDGTSASFQIV----EEDHTLGNALRYIIMKNPEVEFCGY 91

Query: 62  KVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNF 105
            + HP      +RIQT       +AL+     +++   V+++ F
Sbjct: 92  SIPHPSENLLNVRIQTYGAITAVEALQKGLKDLMDLCDVVESKF 135

>Ecym_5423 Chr5 complement(871715..872098) [384 bp, 127 aa] {ON}
           similar to Ashbya gossypii AFL220C
          Length = 127

 Score = 46.6 bits (109), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 45/90 (50%), Gaps = 2/90 (2%)

Query: 18  KLKIEPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDTKVLFAAYKVEHPLFARFKMRI 75
           K+++ P+  + +    +F+   EDHTLGN +R  ++ + +V F  Y + HP      +RI
Sbjct: 31  KIRLLPEAASEDGTCASFQISDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSETVLNLRI 90

Query: 76  QTVEGYDPKDALKNACNGIINKLAVLKTNF 105
           QT       +AL      +++   V++  F
Sbjct: 91  QTYGKMTAVEALHKGLKDLMDLCDVVEDKF 120

>TDEL0F01180 Chr6 (211106..211495) [390 bp, 129 aa] {ON} Anc_2.163
           YNL113W
          Length = 129

 Score = 45.8 bits (107), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 2/90 (2%)

Query: 18  KLKIEPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDTKVLFAAYKVEHPLFARFKMRI 75
           K+K+ P   + +    +F+  +EDHTLGN +R  ++ +  V F  Y + HP      +RI
Sbjct: 33  KIKLLPQASSEDGTCASFQIAEEDHTLGNALRYVIMKNKDVEFCGYSIPHPSENLLNLRI 92

Query: 76  QTVEGYDPKDALKNACNGIINKLAVLKTNF 105
           QT       D L+     +++    ++  F
Sbjct: 93  QTYGATTAVDVLQKGLTDLMDLCDAVEDRF 122

>Skud_14.218 Chr14 (402879..403349) [471 bp, 156 aa] {ON} YNL113W
           (REAL)
          Length = 156

 Score = 46.2 bits (108), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 50/104 (48%), Gaps = 8/104 (7%)

Query: 2   NAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAAY 61
           + PDR ++ LL +  S    E  T A   +V    +EDHTLGN +R  ++ +  V F  Y
Sbjct: 54  DEPDREKIKLLTQATS----EDGTNASFQIV----EEDHTLGNALRYIIMKNPDVEFCGY 105

Query: 62  KVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNF 105
            + HP      +RIQT       DAL+     +++   V++  F
Sbjct: 106 SIPHPSENLLNIRIQTYGEITAVDALQKGLKDLMDLCDVVEAKF 149

>ZYRO0B09878g Chr2 complement(771644..772036) [393 bp, 130 aa] {ON}
           highly similar to uniprot|Q755Q7 Ashbya gossypii AFL220C
           AFL220Cp and similar to YNL113W uniprot|P28000
           Saccharomyces cerevisiae YNL113W RPC19 RNA polymerase
           subunit common to RNA polymerases I and III
          Length = 130

 Score = 45.4 bits (106), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 42/90 (46%), Gaps = 2/90 (2%)

Query: 18  KLKIEPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDTKVLFAAYKVEHPLFARFKMRI 75
           K+KI P   + +    +F+  +EDHTLGN +R  ++ +  V F  Y + HP      +R+
Sbjct: 34  KIKILPQATSEDGTCASFQIAEEDHTLGNALRYMIMKNPDVEFCGYSIPHPSENLLNIRV 93

Query: 76  QTVEGYDPKDALKNACNGIINKLAVLKTNF 105
           QT       D L      +++    ++  F
Sbjct: 94  QTYGNVTAVDVLHKGLQDLMDLCDAVEDKF 123

>AFL220C Chr6 complement(25281..25688) [408 bp, 135 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL113W
           (RPC19)
          Length = 135

 Score = 45.1 bits (105), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 43/90 (47%), Gaps = 2/90 (2%)

Query: 18  KLKIEPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDTKVLFAAYKVEHPLFARFKMRI 75
           K+++ P   + +     F+   EDHTLGN +R  ++ + +V F  Y + HP      +RI
Sbjct: 39  KIRLLPQATSEDGTCAFFQITDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENFLNIRI 98

Query: 76  QTVEGYDPKDALKNACNGIINKLAVLKTNF 105
           QT       DAL      +++   V++  F
Sbjct: 99  QTYGKVTAVDALHKGLQDLMDMCDVVEDKF 128

>NCAS0G02550 Chr7 (456827..457279) [453 bp, 150 aa] {ON} Anc_2.163
           YNL113W
          Length = 150

 Score = 45.1 bits (105), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 44/90 (48%), Gaps = 2/90 (2%)

Query: 18  KLKIEPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDTKVLFAAYKVEHPLFARFKMRI 75
           K+KI P+  + +    +F+   EDHTLGN +R  ++ +  V F  Y + HP      +RI
Sbjct: 54  KVKILPEGASEDGTCASFQIVDEDHTLGNALRYIIMKNPNVEFCGYSIPHPSENFLNVRI 113

Query: 76  QTVEGYDPKDALKNACNGIINKLAVLKTNF 105
           QT       +A +     +++   V++  F
Sbjct: 114 QTYGDITAVEAFQKGLQDLMDLCDVVEDKF 143

>SAKL0E10692g Chr5 complement(891637..892032) [396 bp, 131 aa] {ON}
           highly similar to uniprot|P28000 Saccharomyces
           cerevisiae YNL113W RPC19 RNA polymerase subunit common
           to RNA polymerases I and III
          Length = 131

 Score = 44.7 bits (104), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 45/90 (50%), Gaps = 2/90 (2%)

Query: 18  KLKIEPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDTKVLFAAYKVEHPLFARFKMRI 75
           K+K+ P   + +    +F+  +EDHTLGN +R  ++ + +V F  Y + HP      +RI
Sbjct: 35  KIKLLPQATSDDGTSASFQISEEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENLLNVRI 94

Query: 76  QTVEGYDPKDALKNACNGIINKLAVLKTNF 105
           QT       +AL+     +++    ++  F
Sbjct: 95  QTYGKITAVEALQKGLQDLMDMCDAVEDKF 124

>NDAI0F02750 Chr6 complement(673843..674292) [450 bp, 149 aa] {ON}
           Anc_2.163 YNL113W
          Length = 149

 Score = 43.5 bits (101), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 44/90 (48%), Gaps = 2/90 (2%)

Query: 18  KLKIEPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDTKVLFAAYKVEHPLFARFKMRI 75
           K+KI     + +    +F+  +EDHTLGN +R  ++ + +V F  Y + HP      +RI
Sbjct: 53  KIKILQQGASEDGCSASFQILQEDHTLGNALRYIIMKNPQVEFCGYSIPHPSEEFLNIRI 112

Query: 76  QTVEGYDPKDALKNACNGIINKLAVLKTNF 105
           QT       +AL      +++   V++  F
Sbjct: 113 QTYGEITAVEALHKGLQDLMDLCDVVEEKF 142

>KLLA0F23760g Chr6 complement(2218555..2218938) [384 bp, 127 aa]
           {ON} similar to uniprot|P28000 Saccharomyces cerevisiae
           YNL113W RPC19 RNA polymerase subunit common to RNA
           polymerases I and III
          Length = 127

 Score = 40.8 bits (94), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 39/88 (44%)

Query: 18  KLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAAYKVEHPLFARFKMRIQT 77
           KL  E  ++   +       EDHTLGN +R  ++ + +V F  Y + HP      +RIQT
Sbjct: 33  KLLTEATSEDGTSASFRITDEDHTLGNTLRYMIMKNPEVEFCGYSIPHPSENFLHIRIQT 92

Query: 78  VEGYDPKDALKNACNGIINKLAVLKTNF 105
                  +AL      +++    ++  F
Sbjct: 93  YGKITAVEALHKGLGDLMDMCDAVEDRF 120

>KLTH0D09350g Chr4 complement(776115..776555) [441 bp, 146 aa] {ON}
           some similarities with uniprot|P28000 Saccharomyces
           cerevisiae YNL113W RPC19 RNA polymerase subunit common
           to RNA polymerases I and III
          Length = 146

 Score = 40.8 bits (94), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 34/71 (47%)

Query: 35  FEKEDHTLGNLIRSELLNDTKVLFAAYKVEHPLFARFKMRIQTVEGYDPKDALKNACNGI 94
             +EDHTLGN +R  ++ +  V F  Y + HP      +RIQT   +   + L+     +
Sbjct: 69  ISEEDHTLGNALRYIIMKNPDVEFCGYSIPHPSETLLNLRIQTYGKFTAVEVLQKGLQDL 128

Query: 95  INKLAVLKTNF 105
           ++    ++  F
Sbjct: 129 MDLCDAVEDKF 139

>Kwal_26.8473 s26 complement(800017..800469) [453 bp, 150 aa] {ON}
           YNL113W (RPC19) - subunit common to RNA polymerases I
           (A) and III (C) [contig 61] FULL
          Length = 150

 Score = 39.3 bits (90), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 34/71 (47%)

Query: 35  FEKEDHTLGNLIRSELLNDTKVLFAAYKVEHPLFARFKMRIQTVEGYDPKDALKNACNGI 94
             +EDHTLGN +R  ++ +  V F  Y + HP      +RIQT   +   + L+     +
Sbjct: 73  ISEEDHTLGNSLRYIIMKNPDVEFCGYSIPHPSENLLNLRIQTYGKHTALEVLQKGLQDL 132

Query: 95  INKLAVLKTNF 105
           ++    ++  F
Sbjct: 133 MDLCDAVEDKF 143

>TBLA0J00730 Chr10 (169980..172160) [2181 bp, 726 aa] {ON} Anc_5.604
           YOR022C
          Length = 726

 Score = 30.0 bits (66), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 37/86 (43%), Gaps = 3/86 (3%)

Query: 40  HTLGNLIRSELLNDTKVLFAAYKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLA 99
           H+LGNLI  +LLN+TK     +KV +         +  +      D + N     + K  
Sbjct: 499 HSLGNLILFDLLNNTKKYSLNFKVGNYFCLGSPAGVFKLIQRTNIDGINNKAGKELGKRK 558

Query: 100 VLKTNFETE---WNLQTLASDDNYGI 122
            LK  ++ E   W  QTL   + Y I
Sbjct: 559 KLKQKYQLEIDNWQTQTLPCKELYNI 584

>YHL030W Chr8 (40084..45690) [5607 bp, 1868 aa] {ON}  ECM29Scaffold
           protein that assists in association of the proteasome
           core particle with the regulatory particle; degraded by
           the mature proteasome after assembly; contains HEAT-like
           repeats
          Length = 1868

 Score = 29.6 bits (65), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 8/71 (11%)

Query: 11  LLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRS--ELLND---TKVLFAAYKVEH 65
           L  EG  KL++ P T A N  ++  + +  TLG++++   EL++D    + LF + K + 
Sbjct: 397 LHAEGWPKLQLGPQTPAFNTAILQRQLQYETLGDILKRDFELVSDLSYIEFLFESLKNDL 456

Query: 66  PLFARFKMRIQ 76
           P   +F+  IQ
Sbjct: 457 P---QFRSSIQ 464

>NDAI0A03150 Chr1 (709990..712806) [2817 bp, 938 aa] {ON} Anc_7.264
          Length = 938

 Score = 28.1 bits (61), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 20/32 (62%)

Query: 85  DALKNACNGIINKLAVLKTNFETEWNLQTLAS 116
           D++  ACNGII KL+  +     ++N+  LAS
Sbjct: 193 DSISTACNGIIIKLSNYQEANNIKYNISILAS 224

>Kwal_23.5892 s23 (1358818..1360854) [2037 bp, 678 aa] {ON} YIL067C
           - Hypothetical ORF [contig 11] FULL
          Length = 678

 Score = 27.7 bits (60), Expect = 8.1,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 25/54 (46%)

Query: 41  TLGNLIRSELLNDTKVLFAAYKVEHPLFARFKMRIQTVEGYDPKDALKNACNGI 94
           T G+L+R E  N  K    AY  EHP    +++   T + ++  DA     N I
Sbjct: 547 TRGSLLRGEAGNSWKPPVLAYNQEHPHLLNWQVTNSTEKSFEKLDAYSLLINDI 600

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.136    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,434,492
Number of extensions: 504668
Number of successful extensions: 1360
Number of sequences better than 10.0: 48
Number of HSP's gapped: 1359
Number of HSP's successfully gapped: 48
Length of query: 122
Length of database: 53,481,399
Length adjustment: 91
Effective length of query: 31
Effective length of database: 43,046,793
Effective search space: 1334450583
Effective search space used: 1334450583
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)