Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G042506.45ON51751726380.0
ZYRO0C07194g6.45ON55856715100.0
SAKL0E01958g6.45ON52453612181e-163
YOL013C (HRD1)6.45ON55154712091e-161
Smik_15.1576.45ON55054611991e-159
Suva_15.1596.45ON55054811941e-158
Skud_15.1486.45ON54854711801e-156
TBLA0B005606.45ON49252410961e-145
TPHA0F024806.45ON60559910821e-141
Kpol_1035.506.45ON60157610791e-141
KLTH0C10604g6.45ON51552210101e-131
CAGL0E02299g6.45ON54542510011e-130
KAFR0A052406.45ON5535579991e-129
Kwal_56.225226.45ON5135299951e-129
NDAI0C027706.45ON6305469781e-125
NCAS0D020106.45ON5105259551e-123
KNAG0E027406.45ON5564338431e-106
KLLA0C05874g6.45ON5535496537e-78
ACL019C6.45ON5755865798e-67
Ecym_30486.45ON6704195068e-56
Suva_2.3048.317ON624851215e-06
TDEL0B063402.545ON762551206e-06
Ecym_72412.545ON758551197e-06
KLTH0G12408g8.317ON603561181e-05
TBLA0I014902.545ON750541181e-05
NCAS0A047602.545ON761551143e-05
NDAI0K018102.545ON762661134e-05
AFR275W2.545ON753611135e-05
KAFR0B014602.545ON761551135e-05
AGR034W3.279ON159701065e-05
TPHA0C042602.545ON757551135e-05
ZYRO0E05632g2.545ON765551135e-05
Skud_4.4028.317ON612681125e-05
Smik_11.2132.545ON759551126e-05
Suva_11.1892.545ON758551126e-05
YKL034W (TUL1)2.545ON758551126e-05
Kpol_1002.72.545ON754541117e-05
Skud_11.1922.545ON758551118e-05
SAKL0A09812g2.545ON751551119e-05
SAKL0H17116gsingletonON544531091e-04
Kwal_26.80992.545ON750541091e-04
Smik_4.3878.317ON634681082e-04
YDR143C (SAN1)8.317ON610681082e-04
TBLA0A096405.628ON325791062e-04
KLTH0D07216g2.545ON747541072e-04
KLLA0F25674g2.545ON757561072e-04
Ecym_42508.317ON657401063e-04
KLLA0E04071g8.317ON704321054e-04
CAGL0L01947g2.545ON757551054e-04
NCAS0C033108.317ON570711045e-04
NDAI0A074503.279ON17381995e-04
KNAG0A070902.545ON762551036e-04
Kwal_56.239008.317ON589401036e-04
KLTH0C05258g3.279ON15285969e-04
Kwal_27.105463.279ON10485930.001
KNAG0G023908.317ON688321000.002
KAFR0B030708.317ON643381000.002
ZYRO0C11176g5.628ON36852980.002
CAGL0M08690g5.628ON32852970.002
Kpol_526.345.628ON32852970.003
TDEL0F02870na 1ON26094950.003
CAGL0E01441g8.317ON71732970.003
TDEL0D034603.279ON14443920.003
Kpol_1036.668.317ON66888960.004
KNAG0A074303.405ON10258880.004
SAKL0H15686g8.317ON59940960.005
SAKL0G07370g5.628ON32152940.005
YBR062C3.279ON18088910.005
CAGL0K02563g2.542ON58630950.007
NDAI0H008405.628ON34152930.007
ZYRO0D05830g8.317ON78050930.011
Suva_4.3023.279ON15045870.012
NCAS0A04680singletonON27490900.013
Smik_2.1963.279ON18588880.015
Kpol_1052.193.279ON10328840.015
TPHA0C008508.317ON78129910.017
KLLA0E16677g5.628ON30567900.017
KNAG0J008503.279ON16293870.019
KLTH0E02464g5.628ON32952890.023
NDAI0G026308.317ON66134900.024
KAFR0H005605.628ON32770890.025
TBLA0I019603.279ON18487860.025
CAGL0H10274g3.279ON17575860.026
TBLA0A039008.317ON69856890.028
Kwal_55.199995.628ON15252840.032
Ecym_13285.628ON32052880.032
Skud_2.1863.279ON17874850.034
NDAI0D02810na 1ON25298860.038
TBLA0G023102.542ON67430880.038
Suva_2.4335.628ON33769870.040
KAFR0A019902.542ON56030880.041
TDEL0F044408.317ON55437880.044
AER390W5.628ON31652870.044
KNAG0C056602.542ON50749870.045
NCAS0A125502.542ON57297870.049
KLLA0F25740g2.542ON51780870.054
TDEL0A049405.628ON32652860.058
NCAS0A113503.405ON42858860.064
TPHA0A039903.279ON17528830.064
Kpol_1002.82.542ON55872860.065
NCAS0C052905.628ON33077850.067
Kwal_26.8030na 2ON66030860.068
Skud_4.5285.628ON33769850.081
KNAG0A012803.28ON11460790.082
ABR104W3.405ON32829840.087
Kwal_55.21206singletonON27553840.088
NDAI0G052001.389ON1586135860.089
KLTH0D06886gna 2ON66430850.094
TDEL0C054203.405ON9356780.095
KAFR0C004603.279ON15775810.10
SAKL0D03058g3.279ON15539800.11
Smik_4.5165.628ON33773830.12
SAKL0A09526gna 2ON66230840.12
YDR265W (PEX10)5.628ON33729830.12
TPHA0C042502.542ON55626840.13
CAGL0I04576g3.190ON14997800.13
KLLA0E18503gna 2ON65030840.14
ZYRO0E06996g3.279ON17287800.14
Ecym_26583.279ON15943800.15
Suva_15.223.22ON133679840.15
KLTH0F18502gsingletonON26763820.15
TPHA0A033403.405ON38463830.16
ZYRO0B02244g2.542ON56328830.16
KNAG0I013801.389ON149326830.18
Suva_8.422.542ON58526820.20
TDEL0A031802.542ON56748820.20
TBLA0C013301.389ON145229830.20
Ecym_54453.405ON32158810.21
ZYRO0E05192g1.389ON152026820.22
YHL010C (ETP1)2.542ON58526820.22
KLLA0F18458g3.279ON14069770.22
KAFR0I020901.389ON1466105820.23
AGL191W8.317ON58259820.23
CAGL0K08052g3.405ON30559800.24
Smik_8.322.542ON58526810.24
TDEL0A03090na 2ON58630810.25
Skud_8.352.542ON58526810.25
Kpol_1048.731.389ON154926810.29
SAKL0A09746g2.542ON54854810.31
NDAI0I004006.332ON48136800.32
KLTH0D07150g2.542ON54028800.32
NCAS0A087801.389ON150227810.33
Kwal_56.231123.190ON13527760.34
KLLA0E07151g3.28ON11060740.37
NCAS0A082803.279ON11834750.38
TBLA0B087103.28ON12222750.41
Kwal_26.80902.542ON52028790.43
KLTH0F19228g3.28ON11022740.43
KAFR0D046405.339ON302135780.44
Kwal_55.220543.28ON11122740.44
TPHA0I005608.808ON39480790.45
CAGL0B05049g1.389ON147067790.49
TPHA0C003505.628ON27829780.52
SAKL0A01474g6.332ON46869780.58
CAGL0E01567g3.28ON10260720.61
KAFR0F028406.332ON44528780.61
NDAI0B018202.542ON62528780.65
CAGL0J03586g6.332ON41161770.65
KLLA0E17711g3.190ON16227750.69
NDAI0E004408.808ON41635770.70
SAKL0C13178g3.28ON13822730.74
SAKL0C03586gsingletonON147427780.79
KAFR0C017803.28ON11822720.79
SAKL0C01760gsingletonON147427780.80
Kpol_1033.198.288ON113921780.80
ZYRO0C03058g3.28ON11622720.86
Suva_4.5211.344ON69063770.86
Skud_15.203.28ON12122720.86
NDAI0G038603.28ON12322720.90
Kpol_1014.163.28ON10722710.95
TDEL0A004703.28ON11822720.95
TBLA0I023606.332ON64428770.95
YPR093C (ASR1)3.405ON28827750.96
TPHA0P014703.28ON11122711.0
KLLA0F12166g1.389ON152826771.0
NCAS0C044803.28ON10922711.0
YOL138C (RTC1)3.22ON134178761.1
SAKL0D08272g1.389ON149191761.1
KNAG0J015605.628ON30929751.2
ZYRO0B02046gna 2ON44530751.2
YOL133W (HRT1)3.28ON12122711.2
Suva_15.263.28ON12222711.2
Smik_15.203.28ON12122711.2
Ecym_7253na 2ON61730761.3
TDEL0B061701.389ON147026761.4
KAFR0B003407.537ON764120751.4
AER016C3.190ON14729721.4
NDAI0G038103.22ON139368761.4
KLLA0C14542g5.339ON32644741.4
KLLA0C08756g6.332ON42724751.5
ADL181W3.28ON10822701.5
Smik_15.163.22ON132678751.5
Ecym_26848.808ON38636741.6
Sklu_YGOB_Anc_1.4371.437ON7168671.6
KLTH0A06556g6.332ON46032741.7
CAGL0B02013g8.288ON112021751.7
TPHA0G002907.537ON80261741.9
Kpol_1061.53.258ON96830741.9
Kpol_480.228.808ON425114742.0
KLTH0F11044g3.405ON29155732.1
CAGL0L06336g8.247ON60077742.2
SAKL0B08976g3.405ON32255732.2
Ecym_20293.28ON11422692.2
KNAG0I028806.332ON46124732.3
Kwal_14.12871.389ON151827742.4
Kpol_1028.466.332ON44836732.5
KLLA0C15697g3.405ON30455722.5
KLTH0G18150g1.389ON155427732.6
TPHA0B036501.389ON157669732.9
TDEL0A074706.332ON40824723.3
AAL030C1.389ON153923723.3
Suva_2.4815.339ON28767704.0
TBLA0A030505.339ON36166704.5
SAKL0A10384g1.533ON62746715.0
KNAG0I020902.157ON42782705.1
ZYRO0C17424g3.405ON27328695.7
Smik_12.3201.389ON155326705.9
KLLA0E04885g7.537ON76090706.2
Smik_4.5665.339ON29058696.6
ZYRO0B16258g2.157ON579140697.3
Kwal_27.114012.316ON107791697.4
CAGL0H07315g5.339ON27870688.1
ZYRO0D08404g6.332ON40924688.7
NCAS0B009908.808ON39238688.9
Kwal_56.235438.247ON96558699.1
NDAI0G057401.317ON85774689.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G04250
         (517 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {O...  1020   0.0  
ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {...   586   0.0  
SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} simila...   473   e-163
YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON} ...   470   e-161
Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {...   466   e-159
Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {...   464   e-158
Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {...   459   e-156
TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.4...   426   e-145
TPHA0F02480 Chr6 (546818..548635) [1818 bp, 605 aa] {ON} Anc_6.4...   421   e-141
Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON} (1244...   420   e-141
KLTH0C10604g Chr3 complement(878953..880500) [1548 bp, 515 aa] {...   393   e-131
CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {...   390   e-130
KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6...   389   e-129
Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013...   387   e-129
NDAI0C02770 Chr3 (640635..642527) [1893 bp, 630 aa] {ON} Anc_6.4...   381   e-125
NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {O...   372   e-123
KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {O...   329   e-106
KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {...   256   7e-78
ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON} S...   227   8e-67
Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to ...   199   8e-56
Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON...    51   5e-06
TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa] ...    51   6e-06
Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar t...    50   7e-06
KLTH0G12408g Chr7 (1055265..1057076) [1812 bp, 603 aa] {ON} weak...    50   1e-05
TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.5...    50   1e-05
NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.5...    49   3e-05
NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2....    48   4e-05
AFR275W Chr6 (928482..930743) [2262 bp, 753 aa] {ON} Non-synteni...    48   5e-05
KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.5...    48   5e-05
AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic hom...    45   5e-05
TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {O...    48   5e-05
ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {...    48   5e-05
Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON...    48   5e-05
Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034...    48   6e-05
Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034...    48   6e-05
YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}  TUL1Golgi...    48   6e-05
Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON} (19006.....    47   7e-05
Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034...    47   8e-05
SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {...    47   9e-05
SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]...    47   1e-04
Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {O...    47   1e-04
Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON...    46   2e-04
YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}  ...    46   2e-04
TBLA0A09640 Chr1 complement(2375252..2376180,2376263..2376311) [...    45   2e-04
KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {...    46   2e-04
KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} simi...    46   2e-04
Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 b...    45   3e-04
KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some s...    45   4e-04
CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} simil...    45   4e-04
NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317     45   5e-04
NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [...    43   5e-04
KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa] ...    44   6e-04
Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {...    44   6e-04
KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459...    42   9e-04
Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {O...    40   0.001
KNAG0G02390 Chr7 complement(548272..550338) [2067 bp, 688 aa] {O...    43   0.002
KAFR0B03070 Chr2 complement(638210..640141) [1932 bp, 643 aa] {O...    43   0.002
ZYRO0C11176g Chr3 (866350..866539,866607..867523) [1107 bp, 368 ...    42   0.002
CAGL0M08690g Chr13 complement(865182..866168) [987 bp, 328 aa] {...    42   0.002
Kpol_526.34 s526 (83624..84610) [987 bp, 328 aa] {ON} (83624..84...    42   0.003
TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON}      41   0.003
CAGL0E01441g Chr5 (135312..137465) [2154 bp, 717 aa] {ON} some s...    42   0.003
TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.27...    40   0.003
Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa] ...    42   0.004
KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa] {...    39   0.004
SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, ...    42   0.005
SAKL0G07370g Chr7 (604332..604383,604452..605365) [966 bp, 321 a...    41   0.005
YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, ...    40   0.005
CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa] ...    41   0.007
NDAI0H00840 Chr8 complement(189570..190595) [1026 bp, 341 aa] {O...    40   0.007
ZYRO0D05830g Chr4 (495428..497770) [2343 bp, 780 aa] {ON} some s...    40   0.011
Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 b...    38   0.012
NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON}      39   0.013
Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}...    39   0.015
Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON} (60008.....    37   0.015
TPHA0C00850 Chr3 (177213..179558) [2346 bp, 781 aa] {ON} Anc_8.3...    40   0.017
KLLA0E16677g Chr5 complement(1481372..1482289) [918 bp, 305 aa] ...    39   0.017
KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {O...    38   0.019
KLTH0E02464g Chr5 (216256..216301,216358..217301) [990 bp, 329 a...    39   0.023
NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317     39   0.024
KAFR0H00560 Chr8 complement(99045..100028) [984 bp, 327 aa] {ON}...    39   0.025
TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 ...    38   0.025
CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483) ...    38   0.026
TBLA0A03900 Chr1 complement(974843..976939) [2097 bp, 698 aa] {O...    39   0.028
Kwal_55.19999 s55 (206149..206607) [459 bp, 152 aa] {ON} YDR265W...    37   0.032
Ecym_1328 Chr1 complement(681157..682070,682146..682194) [963 bp...    39   0.032
Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 b...    37   0.034
NDAI0D02810 Chr4 complement(650919..651677) [759 bp, 252 aa] {ON}      38   0.038
TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.5...    39   0.038
Suva_2.433 Chr2 (765490..766503) [1014 bp, 337 aa] {ON} YDR265W ...    38   0.040
KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.5...    39   0.041
TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {O...    39   0.044
AER390W Chr5 (1370316..1370364,1370423..1371324) [951 bp, 316 aa...    38   0.044
KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa] ...    38   0.045
NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON} Anc_2...    38   0.049
KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]...    38   0.054
TDEL0A04940 Chr1 (872976..873072,873142..874025) [981 bp, 326 aa...    38   0.058
NCAS0A11350 Chr1 complement(2249991..2251277) [1287 bp, 428 aa] ...    38   0.064
TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.27...    37   0.064
Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON...    38   0.065
NCAS0C05290 Chr3 (1076165..1077157) [993 bp, 330 aa] {ON} Anc_5....    37   0.067
Kwal_26.8030 s26 (616729..618711) [1983 bp, 660 aa] {ON} [contig...    38   0.068
Skud_4.528 Chr4 (941613..942626) [1014 bp, 337 aa] {ON} YDR265W ...    37   0.081
KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28 Y...    35   0.082
ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic hom...    37   0.087
Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {O...    37   0.088
NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_...    38   0.089
KLTH0D06886g Chr4 (600181..602175) [1995 bp, 664 aa] {ON} conser...    37   0.094
TDEL0C05420 Chr3 complement(972821..973102) [282 bp, 93 aa] {ON}...    35   0.095
KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, ...    36   0.10 
SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468...    35   0.11 
Smik_4.516 Chr4 (931711..932724) [1014 bp, 337 aa] {ON} YDR265W ...    37   0.12 
SAKL0A09526g Chr1 (834338..836326) [1989 bp, 662 aa] {ON} conser...    37   0.12 
YDR265W Chr4 (998864..999877) [1014 bp, 337 aa] {ON}  PEX10Perox...    37   0.12 
TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.5...    37   0.13 
CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar...    35   0.13 
KLLA0E18503g Chr5 complement(1645113..1647065) [1953 bp, 650 aa]...    37   0.14 
ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519...    35   0.14 
Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar ...    35   0.15 
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    37   0.15 
KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON} conse...    36   0.15 
TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON} Anc_3.4...    37   0.16 
ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} simila...    37   0.16 
KNAG0I01380 Chr9 (265230..269711) [4482 bp, 1493 aa] {ON} Anc_1....    37   0.18 
Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON} Y...    36   0.20 
TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.5...    36   0.20 
TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1....    37   0.20 
Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON} ...    36   0.21 
ZYRO0E05192g Chr5 (393899..398461) [4563 bp, 1520 aa] {ON} simil...    36   0.22 
YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}  ET...    36   0.22 
KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa] ...    34   0.22 
KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {...    36   0.23 
AGL191W Chr7 (339295..341043) [1749 bp, 582 aa] {ON} Syntenic ho...    36   0.23 
CAGL0K08052g Chr11 complement(800991..801908) [918 bp, 305 aa] {...    35   0.24 
Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON} Y...    36   0.24 
TDEL0A03090 Chr1 (550834..552594) [1761 bp, 586 aa] {ON}               36   0.25 
Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON} Y...    36   0.25 
Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON} (207...    36   0.29 
SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} simila...    36   0.31 
NDAI0I00400 Chr9 complement(80973..82418) [1446 bp, 481 aa] {ON}...    35   0.32 
KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} simila...    35   0.32 
NCAS0A08780 Chr1 (1735117..1739625) [4509 bp, 1502 aa] {ON} Anc_...    36   0.33 
Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {O...    34   0.34 
KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar...    33   0.37 
NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3....    33   0.38 
TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {...    33   0.41 
Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {O...    35   0.43 
KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa] ...    33   0.43 
KAFR0D04640 Chr4 complement(911653..912561) [909 bp, 302 aa] {ON...    35   0.44 
Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa] ...    33   0.44 
TPHA0I00560 Chr9 (112560..113744) [1185 bp, 394 aa] {ON} Anc_8.8...    35   0.45 
CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some ...    35   0.49 
TPHA0C00350 Chr3 complement(58374..59210) [837 bp, 278 aa] {ON} ...    35   0.52 
SAKL0A01474g Chr1 complement(140890..142296) [1407 bp, 468 aa] {...    35   0.58 
CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar...    32   0.61 
KAFR0F02840 Chr6 complement(564020..565357) [1338 bp, 445 aa] {O...    35   0.61 
NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542     35   0.65 
CAGL0J03586g Chr10 complement(343893..345128) [1236 bp, 411 aa] ...    34   0.65 
KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa] ...    33   0.69 
NDAI0E00440 Chr5 (80965..82215) [1251 bp, 416 aa] {ON} Anc_8.808...    34   0.70 
SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa] ...    33   0.74 
SAKL0C03586g Chr3 (337347..341771) [4425 bp, 1474 aa] {ON} weakl...    35   0.79 
KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON...    32   0.79 
SAKL0C01760g Chr3 complement(149641..154065) [4425 bp, 1474 aa] ...    35   0.80 
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    35   0.80 
ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {O...    32   0.86 
Suva_4.521 Chr4 (902071..904143) [2073 bp, 690 aa] {ON} YBR259W ...    34   0.86 
Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W (R...    32   0.86 
NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28...    32   0.90 
Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON...    32   0.95 
TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28 Y...    32   0.95 
TBLA0I02360 Chr9 (541190..543124) [1935 bp, 644 aa] {ON} Anc_6.3...    34   0.95 
YPR093C Chr16 complement(719558..720424) [867 bp, 288 aa] {ON}  ...    33   0.96 
TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {O...    32   1.0  
KLLA0F12166g Chr6 complement(1116715..1121301) [4587 bp, 1528 aa...    34   1.0  
NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28       32   1.0  
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    34   1.1  
SAKL0D08272g Chr4 complement(687452..691927) [4476 bp, 1491 aa] ...    34   1.1  
KNAG0J01560 Chr10 (287736..288665) [930 bp, 309 aa] {ON} Anc_5.6...    33   1.2  
ZYRO0B02046g Chr2 (164680..166017) [1338 bp, 445 aa] {ON} conser...    33   1.2  
YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING fin...    32   1.2  
Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W (R...    32   1.2  
Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W (R...    32   1.2  
Ecym_7253 Chr7 complement(534000..535853) [1854 bp, 617 aa] {ON}...    34   1.3  
TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_...    34   1.4  
KAFR0B00340 Chr2 (77653..79947) [2295 bp, 764 aa] {ON} Anc_7.537...    33   1.4  
AER016C Chr5 complement(659572..660015) [444 bp, 147 aa] {ON} Sy...    32   1.4  
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    34   1.4  
KLLA0C14542g Chr3 (1272215..1273195) [981 bp, 326 aa] {ON} simil...    33   1.4  
KLLA0C08756g Chr3 complement(765847..767130) [1284 bp, 427 aa] {...    33   1.5  
ADL181W Chr4 (379682..380008) [327 bp, 108 aa] {ON} Syntenic hom...    32   1.5  
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    33   1.5  
Ecym_2684 Chr2 complement(1321556..1322716) [1161 bp, 386 aa] {O...    33   1.6  
Sklu_YGOB_Anc_1.437 Chr4 complement(886967..887182) [216 bp, 71 ...    30   1.6  
KLTH0A06556g Chr1 (545636..547018) [1383 bp, 460 aa] {ON} simila...    33   1.7  
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    33   1.7  
TPHA0G00290 Chr7 (47777..50185) [2409 bp, 802 aa] {ON} Anc_7.537...    33   1.9  
Kpol_1061.5 s1061 complement(14626..17532) [2907 bp, 968 aa] {ON...    33   1.9  
Kpol_480.22 s480 (52842..54119) [1278 bp, 425 aa] {ON} (52842..5...    33   2.0  
KLTH0F11044g Chr6 (937668..938543) [876 bp, 291 aa] {ON} weakly ...    33   2.1  
CAGL0L06336g Chr12 (715056..716858) [1803 bp, 600 aa] {ON} some ...    33   2.2  
SAKL0B08976g Chr2 complement(766719..767687) [969 bp, 322 aa] {O...    33   2.2  
Ecym_2029 Chr2 (47083..47427) [345 bp, 114 aa] {ON} similar to A...    31   2.2  
KNAG0I02880 Chr9 complement(562281..563666) [1386 bp, 461 aa] {O...    33   2.3  
Kwal_14.1287 s14 (263082..267638) [4557 bp, 1518 aa] {ON} YLR247...    33   2.4  
Kpol_1028.46 s1028 complement(110464..110775,110777..111811) [13...    33   2.5  
KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} simil...    32   2.5  
KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa...    33   2.6  
TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {...    33   2.9  
TDEL0A07470 Chr1 (1302286..1303512) [1227 bp, 408 aa] {ON} Anc_6...    32   3.3  
AAL030C Chr1 complement(284758..289377) [4620 bp, 1539 aa] {ON} ...    32   3.3  
Suva_2.481 Chr2 complement(853097..853960) [864 bp, 287 aa] {ON}...    32   4.0  
TBLA0A03050 Chr1 complement(731447..732532) [1086 bp, 361 aa] {O...    32   4.5  
SAKL0A10384g Chr1 complement(908415..910298) [1884 bp, 627 aa] {...    32   5.0  
KNAG0I02090 Chr9 complement(407893..409176) [1284 bp, 427 aa] {O...    32   5.1  
ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa] ...    31   5.7  
Smik_12.320 Chr12 complement(573526..578187) [4662 bp, 1553 aa] ...    32   5.9  
KLLA0E04885g Chr5 complement(433298..435580) [2283 bp, 760 aa] {...    32   6.2  
Smik_4.566 Chr4 complement(1020697..1021569) [873 bp, 290 aa] {O...    31   6.6  
ZYRO0B16258g Chr2 complement(1317605..1319344) [1740 bp, 579 aa]...    31   7.3  
Kwal_27.11401 s27 complement(788598..791831) [3234 bp, 1077 aa] ...    31   7.4  
CAGL0H07315g Chr8 (715930..716766) [837 bp, 278 aa] {ON} similar...    31   8.1  
ZYRO0D08404g Chr4 complement(728281..729510) [1230 bp, 409 aa] {...    31   8.7  
NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa] {O...    31   8.9  
Kwal_56.23543 s56 complement(591514..594411) [2898 bp, 965 aa] {...    31   9.1  
NDAI0G05740 Chr7 (1421943..1424516) [2574 bp, 857 aa] {ON} Anc_1...    31   9.6  

>TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {ON}
           Anc_6.45 YOL013C
          Length = 517

 Score = 1020 bits (2638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/517 (97%), Positives = 506/517 (97%)

Query: 1   MAISETRKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTEGFNIVIITVFFTLNS 60
           MAISETRKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTEGFNIVIITVFFTLNS
Sbjct: 1   MAISETRKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTEGFNIVIITVFFTLNS 60

Query: 61  VLLWKLSTSLLFGSLRLIEYEHIFERLPFTIINTMLMSSMFSEHDFLTVAIYGLLLLFMK 120
           VLLWKLSTSLLFGSLRLIEYEHIFERLPFTIINTMLMSSMFSEHDFLTVAIYGLLLLFMK
Sbjct: 61  VLLWKLSTSLLFGSLRLIEYEHIFERLPFTIINTMLMSSMFSEHDFLTVAIYGLLLLFMK 120

Query: 121 VFHWILRDRLEALLQTIQESTTLSDLIFTRFTFNLVLLAIADYQIISHCVSNSLDNSFGA 180
           VFHWILRDRLEALLQTIQESTTLSDLIFTRFTFNLVLLAIADYQIISHCVSNSLDNSFGA
Sbjct: 121 VFHWILRDRLEALLQTIQESTTLSDLIFTRFTFNLVLLAIADYQIISHCVSNSLDNSFGA 180

Query: 181 SASVHLMMGMEFAXXXXXXXXXXXHAALCFYEFYQSQTHGRRNAVNDDEDDTQFSGLEGK 240
           SASVHLMMGMEFA           HAALCFYEFYQSQTHGRRNAVNDDEDDTQFSGLEGK
Sbjct: 181 SASVHLMMGMEFALLLIDLLNTTLHAALCFYEFYQSQTHGRRNAVNDDEDDTQFSGLEGK 240

Query: 241 FIYERVIDISTRFLKTVLHALLLVPFRMPIMLIKDVLWDCLTLHQNAKGLWKIWRNNKQL 300
           FIYERVIDISTRFLKTVLHALLLVPFRMPIMLIKDVLWDCLTLHQNAKGLWKIWRNNKQL
Sbjct: 241 FIYERVIDISTRFLKTVLHALLLVPFRMPIMLIKDVLWDCLTLHQNAKGLWKIWRNNKQL 300

Query: 301 DDKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWM 360
           DDKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWM
Sbjct: 301 DDKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWM 360

Query: 361 ERSQTCPICRLAVFDEMGNVVQSTVPTTAEVTPTDEINVPETVVERSQEQIQDNQQQMGE 420
           ERSQTCPICRLAVFDEMGNVVQSTVPTTAEVTPTDEINVPETVVERSQEQIQDNQQQMGE
Sbjct: 361 ERSQTCPICRLAVFDEMGNVVQSTVPTTAEVTPTDEINVPETVVERSQEQIQDNQQQMGE 420

Query: 421 GQVAVLDSWYSFPVEETSENLVTFSMKNSATNETVPASLLIERTNASERYDDDDDQVETI 480
           GQVAVLDSWYSFPVEETSENLVTFSMKNSATNETVPASLLIERTNASERYDDDDDQVETI
Sbjct: 421 GQVAVLDSWYSFPVEETSENLVTFSMKNSATNETVPASLLIERTNASERYDDDDDQVETI 480

Query: 481 IIPDEVVDQAQTIENLKRRVSELESQVEHLNKRVRKD 517
           IIPDEVVDQAQTIENLKRRVSELESQVEHLNKRVRKD
Sbjct: 481 IIPDEVVDQAQTIENLKRRVSELESQVEHLNKRVRKD 517

>ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 558

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/567 (52%), Positives = 380/567 (67%), Gaps = 65/567 (11%)

Query: 1   MAISETRKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTEGFNIVIITVFFTLNS 60
           MA S+TR+RQ   F++ VYALTIY+VYN+ RTS+SFLQ  ++LT GFN+VI+TVF  LNS
Sbjct: 1   MATSDTRRRQVACFALSVYALTIYAVYNSARTSVSFLQATIKLTTGFNVVILTVFTILNS 60

Query: 61  VLLWKLSTSLLFGSLRLIEYEHIFERLPFTIINTMLMSSMFSEHDFLTVAIYGLLLLFMK 120
            +LWKLST++LFG+L L+EYEHIFERLPFTIINT+ MSSMF E DF TV ++GLLLL+MK
Sbjct: 61  AVLWKLSTAILFGNLSLLEYEHIFERLPFTIINTVFMSSMFHEQDFFTVTLFGLLLLYMK 120

Query: 121 VFHWILRDRLEALLQTIQESTTLSDLIFTRFTFNLVLLAIADYQIISHCVSNSLDNSFGA 180
           VFHWIL+DRLEALLQ+I ESTTL  LI TRF+FNLVLLAI DY+I+S C++NSL NSFGA
Sbjct: 121 VFHWILKDRLEALLQSIHESTTLKSLICTRFSFNLVLLAILDYKIVSGCITNSLSNSFGA 180

Query: 181 SASVHLMMGMEFAXXXXXXXXXXXHAALCFYEFYQSQTHGRRNAV----------NDDED 230
           S SVHLM+GMEFA           H  L FYEFY++Q     ++V          N+DED
Sbjct: 181 STSVHLMVGMEFAMLLIDLLNLAMHTVLNFYEFYRTQVDAHLSSVDTDTDGGDEENEDED 240

Query: 231 --DTQFSGLEGKFIYERVIDISTRFLKTVLHALLLVPFRMPIMLIKDVLWDCLTLHQNAK 288
              + F+GLEGKF+YERVID+ TRFLKT++HA++L+PFRM I+LIKDV WD LTL Q   
Sbjct: 241 VNGSSFAGLEGKFMYERVIDVFTRFLKTLIHAIMLIPFRMSILLIKDVFWDVLTLCQIVS 300

Query: 289 GLWKIWRNNKQLDDKLPTMSEDQLRNIDNMCIICMDELIPEQDE---GHTR-----NTKN 340
            LW+IW+NNKQLDDKL TMS  +L   DN+CI+CMDEL  + +E   G  R       K 
Sbjct: 301 SLWRIWQNNKQLDDKLKTMSPVELSATDNICIVCMDELCADLEEVVQGPDREKVAKTGKY 360

Query: 341 KPKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFDEMGNVVQSTVPTTAEVTPTD----- 395
           KPKRLPCGHVLHL+CLKNWMERSQTCPICRL VFDE GNVVQS   TT   T        
Sbjct: 361 KPKRLPCGHVLHLFCLKNWMERSQTCPICRLPVFDENGNVVQSQSSTTNRTTQATNQSTN 420

Query: 396 ---------------------EINVPETVVERSQEQIQDNQQQMG---------EGQVAV 425
                                E++        +    Q  QQ +G         +    +
Sbjct: 421 VTTTAATTTTTTTTTTTTSTTEMDSSGGSTASTPSSRQSTQQTLGDLTPTPTTADSNSNI 480

Query: 426 LDSWYSFPVEETSENLVTFSMKNSATNETVPASLLIERTNASERYDDDDDQVETIIIPDE 485
            + WYS+P++E  + +VTFS+++S +   V A L +          ++D++ + I IP+E
Sbjct: 481 ANLWYSYPIQEAKDGVVTFSLRDSVSGNPVRAKLTL----------NNDNETQRITIPNE 530

Query: 486 VVDQAQTIENLKRRVSELESQVEHLNK 512
            +   ++I+ LKRR+SELE+QV  +++
Sbjct: 531 CIHHLESIQGLKRRISELEAQVREMSE 557

>SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} similar
           to uniprot|Q08109 Saccharomyces cerevisiae YOL013C HRD1
           Ubiquitin-protein ligase required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins genetically linked to the unfolded protein
           response (UPR) regulated through association with Hrd3p
           contains an H2 ring finger
          Length = 524

 Score =  473 bits (1218), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 242/536 (45%), Positives = 350/536 (65%), Gaps = 31/536 (5%)

Query: 1   MAISETRKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTEGFNIVIITVFFTLNS 60
           M +S+ R+ QFIV+S+F Y+  I+SVY++  +S++FLQT ++L EG N++I+  F  LN 
Sbjct: 1   MPVSQNRRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNG 60

Query: 61  VLLWKLSTSLLFGSLRLIEYEHIFERLPFTIINTMLMSSMFSEHDFLTVAIYGLLLLFMK 120
           VLLWKL T LLFG LRLIEYEH+FERL FTI+N++ +SSMF E DFLTV ++  +L+F+K
Sbjct: 61  VLLWKLLTRLLFGELRLIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLK 120

Query: 121 VFHWILRDRLEALLQTIQESTTLSDLIFTRFTFNLVLLAIADYQIISHCVSNSLDNSFGA 180
           VFHWIL+DRLE + Q   E+T L  ++F+RF FNL+ LA  DYQ++ +C+SNS+ N    
Sbjct: 121 VFHWILKDRLEFVFQNANENTNLKKMLFSRFNFNLLFLASVDYQMVRYCLSNSISNDQWT 180

Query: 181 SASVHLMMGMEFAXXXXXXXXXXXHAALCFYEFYQSQTHGRRNAVNDDEDDTQFSGLEGK 240
           S+SV+LM G++FA           H  + F E Y+ Q+H       +   D +F GLEGK
Sbjct: 181 SSSVYLMFGIDFAMLLVDTLSIGLHGVVNFVEVYRLQSH-------NSHYDEEFLGLEGK 233

Query: 241 FIYERVIDISTRFLKTVLHALLLVPFRMPIMLIKDVLWDCLTLHQNAKGLWKIWRNNKQL 300
           F+YE++ID+  R LK +LH  LL+PFRMPIM+IKD++WD ++L+Q A  LWK W+N K+L
Sbjct: 234 FMYEKLIDMGARLLKMLLHIALLIPFRMPIMIIKDIIWDAISLYQTATSLWKTWKNAKKL 293

Query: 301 DDKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWM 360
           D+KLP ++E++L   +NMCI+CMD+++P  +   TRN   KPK+LPCGH+LHL CLK+WM
Sbjct: 294 DEKLPDVTEEELNQGNNMCIVCMDDMLPNSE---TRNANLKPKKLPCGHILHLSCLKSWM 350

Query: 361 ERSQTCPICRLAVFDEMGNVV-----------------QSTVPTTAEVTPTDEINVPETV 403
           ERSQTCPICRL VFDE GNV                  Q       ++T +       +V
Sbjct: 351 ERSQTCPICRLPVFDERGNVTRMDSSSQEQQLPHNLQRQEAEGEVVQMTTSPFHTTSASV 410

Query: 404 VERSQEQIQDNQQQMGEGQVAVLDSWYSFPVE--ETSENLVTFSMKNSATNETVPASLLI 461
              S    Q N+  +      V   WY+FP+E  +T+++ V F + +S  NE + A+LL 
Sbjct: 411 GPTSTTPTQANRSVIMPQVPRVPQDWYAFPIEATQTTKDKVVFKLVDSDNNE-ITANLLT 469

Query: 462 ERTNASERYDDDDDQVETIIIPDEVVDQAQTIENLKRRVSELESQVEHLNKRVRKD 517
            +T    +   +    + I IP   ++Q + IE+LKR++SE+E++++ L KRVR +
Sbjct: 470 -KTRPQFQKVTEVSGGQRITIPQSCIEQKEEIESLKRKISEMENKLDALTKRVRTE 524

>YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON}
           HRD1Ubiquitin-protein ligase; required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins; genetically linked to the unfolded protein
           response (UPR); regulated through association with
           Hrd3p; contains an H2 ring finger; likely plays a
           general role in targeting proteins that persistently
           associate with and potentially obstruct the ER-localized
           translocon
          Length = 551

 Score =  470 bits (1209), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 258/547 (47%), Positives = 340/547 (62%), Gaps = 62/547 (11%)

Query: 3   ISETRKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTEGFNIVIITVFFTLNSVL 62
           + E R++Q  +F +  Y LT Y VY+AT+TS+SFLQ  L+L EGFN++++++F  LNS L
Sbjct: 2   VPENRRKQLAIFVVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNSTL 61

Query: 63  LWKLSTSLLFGSLRLIEYEHIFERLPFTIINTMLMSSMFSEHDFLTVAIYGLLLLFMKVF 122
           LW+L T LLFG LRLIE+EHIFERLPFTIINT+ MSS+F E  F TVA +GLLLL++KVF
Sbjct: 62  LWQLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSLFHERYFFTVAFFGLLLLYLKVF 121

Query: 123 HWILRDRLEALLQTIQESTTLSDLIFTRFTFNLVLLAIADYQIISHCVSNSLDNSFG--A 180
           HWIL+DRLEALLQ+I +STT+  LIF+RF+FNLVLLA+ DYQII+ C+S+   N      
Sbjct: 122 HWILKDRLEALLQSINDSTTMKTLIFSRFSFNLVLLAVVDYQIITRCISSIYTNQKSDIE 181

Query: 181 SASVHLMMGMEFAXXXXXXXXXXXHAALCFYEFYQSQ----------THGRRNAVNDDED 230
           S S++L+  MEF               L F+EFY+SQ           HG     N  E 
Sbjct: 182 STSLYLIQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSLSNENNHIVHGDPTDENTVES 241

Query: 231 DT----------------QFSGLEGKFIYERVIDISTRFLKTVLHALLLVPFRMPIMLIK 274
           D                 QF+GLEGKF+YE+ ID+ TRFLKT LH  +L+PFRMP+ML+K
Sbjct: 242 DQSQPVLNDDDDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLK 301

Query: 275 DVLWDCLTLHQNAKGLWKIWRNNKQLDDKLPTMSEDQLRNI---DNMCIICMDELIPEQD 331
           DV+WD L L+Q+   LWKIWRNNKQLDD L T++ +QL+N    DN+CIICMDELI   +
Sbjct: 302 DVVWDILALYQSGTSLWKIWRNNKQLDDTLVTVTVEQLQNSANDDNICIICMDELIHSPN 361

Query: 332 EGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFDEMGNVVQSTVPTTAEV 391
           +   +N   KPKRLPCGH+LHL CLKNWMERSQTCPICRL VFDE GNVVQ+T  + +++
Sbjct: 362 QQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQTTFTSNSDI 421

Query: 392 TP-----------------TDEINVPETVVERSQEQIQDNQQ-----QMGEGQVAVLDSW 429
           T                   +E+++  T       +I   Q                 +W
Sbjct: 422 TTQTTVTDSTGIATDQQGFANEVDLLPTRTTSPDIRIVPTQNIDTLAMRTRSTSTPSPTW 481

Query: 430 YSFPVEETSENLVT-------FSMKNSATNET-VPASLLIERTNASERYDDDDDQV-ETI 480
           Y+FP+ +T +N V        F + NS   E  +P  L IE    +  + D  +Q+ + I
Sbjct: 482 YTFPLHKTGDNSVGSSRSAYEFLITNSDEKENGIPVKLTIENHEVNSLHGDGGEQIAKKI 541

Query: 481 IIPDEVV 487
           +IPD+ +
Sbjct: 542 VIPDKFI 548

>Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score =  466 bits (1199), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 265/546 (48%), Positives = 337/546 (61%), Gaps = 61/546 (11%)

Query: 3   ISETRKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTEGFNIVIITVFFTLNSVL 62
           + E R++Q +VF +  Y LT Y VY+AT+TS+SFLQ  L+L EGFN++++++F  LNS L
Sbjct: 2   VPENRRKQLVVFIVITYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFVLLNSTL 61

Query: 63  LWKLSTSLLFGSLRLIEYEHIFERLPFTIINTMLMSSMFSEHDFLTVAIYGLLLLFMKVF 122
           LW L T LLFG LRLIE+EHIFERLPFTIINT+ MSSMF E  F TVA +GLLLL++KVF
Sbjct: 62  LWHLLTRLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKVF 121

Query: 123 HWILRDRLEALLQTIQESTTLSDLIFTRFTFNLVLLAIADYQIISHCVSNSLDNSF--GA 180
           HWIL+DRLEALLQ+I +STT+  LIF+RF+ NLVLLA  DYQII HC+S+   N      
Sbjct: 122 HWILKDRLEALLQSINDSTTMKTLIFSRFSLNLVLLAALDYQIIVHCISSIYTNQKIDIV 181

Query: 181 SASVHLMMGMEFAXXXXXXXXXXXHAALCFYEFY---QSQTHGRRNAVNDDEDDT----- 232
           S S++LM  MEF               L F+EFY   QSQ+    + V+DD  D      
Sbjct: 182 STSLYLMQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSQSDDGNHIVHDDLSDGNRVDF 241

Query: 233 -----------------QFSGLEGKFIYERVIDISTRFLKTVLHALLLVPFRMPIMLIKD 275
                            QF+GLEGKF+YE+ ID+ TRFLKT LH  +L+PFRMP+ML+KD
Sbjct: 242 DGSQHALNDDGDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKD 301

Query: 276 VLWDCLTLHQNAKGLWKIWRNNKQLDDKLPTMSEDQLRNI---DNMCIICMDELIPEQDE 332
           V+WD L L+Q+A GLWKIWRNNKQLDD L T++ +QL+N    DN+CIICMDELI   ++
Sbjct: 302 VIWDILALYQSATGLWKIWRNNKQLDDSLLTVTVEQLQNSANEDNICIICMDELIHSTNQ 361

Query: 333 GHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFDEMGNVVQSTVP------ 386
              +N   KPKRLPCGH+LHL CLKNWMERSQTCPICRL VFD+ GNVVQ+T        
Sbjct: 362 QTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDDKGNVVQTTFTSETNSS 421

Query: 387 --------TTAEVTPTDEINVPETVVERSQE---QIQDNQQQMGEGQVA-----VLDSWY 430
                   T   V   D  N  E +  R+     +I  NQ        A        +W 
Sbjct: 422 ITMAATDNTRTIVNSQDFANETELLPTRTTSPDVRILPNQNTNTFASRATSTSTSSTTWC 481

Query: 431 SFPVEETSENLV------TFSMKNSATNE-TVPASLLIERTNASERYDDDDDQV--ETII 481
            FP+++T +N V       F M +S   E ++P  L IE         D + Q   + I+
Sbjct: 482 KFPLQQTEDNDVESRSTYEFLMTSSDEKESSIPVKLTIESHEIDYLQGDGEGQTAQKKIV 541

Query: 482 IPDEVV 487
           IP + +
Sbjct: 542 IPSKFI 547

>Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score =  464 bits (1194), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 252/548 (45%), Positives = 341/548 (62%), Gaps = 61/548 (11%)

Query: 3   ISETRKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTEGFNIVIITVFFTLNSVL 62
           + E R++Q + F +  Y LT Y VY+AT+TS+SFLQ  L+L EGFN++++++F  LNS L
Sbjct: 2   VPENRRKQLVAFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNSTL 61

Query: 63  LWKLSTSLLFGSLRLIEYEHIFERLPFTIINTMLMSSMFSEHDFLTVAIYGLLLLFMKVF 122
           LW+L T LLFG LRLIE+EHIFERLPFTIINT+ MSSMF E  F TVA +GLLLL++KVF
Sbjct: 62  LWQLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKVF 121

Query: 123 HWILRDRLEALLQTIQESTTLSDLIFTRFTFNLVLLAIADYQIISHCVSNSLDNSF--GA 180
           HWI++DRLEALLQ+I +STTL  LIF+RF+FNL LLA+ DYQII+ C+S+   N      
Sbjct: 122 HWIIKDRLEALLQSINDSTTLKTLIFSRFSFNLALLALTDYQIITRCISSIYTNKNIDVV 181

Query: 181 SASVHLMMGMEFAXXXXXXXXXXXHAALCFYEFY---QSQTHGRRNAVNDDEDDT----- 232
           S S++LM  MEF              +L F+EFY   QSQ++   + V D+ +D      
Sbjct: 182 STSLYLMQVMEFTMLLIDLLNLFLQTSLNFWEFYCSQQSQSNENNHIVQDEVEDENEVDS 241

Query: 233 ----------------QFSGLEGKFIYERVIDISTRFLKTVLHALLLVPFRMPIMLIKDV 276
                           QF+GLEGKF+YE+ ID+ TRFLKT LH  +L+PFRMP+ML+KDV
Sbjct: 242 GEPHAELDDDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKDV 301

Query: 277 LWDCLTLHQNAKGLWKIWRNNKQLDDKLPTMSEDQLRNI---DNMCIICMDELIPEQDEG 333
           +WD L L+Q+A  LWKIWRNNKQLDD L T++ +Q++N    DN+CIICMDELI   ++ 
Sbjct: 302 VWDVLALYQSATTLWKIWRNNKQLDDTLITVTIEQMQNSANEDNICIICMDELIHSANQQ 361

Query: 334 HTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFDEMGNVVQSTVPTTAE--- 390
             +N   KPKRLPCGH+LHL CLKNWMERSQTCPICRL VFDE GNVVQ+   + +    
Sbjct: 362 AWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQTPFTSNSTTTR 421

Query: 391 -------------------VTPTDEINVPETVVERSQEQIQDNQQQMGEGQVAVLDSWYS 431
                              ++  D   +P   +             M     A  ++WY+
Sbjct: 422 NNTSTTDTTRTATTATNQYISTNDTELIPTRTIPHDAGIASSQNMNMSASMSASSNTWYT 481

Query: 432 FPVEETS-----ENLVTFSMKNSATNE---TVPASLLIE--RTNASERYDDDDDQVETII 481
           FP+++T          T+    S++NE   ++P  L +E    N+ +  +++    + I+
Sbjct: 482 FPLQQTGNTSGESKCSTYEFLISSSNEKDNSIPVKLTVESHELNSEQGREEEQGAQKRIV 541

Query: 482 IPDEVVDQ 489
           IPD+ +  
Sbjct: 542 IPDQFIQH 549

>Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {ON}
           YOL013C (REAL)
          Length = 548

 Score =  459 bits (1180), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 258/547 (47%), Positives = 343/547 (62%), Gaps = 61/547 (11%)

Query: 3   ISETRKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTEGFNIVIITVFFTLNSVL 62
           + E R++Q IVF +  Y LT Y VY+AT+TS+SFLQ  L+L EGFN++++++F  LNS L
Sbjct: 2   VPENRRKQLIVFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNSTL 61

Query: 63  LWKLSTSLLFGSLRLIEYEHIFERLPFTIINTMLMSSMFSEHDFLTVAIYGLLLLFMKVF 122
           LW+L T LLFG LRLIE+EHIFERLPFTIINT+ MSSMF E  F TVA +GLLLL++KVF
Sbjct: 62  LWQLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKVF 121

Query: 123 HWILRDRLEALLQTIQESTTLSDLIFTRFTFNLVLLAIADYQIISHCVSNSLDNSFG--A 180
           HWIL+DRLEALLQ+I +STT+ +LI +RF+FNLVLLA+ D+QI+  C+S+   N      
Sbjct: 122 HWILKDRLEALLQSINDSTTMKNLILSRFSFNLVLLAVVDFQILIRCISSIYTNQNIDII 181

Query: 181 SASVHLMMGMEFAXXXXXXXXXXXHAALCFYEFY---QSQTHGRRNAVNDDEDDT----- 232
           S S++LM  MEF               L F+EFY   QSQ++   + V+DD  +      
Sbjct: 182 STSLYLMQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSQSNESNHIVHDDTPNGVGFEE 241

Query: 233 -------------QFSGLEGKFIYERVIDISTRFLKTVLHALLLVPFRMPIMLIKDVLWD 279
                        QF+GLEGKF+YE+ ID+ TRFLKT LH  +L+PFRMP+ML+KDV+WD
Sbjct: 242 AHAVLNDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPLMLLKDVVWD 301

Query: 280 CLTLHQNAKGLWKIWRNNKQLDDKLPTMSEDQLRNI---DNMCIICMDELIPEQDEGHTR 336
            L L+Q+   LWKIWRNNKQLDD L T++ +QL+N    DN+CIICMDEL+  Q +   +
Sbjct: 302 VLALYQSGTSLWKIWRNNKQLDDALITVTAEQLQNSANEDNICIICMDELMHSQADQTWK 361

Query: 337 NTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFDEMGNVVQSTVPTTAEVTPTDE 396
           N   KPKRLPCGH+LHL CLKNWMERSQTCPICRL+VFDE GNVVQST  +    T T+ 
Sbjct: 362 NKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLSVFDEKGNVVQSTFTSNTGTTSTNT 421

Query: 397 INVPETVVERSQEQIQDNQQQMGEGQVAVLD------------------------SWYSF 432
                T    ++ Q+  NQ ++   +    D                         WY+F
Sbjct: 422 TVTGATSATINR-QVFTNQTELLPTRTTSPDVGIIPNHNINTLASRSTSTSTSSTMWYTF 480

Query: 433 PVEETSEN-------LVTFSMKNSATNE-TVPASLLIE--RTNASERYDDDDDQVETIII 482
           P+++T ++          F M NS   E  +P  L +E    N+ +  ++     + I+I
Sbjct: 481 PLQQTDDDSNESKCSTYEFLMTNSNEKEDRIPVKLTVESHEVNSLQGGEEVQGTQKRIVI 540

Query: 483 PDEVVDQ 489
           PD+ +  
Sbjct: 541 PDKFIQH 547

>TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.45
           YOL013C
          Length = 492

 Score =  426 bits (1096), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 241/524 (45%), Positives = 341/524 (65%), Gaps = 55/524 (10%)

Query: 1   MAISETRKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTEGFNIVIITVFFTLNS 60
           M   ++R  QF++F++F+Y LT  SVY A  +SISFLQ  ++LT+GFNI+II++F  +NS
Sbjct: 1   MPFYQSRTAQFVLFTLFIYVLTFASVYFAISSSISFLQVTIKLTQGFNIIIISIFSIINS 60

Query: 61  VLLWKLSTSLLFGSLRLIEYEHIFERLPFTIINTMLMSSMFSEHDFLTVAIYGLLLLFMK 120
           ++LWK S  LLFG LRLIEYEH+ ERLPFT+IN + MSSMF+EHD  T  I  LLLL+MK
Sbjct: 61  IILWKFSNYLLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHDIFTTIILSLLLLYMK 120

Query: 121 VFHWILRDRLEALLQTIQESTTLSDLIF-TRFTFNLVLLAIADYQIISHCVSNSL--DNS 177
           V +WILRDRLE+LLQT+ +STT+ +LIF T+F FNL+L ++ DY +++ C+SNSL  +++
Sbjct: 121 VSNWILRDRLESLLQTVNDSTTIFNLIFSTQFFFNLILFSLIDYLMMNFCISNSLLSNSN 180

Query: 178 FGASASVHLMMGMEFAXXXXXXXXXXXHAALCFYEFYQSQ-----THGRRNAVNDDEDDT 232
            G+SASV+L+MGMEF            H+ L  YEFY+S      TH    + ++++D++
Sbjct: 181 IGSSASVYLLMGMEFTMLLVDLFNILCHSILNIYEFYKSSLVSLDTH--LTSEDEEDDES 238

Query: 233 QFSGLEGKFIYERVIDISTRFLKTVLHALLLVPFRMPIMLIKDVLWDCLTLHQNAKGLWK 292
            F+GLEGKFIYE++ID  TRFLKT++H LLL+PF MP+ML KDV+ D +TL QN   +WK
Sbjct: 239 GFNGLEGKFIYEKIIDTFTRFLKTIIHILLLIPFAMPVMLSKDVVIDLVTLSQNINTIWK 298

Query: 293 IWRNNKQLDDKLPTMSEDQLRNI-DNMCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVL 351
           IW NN++LDD+LPT+++ QL ++ D +CIICMD+L     + +    K KPK LPCGH+L
Sbjct: 299 IWVNNRKLDDQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFE--KRKPKMLPCGHIL 356

Query: 352 HLYCLKNWMERSQTCPICRLAVFDEMGNVVQSTVPTTAEVTPTDEINVPETVVERSQEQI 411
           H+ CLKNWMERSQTCP+CRL VF+E G V    +PT  E   T E +   +      E+ 
Sbjct: 357 HMNCLKNWMERSQTCPMCRLPVFNEKGEV----LPTRRERATTPEPSTSTSSDSEENEE- 411

Query: 412 QDNQQQMGEGQVAVLDSWYSFPVEETSENLVTFSMKNSATNETVPASLLIERTNASERYD 471
                            W SFP+E   ++ +TF++ N      + + LLI  T  + +  
Sbjct: 412 -----------------WVSFPIETIDDSTITFNLANDD-GRILKSRLLINSTTDTTQNS 453

Query: 472 DDDDQVETIIIPDEVVDQAQTIENLKRRVSELESQVEHLNKRVR 515
           DD                   I  LK+++++L+ Q+  LNK ++
Sbjct: 454 DD-------------------ILGLKQKINQLQDQINQLNKNMK 478

>TPHA0F02480 Chr6 (546818..548635) [1818 bp, 605 aa] {ON} Anc_6.45
           YOL013C
          Length = 605

 Score =  421 bits (1082), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 234/599 (39%), Positives = 353/599 (58%), Gaps = 90/599 (15%)

Query: 2   AISETRKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTEGFNIVIITVFFTLNSV 61
           ++S TRK Q  + +  +Y  TI+  Y A ++S S+LQ  ++LT+G N++I+ +F  LN  
Sbjct: 3   SLSVTRKYQLALITFVIYTSTIFVTYLAIQSSSSYLQVTIKLTKGLNVIILVLFGLLNVA 62

Query: 62  LLWKLSTSLLFGSLRLIEYEHIFERLPFTIINTMLMSSMFSEHDF-LTVAIYGLLLLFMK 120
            +WK    LLF SLRLIEYEHI ERLPFTIIN  L+SSMF+E D  ++++ YG++L+FMK
Sbjct: 63  FIWKGLMYLLFSSLRLIEYEHILERLPFTIINFCLLSSMFNERDIIMSISSYGMILIFMK 122

Query: 121 VFHWILRDRLEALLQTIQESTTLSDLIFT-RFTFNLVLLAIADYQIISHCVSNSLDNSFG 179
           V HW+L+DRLE+LLQ++ +++++  LIF+ RF  NL L A+ DYQ++  CV+NS+ NS G
Sbjct: 123 VAHWVLKDRLESLLQSMNDNSSIRSLIFSNRFFLNLGLFAVIDYQMMMQCVTNSIKNSMG 182

Query: 180 ASASVHLMMGMEFAXXXXXXXXXXXHAALCFYEFYQSQTHGRRNAVNDDED-----DTQF 234
           AS S+HL++G+EF            H  L  YEF++S      N V +DED     + +F
Sbjct: 183 ASTSIHLLLGVEFTMLLVDLVNLFLHTCLNLYEFHKSIEDRNLNIVGEDEDGLVDDEEEF 242

Query: 235 SGLEGKFIYERVIDISTRFLKTVLHALLLVPFRMPIMLIKDVLWDCLTLHQNAKGLWKIW 294
           + LEGKF+YE+ IDI TRFLKT+LH L+ +PFRM I+L+KDV+WD +TL+Q+   LWK W
Sbjct: 243 NELEGKFMYEKAIDIFTRFLKTLLHLLMFIPFRMKIVLLKDVIWDVITLYQSTVSLWKTW 302

Query: 295 RNNKQLDDKLPTMSEDQLRNIDN-MCIICMDELI---------------PEQDEGHTRNT 338
           RN+KQLD+KLPT+S ++L++ DN MCI+CMD LI                EQ      ++
Sbjct: 303 RNSKQLDEKLPTVSLEELKSSDNDMCIVCMDSLINIDFNSTEETENKEKEEQIYNAAIHS 362

Query: 339 KNKPKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFDEMGNVV-----QSTVPTTAEVTP 393
           K KPK+LPC H+LHL CLKNWMERSQTCPICRL+VFD  GN++     +S      E+T 
Sbjct: 363 KQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNGNILPFNNTRSDTMRNTELTA 422

Query: 394 TDEINVPETVVERSQE-------QIQ---------------------------------- 412
           T+  +  +   E   E       Q+Q                                  
Sbjct: 423 TNSNDAADESTENDTEMDALLSSQVQESVGDTLARDINFRSSIGDADVEGENNDNYDLDN 482

Query: 413 -------DNQQQM--GEGQVAVLD----SWYSFPVEETSENLVTFSMKN-SATNETVPAS 458
                  DN  Q+   E Q A  +     W SF ++  ++  ++F + +    ++T+   
Sbjct: 483 ELEIPNSDNPSQLLNSESQNAECEFNNVKWKSFLIKSVNKESISFELTDLKNPDQTILTK 542

Query: 459 LLIERTNASERYDDDDDQVETIIIPDE---VVDQAQTIENLKRRVSELESQVEHLNKRV 514
           L+I+     +    D   ++ ++I DE   +  + +TI++L  +++ELE +++ ++ ++
Sbjct: 543 LIIKEKPILK----DSKNIKQVVIKDEDIWMATEPKTIKSLNDKINELERKLKDISSKI 597

>Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON}
           (124427..126232) [1806 nt, 602 aa]
          Length = 601

 Score =  420 bits (1079), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 228/576 (39%), Positives = 339/576 (58%), Gaps = 83/576 (14%)

Query: 22  TIYSVYNATRTSISFLQTVLRLTEGFNIVIITVFFTLNSVLLWKLSTSLLFGSLRLIEYE 81
           T  S+Y A  +S S+LQ  ++L++GFN +++ +F  LN   +W+    L FG+LRLIEYE
Sbjct: 24  TFLSIYFAVLSSTSYLQVTIKLSQGFNAIVLVLFAILNGTYVWRFFIWLAFGNLRLIEYE 83

Query: 82  HIFERLPFTIINTMLMSSMFSEHDF-LTVAIYGLLLLFMKVFHWILRDRLEALLQTIQES 140
           H+ ERLPFTI+N ++  SMF++     T +I+G  L+FMKV HWILRDRL+A++Q+  +S
Sbjct: 84  HVMERLPFTILNMVITYSMFNDKSIAFTGSIFGFFLIFMKVLHWILRDRLDAIVQSFNDS 143

Query: 141 TTLSDLIFT-RFTFNLVLLAIADYQIISHCVSNSLDNSFGASASVHLMMGMEFAXXXXXX 199
           +TL+ +I +  F  NL++  I DY+++S+CVSNSL NS GAS +VHL++GMEF       
Sbjct: 144 STLTSIILSNNFFLNLIIFTIVDYKMVSYCVSNSLSNSMGASTTVHLLLGMEFTMLLIDL 203

Query: 200 XXXXXHAALCFYEFYQSQTHGRRNAVNDDEDDT------QFSGLEGKFIYERVIDISTRF 253
                H  L  YEF+ +      N + +D +D       QF+ LEGKF+YE+ ID+ TRF
Sbjct: 204 LNLFLHTCLNLYEFHLTTLERSSNIIQEDGEDDEEDDELQFNSLEGKFMYEKTIDVFTRF 263

Query: 254 LKTVLHALLLVPFRMP-IMLIKDVLWDCLTLHQNAKGLWKIWRNNKQLDDKLPTMSEDQL 312
           LKT +H L+L+P RM   +L+KDV+W+ ++L+++   LWK W+NNKQLDDKLPT S ++L
Sbjct: 264 LKTFIHILMLIPLRMKFFLLLKDVIWNVISLYKHTGSLWKTWKNNKQLDDKLPTASIEEL 323

Query: 313 RNID-NMCIICMDELIPEQDE------------GHTRNTKNKPKRLPCGHVLHLYCLKNW 359
           +N D N+CI+CMD+L+P  +              H   +K KPK+LPCGH+LHL CLKNW
Sbjct: 324 KNTDNNICIVCMDDLLPRINSEKYDSQREKELYDHIMKSKQKPKKLPCGHILHLNCLKNW 383

Query: 360 MERSQTCPICRLAVFDEMGNVVQST-----------------------VPTTAEVTP--- 393
           MERSQTCPICRL VFD+ GNV+ ST                        P T EV P   
Sbjct: 384 MERSQTCPICRLPVFDDKGNVMPSTHSQNQTETQQQQPQTQTQSTTELQPQT-EVQPDLN 442

Query: 394 -----TDEINVPETVVERSQEQIQD------------------------NQQQMGEGQVA 424
                  + NV   +    ++  QD                        + +Q G    +
Sbjct: 443 QRQETNIQHNVQNVIETPGRDSAQDASRGGTGSNSDHNLTNTQVSSEGSSNEQQGNVTNS 502

Query: 425 VLD--SWYSFPVEETSENLVTFSMKNSATNETV-PASLLIERTNASERYDDDDDQVETII 481
           +L+  SWYSFP++ +S++ +TF + ++     V PA L +E   +S   + D   ++ +I
Sbjct: 503 ILNTSSWYSFPIKTSSDSSITFDISDAHDPAKVYPAKLSVEEKVSSRTLNSDGGMLQVVI 562

Query: 482 IPDEV--VDQAQTIENLKRRVSELESQVEHLNKRVR 515
              ++  V  ++TI+ LK+R++ELE +V+ L   V+
Sbjct: 563 KDKDIKTVTDSKTIDLLKKRITELEEKVDSLAANVQ 598

>KLTH0C10604g Chr3 complement(878953..880500) [1548 bp, 515 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 515

 Score =  393 bits (1010), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 201/522 (38%), Positives = 312/522 (59%), Gaps = 23/522 (4%)

Query: 7   RKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTEGFNIVIITVFFTLNSVLLWKL 66
           ++RQF+ +++F Y    +SV +  + S+SFL   L+L EG N+V++  F  +NS+LLWK 
Sbjct: 6   QRRQFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCEGLNLVVLCNFAIVNSILLWKG 65

Query: 67  STSLLFGSLRLIEYEHIFERLPFTIINTMLMSSMFSEHDFLTVAIYGLLLLFMKVFHWIL 126
            T LLFG LRL+EYEHIFERL FTI+N   MSS F E+ FLTV I   LL F++VFHW+L
Sbjct: 66  LTRLLFGELRLLEYEHIFERLSFTIVNCFFMSSAFPEYQFLTVMILFALLTFIRVFHWVL 125

Query: 127 RDRLEALLQTIQESTTLSDLIFTRFTFNLVLLAIADYQIISHCVSNSLDNSF--GASASV 184
           +DRLE + Q   E T ++ L+ +RF  N+++ A+ DYQ++  C+ NSL N      SA V
Sbjct: 126 KDRLEYVFQHTDERTNIARLLCSRFFLNVIIFAVVDYQMVRFCLRNSLTNKHDPSPSAPV 185

Query: 185 HLMMGMEFAXXXXXXXXXXXHAALCFYEFYQSQTHGRRNAVNDDEDDTQFSGLEGKFIYE 244
           +++  ++F+            + +   E  Q      + A   D DD  F GL+GKF+YE
Sbjct: 186 YILFCVDFSMLLVDVAEVAMKSVINLIELIQC-----KRAFERDGDD--FVGLDGKFMYE 238

Query: 245 RVIDISTRFLKTVLHALLLVPFRMPIMLIKDVLWDCLTLHQNAKGLWKIWRNNKQLDDKL 304
           +++ +  + LK  L    L PF MP+M+ KD++WD + L    K +W+ W++N+Q+D+KL
Sbjct: 239 KLVQLVCQVLKLGLRVASLAPFSMPLMIAKDIIWDGIALFHTGKSVWRTWKSNRQIDEKL 298

Query: 305 PTMSEDQLR-NIDNMCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERS 363
           P ++E QL  + D MCI+CM++++P  +     + K+KPK+LPC H LHL CLK+WMERS
Sbjct: 299 PDVTEAQLNASEDKMCIVCMEDMLPPSE---ATSAKHKPKKLPCNHCLHLGCLKSWMERS 355

Query: 364 QTCPICRLAVFDEMGNVVQSTVPTTAEVTPTDEINVPETVVERSQEQIQDNQQQMGEGQV 423
           QTCPICR++VFD  GNV        A+   +++ +V +  +  + E    +      G +
Sbjct: 356 QTCPICRVSVFDSKGNVALPN-QNAAQQPISEDASVAQQPLSAANESNSTSLASTHTGSL 414

Query: 424 AVLDS-------WYSFPVE-ETSENLVTFSMKNSATNETVPASLLIERTNASERYDDDDD 475
             + S       WY+FPV    ++  V F +++    E + A L+I++    +   + D 
Sbjct: 415 GAVSSSNPNFPTWYTFPVTLSDNDGAVDFKVRDINGVE-INAKLIIKKRPGFDVPKEQDQ 473

Query: 476 QVETIIIPDEVVDQAQTIENLKRRVSELESQVEHLNKRVRKD 517
           + + ++I D    Q Q IE LKRR+SELE++V+ L K+ R +
Sbjct: 474 ESQRVVINDPPATQYQDIERLKRRISELENKVDELTKKARTE 515

>CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013c HRD1
          Length = 545

 Score =  390 bits (1001), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 209/425 (49%), Positives = 280/425 (65%), Gaps = 36/425 (8%)

Query: 3   ISETRKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTEGFNIVIITVFFTLNSVL 62
           ++   KR+F++F+   Y LTIY V +A ++S+SFLQ  L+L+EGFNI+IITVF  LNS L
Sbjct: 2   LTAIHKREFLIFTAITYVLTIYCVISACQSSVSFLQIALKLSEGFNILIITVFTLLNSTL 61

Query: 63  LWKLSTSLLFGSLRLIEYEHIFERLPFTIINTMLMSSMFSEHDFLTVAIYGLLLLFMKVF 122
           LW+  TS+LFG LR+IE+EHIFERLPF +INT+ M S F+E  F T+A   L+LL+MKVF
Sbjct: 62  LWQFLTSMLFGELRIIEHEHIFERLPFAVINTIFMFSTFNEKYFFTLATCALVLLYMKVF 121

Query: 123 HWILRDRLEALLQTIQESTTLSDLIFTRFTFNLVLLAIADYQIISHCVSNSLD------- 175
           HWILRDRL+ LLQ I E T   DL+  R+  NL+LL + D  +IS CVS + +       
Sbjct: 122 HWILRDRLDLLLQGINEDTRWKDLLVNRYICNLLLLVVIDSYVISFCVSTAYNIASSIFT 181

Query: 176 ---NSF---GAS-----ASVHLMMGMEFAXXXXXXXXXXXHAALCFYEFYQSQTHGRRN- 223
              NS    G S     A +++M  MEF            +  L FYEF+ S+   + N 
Sbjct: 182 AGTNSIVLGGGSPLTQRALIYIMQAMEFTNLMIDLVNLILNTGLQFYEFHLSRKFSQNNP 241

Query: 224 ---------AVNDDED-DTQFSGLEGKFIYERVIDISTRFLKTVLHALLLVPFRMPIMLI 273
                    A  + ED D+QF+GLEGKF+YE++ID+ TRFL+T++H ++ +   +P+ML+
Sbjct: 242 TFNSISAEDADTESEDGDSQFNGLEGKFMYEKLIDVVTRFLQTLVHVVMAMVLNLPLMLV 301

Query: 274 KDVLWDCLTLHQNAKGLWKIWRNNKQLDDKLPTMSEDQLR---NIDNMCIICMDELIPEQ 330
           KD+  D   L+ N+K L  IW+N+KQLD KLPTM+ D L    N DN+CI+CMDEL+ E 
Sbjct: 302 KDIFVDVWVLYMNSKSLLAIWKNSKQLDTKLPTMTSDDLNNDPNFDNVCIVCMDELVSEN 361

Query: 331 DEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFDEMGNVVQSTVPTTAE 390
              H  + K KPK+LPCGHVLHL CLKNWMERSQTCPICRL VFDE G ++    P++A 
Sbjct: 362 PHHHQSDGK-KPKKLPCGHVLHLSCLKNWMERSQTCPICRLPVFDENGEIL---APSSAN 417

Query: 391 VTPTD 395
           V+ T+
Sbjct: 418 VSQTN 422

>KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6.45
           YOL013C
          Length = 553

 Score =  389 bits (999), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 222/557 (39%), Positives = 326/557 (58%), Gaps = 82/557 (14%)

Query: 3   ISETRKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTEGFNIVIITVFFTLNSVL 62
           I ++RK+Q ++FS+ +Y LTI +++ + ++S +FLQ  ++LT+G N++I+ +F  LN  L
Sbjct: 2   IVQSRKQQLVIFSMIIYLLTIITIFTSYKSSKTFLQCTIKLTQGINVLILAIFTALNLFL 61

Query: 63  LWKLSTSLLFGSLRLIEYEHIFERLPFTIINTMLMSSMFSEHDFLTVAIYGLLLLFMKVF 122
           LW+    +LFG LRLIE+EHIFERLPFTIIN + M S+F+E+ F    ++ L+L  +KVF
Sbjct: 62  LWEFLRWILFGELRLIEHEHIFERLPFTIINVLFMISIFNEYQFFNALVFALILSVLKVF 121

Query: 123 HWILRDRLEALLQTIQESTTLSDLIFTRFTFNLVLLAIADYQIISHCV------------ 170
           HWIL+DRLE+LLQ+I ++T L +LIF+R+  NL + ++ D+ I S+              
Sbjct: 122 HWILKDRLESLLQSINDATDLKNLIFSRYMLNLAIFSVLDFWICSNTYRAFRGYDNNNST 181

Query: 171 -------SNSLDNSFGASA----SVHLMMGMEFAXXXXXXXXXXXHAALCFYEFYQSQTH 219
                  S++L N    +     ++ L+ GMEF            H  L FYEFY SQ  
Sbjct: 182 NNNQNADSSNLMNKNNLTPTNKKALFLLFGMEFFVLFLDLINLAMHTVLNFYEFYCSQRA 241

Query: 220 GRRNAVNDD------------EDDTQFSGLEGKFIYERVIDISTRFLKTVLHALLLVPFR 267
              + VN              +DD  F+GLEGKF+YE++ID+ST+F KT++H  +L+  +
Sbjct: 242 TAHHNVNAGTDEESEEEADGDDDDANFNGLEGKFMYEKLIDVSTKFFKTIVHIFVLIQTK 301

Query: 268 MPIMLIKDVLWDCLTLHQNAKGLWKIWRNNKQLDDKLPTMSEDQLRN-IDNMCIICMDEL 326
           + IM++KDV+WDCLTL+Q++  LWKI++NNKQLDDKLPT+S + + N  DN+CI+CMD+L
Sbjct: 302 LQIMVLKDVVWDCLTLYQDSISLWKIYKNNKQLDDKLPTLSVNDVENDNDNICIVCMDDL 361

Query: 327 IPE----------QDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFDE 376
           +P           Q +  + +   +PK+LPCGH+LHL CLKNWMERSQTCPICRL VFDE
Sbjct: 362 VPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPICRLPVFDE 421

Query: 377 MGNV-------------------VQSTVPTTAEV---TPTDEINVPETVVERSQEQIQDN 414
            GNV                   V ST  T +     TP  ++  P      +       
Sbjct: 422 NGNVKPFLHTTTNNNMQPNNDADVTSTTATNSRTDTSTPMTDVPTPTRTSASALTTSSII 481

Query: 415 QQQMGEGQVAVLDS--WYSFPVEETSE--NLVTFSMKN-SATNETVPASLLIERTNASER 469
            Q    G +  +DS  WY+F ++  S+  N V F+++N S+ N ++P  LLIER   +  
Sbjct: 482 TQDFKNG-ITPIDSVEWYAFEIDSISDARNEVKFNVRNASSNNRSIPMKLLIERMEETAE 540

Query: 470 YDDDDDQVETIIIPDEV 486
                     I+IPD  
Sbjct: 541 --------GQIVIPDSA 549

>Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013C
           (HRD1) - required to degrade misfolded ER lumenal and
           integral membrane proteins [contig 185] FULL
          Length = 513

 Score =  387 bits (995), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 210/529 (39%), Positives = 308/529 (58%), Gaps = 28/529 (5%)

Query: 1   MAISETRKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTEGFNIVIITVFFTLNS 60
           MA+   ++RQF  +    YA   +++    + S+SFL+   RL EG N++++  F  +N 
Sbjct: 1   MAV-RVQRRQFAAYVFASYAAAAWAIIGTVQESLSFLELSARLCEGLNLILLCNFAAVNG 59

Query: 61  VLLWKLSTSLLFGSLRLIEYEHIFERLPFTIINTMLMSSMFSEHDFLTVAIYGLLLLFMK 120
           VLLWK  T LLFG LRL+EYEHIFERL FTI+N   MSS FSE +F++V  +   L+F+K
Sbjct: 60  VLLWKALTHLLFGELRLLEYEHIFERLSFTIVNCFFMSSAFSESEFMSVMAFSAALIFVK 119

Query: 121 VFHWILRDRLEALLQTIQESTTLSDLIFTRFTFNLVLLAIADYQIISHCVSN----SLDN 176
           VFHW+LRDRLE + Q   E T  + L+ +RF FN+ LL   D+Q+   C+      S   
Sbjct: 120 VFHWVLRDRLEHVFQHTDEHTNFARLLLSRFFFNIFLLGFLDFQMTKFCIQGTRFFSRSG 179

Query: 177 SFGASASVHLMMGMEFAXXXXXXXXXXXHAALCFYEFYQSQTHGRRNAVNDDEDDTQFSG 236
            + +S SVHLM  +EFA            + +   E YQ     +R+   D ED   ++G
Sbjct: 180 FYSSSLSVHLMFAVEFAMLLVDVTEVAMKSIINLVEVYQC----KRSFARDGED---YTG 232

Query: 237 LEGKFIYERVIDISTRFLKTVLHALLLVPFRMPIMLIKDVLWDCLTLHQNAKGLWKIWRN 296
           LEGKF+YE+V+ +  +  +  LH +L++PF MP+M+ KD+LWD   +   AK L   W++
Sbjct: 233 LEGKFMYEKVVQLICQLTRMGLHIMLMMPFSMPLMIAKDILWDAFAVFHTAKSLLLTWKS 292

Query: 297 NKQLDDKLPTMSEDQLRNIDN-MCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYC 355
           N+Q+D+KLP +SE QL   D+ MCI+CMD+++   +     N K KPKRLPC H LHL C
Sbjct: 293 NRQIDEKLPDVSEAQLAASDDKMCIVCMDDMLAPSE---CTNAKQKPKRLPCNHCLHLGC 349

Query: 356 LKNWMERSQTCPICRLAVFDEMGNVVQSTVPTTAEVTPTDEINVPETVVERSQEQIQDNQ 415
           LK+WMERSQTCPICR+ VFD+ GNVV ++  T  +  P     V  T  E S        
Sbjct: 350 LKSWMERSQTCPICRVPVFDKKGNVVVTSDQTNNQ--PGTSSAVESTADETSTAAT--TS 405

Query: 416 QQMGEGQVAVLD------SWYSFP-VEETSENLVTFSMKNSATNETVPASLLIERTNASE 468
                  +AV D       WY+FP V+   E  +   + +++  E + A+L+ +  +  E
Sbjct: 406 VSSQSSSIAVTDVPSHQRGWYAFPTVQVHDEGSIDIKVTDTSGAE-IKATLVCKDRHEFE 464

Query: 469 RYDDDDDQVETIIIPDEVVDQAQTIENLKRRVSELESQVEHLNKRVRKD 517
             + D      +++ ++ V Q Q IE LKRR+SELE++V+ L+K+ R +
Sbjct: 465 AIETDAQGPRKVVVKNDCVYQNQDIERLKRRISELENKVDELSKKARTE 513

>NDAI0C02770 Chr3 (640635..642527) [1893 bp, 630 aa] {ON} Anc_6.45
           YOL013C
          Length = 630

 Score =  381 bits (978), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 210/546 (38%), Positives = 309/546 (56%), Gaps = 110/546 (20%)

Query: 1   MAISETRKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTEGFNIVIITVFFTLNS 60
           +++  ++K QF++FSI VY +T +++ NA  +S SFL   L+L EGFNI+IIT+F  LNS
Sbjct: 5   ISMLNSKKFQFVIFSISVYLITFFTIINAANSSTSFLHLCLKLNEGFNIMIITIFILLNS 64

Query: 61  VLLWKLSTSLLFGSLRLIEYEHIFERLPFTIINTMLMSSMFSEHDFLTVAIYGLLLLFMK 120
           +L WKL T  LF  LRLIE EHI ERLPFT+IN ++M++MF+E  F T+ IYGLLL+ ++
Sbjct: 65  LLSWKLITWFLFNDLRLIEQEHIMERLPFTVINFIVMATMFNERFFFTLTIYGLLLISLR 124

Query: 121 VFHWILRDRLEALLQTIQESTTLSDLIFTRFTFNLVLLAIADYQIISHC----------- 169
           V+HWIL+DRLE ++QTI +ST+++ +IF++F+FNL+ L++ + ++I +C           
Sbjct: 125 VYHWILKDRLEFIIQTINDSTSMTKIIFSKFSFNLISLSLINLKLIQNCLTWDDINFWKN 184

Query: 170 --------------------VSNSLDNSFGASASVHLMMGMEFAXXXXXXXXXXXHAALC 209
                               +SN ++N    S  V+LM+GMEF+           H+ L 
Sbjct: 185 NQNLFNSIMNYLINPISSTTISNGINN---HSNPVYLMLGMEFSILLLEYFNVLFHSLLS 241

Query: 210 FYEFYQSQTH-------------GRRNAVNDDEDDTQ-----------------FSGLEG 239
            +EFY+S+                R     +DE++                   F+GLEG
Sbjct: 242 LFEFYKSKQFSIQQQQIRQNNLINRAQTTQNDENEINIGLDIDIDDDEEDDDETFNGLEG 301

Query: 240 KFIYERVIDISTRFLKTVLHALLLVPFRMPIMLIKDVLWDCLTLHQNAKGLWKIWRNNKQ 299
           KFIYE++ID+ TRFL T++H  LL+P  +P++L+KD+LWD  +L++NA  L+KIW+NN++
Sbjct: 302 KFIYEKIIDLFTRFLMTIIHVSLLLPLNIPMILVKDILWDFFSLYRNAMSLYKIWKNNQK 361

Query: 300 LDDKLPTMSEDQLRNIDNMCIICMDELIP--EQDEGHTRNTKNKPKR------------- 344
           L+  LP M+ D L++ DN+CIICMD+L+P  E  E  T  +   P               
Sbjct: 362 LESALPNMTPDDLQHSDNVCIICMDDLLPSLETLEHATNVSSTTPSSNHYLNIKKKKKPK 421

Query: 345 -LPCGHVLHLYCLKNWMERSQTCPICRLAVFDEMGNVVQSTVPTTAEVTPTDEINVPETV 403
            LPCGH LH  CLKNWMERSQTCPICRL VFD+ GNV         +V P         V
Sbjct: 422 KLPCGHFLHFSCLKNWMERSQTCPICRLDVFDKNGNV---------KVYPNTN--TNTNV 470

Query: 404 VERSQEQIQDNQQQMGEGQVAVLDSWYSFPVEETSENLVTFSMKNSATNETVPASLLIER 463
            + S +Q  +N+                 P   ++ N++  S  N  TN  +P +  I+ 
Sbjct: 471 NDSSHDQTSENR-----------------PPSTSTSNIIPGSNTNITTNTPIPRN--IDA 511

Query: 464 TNASER 469
           +N S  
Sbjct: 512 SNGSHE 517

>NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {ON}
           Anc_6.45 YOL013C
          Length = 510

 Score =  372 bits (955), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 213/525 (40%), Positives = 311/525 (59%), Gaps = 65/525 (12%)

Query: 5   ETRKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTEGFNIVIITVFFTLNSVLLW 64
           +TR+ Q I F+  +Y LTI  + N+   S SFL   L+L +GFN++IIT+F  LN++LLW
Sbjct: 3   QTRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMIITIFILLNALLLW 62

Query: 65  KLSTSLLFGSLRLIEYEHIFERLPFTIINTMLMSSMFSEHDFLTVAIYGLLLLFMKVFHW 124
           K    LLF  LRLIE EHI ERLPFTIIN + +S+MF+E  F+T+A YG +LL+MK+F+W
Sbjct: 63  KFLNFLLFKELRLIEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIFYW 122

Query: 125 ILRDRLEALLQTIQESTTLSDLIFTRFTFNLVLLAIADYQIISHCVS------------- 171
           IL+DRLE L+Q+   + ++S  IF++F  NL++L+  + Q+I  C+              
Sbjct: 123 ILKDRLEFLIQS-NTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLNS 181

Query: 172 ----NSLDNSFGASAS-----------VHLMMGMEFAXXXXXXXXXXXHAALCFYEFYQS 216
                SL N    S++           ++LM+ MEFA           H+ L  YE Y+S
Sbjct: 182 TSILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAILLINFINLFLHSILSLYEIYKS 241

Query: 217 QTHGRRNA---------VNDDEDDTQFSGLEGKFIYERVIDISTRFLKTVLHALLLVPFR 267
             + + NA          +DD+    F+GLE KFIYE++ID+ TR L T++H  L +P  
Sbjct: 242 NQYDQLNAIIEDIEDENDDDDDTPADFNGLENKFIYEKIIDLFTRSLMTMIHISLALPLN 301

Query: 268 MPIMLIKDVLWDCLTLHQNAKGLWKIWRNNKQLDDKLPTMSEDQLRNIDNMCIICMDELI 327
           +P++++KD++WD ++L+QN K L++I +NNK LD KLP M  + L++ DN+CI+CMD+L+
Sbjct: 302 LPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQDSDNVCIVCMDDLL 361

Query: 328 PEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFDEMGNVVQSTVPT 387
            E+ +      K K KRLPCGH LHL CLKNWMERSQTCPICRL VFDE GNV +S  P 
Sbjct: 362 SEEHK------KKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESGNVKESERPA 415

Query: 388 TAEVTPTDEINVPETVVERSQEQIQDNQ--QQMGEGQVAVLD--SWYSFPVEETSEN--L 441
           TA     D           S      +   Q+  E + A +D  +WYSFP+   +++  +
Sbjct: 416 TAADADVDVDVAAAQPPSTSSSPSIPHSPIQETLEPEEASIDNNTWYSFPITHINKDKSV 475

Query: 442 VTFSMKNSA-TNETVPASLLIERTNASERYDDDDDQVETIIIPDE 485
           ++F +++   ++ETV    LI  T           + E +IIPD+
Sbjct: 476 ISFELRDDKESSETVQ---LIRET-----------KTENVIIPDD 506

>KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {ON}
           Anc_6.45 YOL013C
          Length = 556

 Score =  329 bits (843), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 182/433 (42%), Positives = 253/433 (58%), Gaps = 51/433 (11%)

Query: 6   TRKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTEGFNIVIITVFFTLNSVLLWK 65
           +RK+QF +  + +Y LT ++V NA   S +FL+    LT+G N VII  F  LN VLLWK
Sbjct: 8   SRKQQFALLVVVIYLLTAFTVINAFGNSHTFLEWTTGLTQGVNYVIIAAFSLLNIVLLWK 67

Query: 66  LSTSLLFGSLRLIEYEHIFERLPFTIINTMLMSSMFSEHDFLTVAIYGLLLLFMKVFHWI 125
             T ++FG LRLIE EHIFER+P T+IN +++SS+ S+     + + G LLL +KV HWI
Sbjct: 68  GFTYMVFGDLRLIEEEHIFERIPLTVINLIMISSLLSDKYMFDIVLLGGLLLVLKVSHWI 127

Query: 126 LRDRLEALLQTIQESTTLSDLIFTRFTFNLVLLAIADYQIISHCVSNSLDNSF--GASAS 183
           LRDRLE  LQ I ++TTL+ L+F++F+ NL++  I DY +   C  N   N +  G  ++
Sbjct: 128 LRDRLEGFLQRINDTTTLTSLLFSKFSRNLLIFGILDYFVTKICFFNHFGNFYHHGDFSN 187

Query: 184 V-HLMMGMEFAXXXXXXXXXXXHAALCFYEFYQSQTHGRR-------NAVNDDEDDTQF- 234
           +  +M G+E+A           H  L FY F+++Q    R       +  ++DE+D+   
Sbjct: 188 ITQIMFGLEYAVVFIDLINILCHTVLNFYAFHRTQLQSARFNLEMMNDDFSEDENDSGVN 247

Query: 235 --SGLEGKFIYERVIDISTRFLKTVLHALLLVPFRMPIMLIKDVLWDCLTLHQNAKGLWK 292
              GLEGKFIYE++ID     L+T LH  +L+P R   ML+KD +WD   L  N   LWK
Sbjct: 248 ADGGLEGKFIYEKLIDFVAGVLRTGLHFTMLIPLRFQSMLVKDFVWDLFNLVNNGNSLWK 307

Query: 293 IWRNNKQLDDKLPTMSEDQLRNIDNMCIICMDELI----PEQ----------DEGHTRNT 338
           I++NN+QL+ KLP ++ + L + DNMCI+CMD+L+    P +          DE +T   
Sbjct: 308 IYKNNRQLNKKLPNIAIEDLLDHDNMCIVCMDDLVLVHHPTKRRQSVQEECDDEKNTEKD 367

Query: 339 K------------------------NKPKRLPCGHVLHLYCLKNWMERSQTCPICRLAVF 374
           K                         KPK+LPCGH+LH  CLKNWMERSQTCPICR+ VF
Sbjct: 368 KPSTTEEDLSEVEPTQGDIDRMADSKKPKKLPCGHMLHFSCLKNWMERSQTCPICRVPVF 427

Query: 375 DEMGNVVQSTVPT 387
           D+ GNV  S   T
Sbjct: 428 DKDGNVRPSIAKT 440

>KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {ON}
           weakly similar to uniprot|Q08109 Saccharomyces
           cerevisiae YOL013C HRD1 Ubiquitin-protein ligase
           required for endoplasmic reticulum-associated
           degradation (ERAD) of misfolded proteins genetically
           linked to the unfolded protein response (UPR) regulated
           through association with Hrd3p contains an H2 ring
           finger
          Length = 553

 Score =  256 bits (653), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 171/549 (31%), Positives = 285/549 (51%), Gaps = 59/549 (10%)

Query: 9   RQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTEGFNIVIITVFFTLNSVLLWKLST 68
           ++FI +S+  Y    +S++    TS S+L  + ++TEG + +I    F LNSVL+ K   
Sbjct: 24  QKFIAYSLMSYTAAAWSLHYCVTTSFSYLHAMTKITEGIHAMIWGNLFLLNSVLILKGVI 83

Query: 69  SLLFGSLRLIEYEHIFERLPFTIINTMLMSSMFSEHDFLTV-AIYGLLLLFMKVFHWILR 127
            +LFG LRLIEYEHI ER+ +T+I  +L  S  S +  ++V  I+ +L +  +  HWIL+
Sbjct: 84  HMLFGQLRLIEYEHILERISYTVITLLLSCS--SMNGLISVMQIHCVLFVCCRTLHWILK 141

Query: 128 DRLEALLQTIQESTTLSDLIFTRFTFNLVLLAIADYQIISHCVSNSLDNSFGASASVHLM 187
           DR+E   Q      TL D++ +RF FNL++L   D  I+++ V+  L  S     +  L 
Sbjct: 142 DRMEVTFQANDMRLTLKDILLSRFMFNLLVLTAVDGIIVAYYVNKILYKS-NIDVTYTLF 200

Query: 188 MGMEFAXXXXXXXXXXXHAALCFYEF--YQSQTHGRRNA--------VNDDEDDTQF--- 234
           +  ++A              L  +E    Q++   RRNA        +N +E        
Sbjct: 201 IISQYAILGTDLLQVILRTGLNLFELSTIQNRARIRRNADHHVDEPVINHEERPNAVAIE 260

Query: 235 ---------SGLEGKFIYERVIDISTRFLKTVLHALLLVPFRMPIMLIKDVLWDCLTLHQ 285
                    +GLEGKFIYE++ID+    +K ++       F    +++  VLW+ +T  +
Sbjct: 261 EDEDEDEENAGLEGKFIYEKLIDVFISTVKVIIK--FASSFSTGRVMMVTVLWEAITTFK 318

Query: 286 NAKGLWKIWRNNKQLDDKLPTMSEDQLRNID-NMCIICMDELIPEQDEGHTRNTKNKP-K 343
           +A+GLWK W+++K LD  L   ++ Q+ + + ++CI+CM++ +P     H R +  K  K
Sbjct: 319 SARGLWKNWKSSKSLDASLMDATDIQIESGEIDICIVCMEDFLP----SHQRKSDGKKVK 374

Query: 344 RLPCGHVLHLYCLKNWMERSQTCPICRLAVFDEMGNVV------QSTVPTTA--EVTPTD 395
            LPC H LHL CLKNW+ RS TCPICRL +FDE GNV+      QST P T   E++P  
Sbjct: 375 ILPCTHALHLSCLKNWIARSPTCPICRLPIFDENGNVMPYQDHSQSTDPNTTAQEISPGI 434

Query: 396 EINVPE----TVVERSQEQI---QDNQQQMGEGQVAVLDSWYSFPVEETSENLVTFSMKN 448
            +          +E + + I    DN        +   ++    P++   E+   F +  
Sbjct: 435 AVETNSQTNINTLETTNQNITLSPDNSTAQNLAFLPTRNTSLIIPIQREDEHKHKFKILT 494

Query: 449 SATNETVPASLLIERTNASERYDDDDDQVETIIIPDEVVDQAQTIENLKRRVSELESQVE 508
            +  E +  SL++       R + D  +   ++  D ++DQ  +   LKR++++LES++E
Sbjct: 495 ESGKE-IEGSLIL-------RNNIDTTKGSVVLPQDLLIDQDAS--QLKRKIADLESKLE 544

Query: 509 HLNKRVRKD 517
            L+K+V+++
Sbjct: 545 ELSKKVKRE 553

>ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL013C
           (HRD1)
          Length = 575

 Score =  227 bits (579), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 173/586 (29%), Positives = 281/586 (47%), Gaps = 90/586 (15%)

Query: 7   RKRQFIVFSIFV---YALTIYSVYNATRTSISFLQTVLRLTEGFNIVIITVFFTLNSVLL 63
           R+  + ++++F+   YAL  +S Y+   +    L  +   + G + VI   F  ++  L 
Sbjct: 3   REVSWPMWAMFITATYALAGWSAYSCATSFDDPLSALFMASSGVHFVIWGNFLIVHYCLF 62

Query: 64  WKLSTSLLFGSLRLIEYEHIFERLPF------TIINTMLMSSMFSEHDFLTVAIYGLLLL 117
                 +LFG L  IEY+HIFERL        +I+ TM  + M      +T+  Y L L 
Sbjct: 63  VWAIIRVLFGQLTAIEYDHIFERLHVVLVTLASIVITMRKTYMAGH---MTILFYTLCL- 118

Query: 118 FMKVFHWILRDRLEALLQTIQESTTLSDLIFTRFTFNLVLLAIADYQIISHCVSNSLDNS 177
              V HW+LRDR++ + Q     ++L  ++ +RF F+L++L + DY+++  CV N+  N 
Sbjct: 119 ---VAHWVLRDRMDFVFQVHGTDSSLLGILCSRFMFSLLVLGMVDYKMLKFCVQNT--NV 173

Query: 178 FGASASVHLMMGMEFAXXXXXXXXXXXHAALCFYEFYQSQTHGRRNAVNDDEDDTQFSG- 236
            G    ++LM+ + FA             +L  +E  +S+     N V +       +  
Sbjct: 174 DGKRHELYLMLALSFAQLILDVLHVVLLTSLNLFEMVRSRRTRSANLVYEGGTTDDDADD 233

Query: 237 ----LEGKFIYERVIDISTRFLKTVLHALLLVPFRMPIMLIKDVLWDCLTLHQNAKGLWK 292
               LEGK+IYE V D++   LK +L  +  V     I ++  +    +   ++   ++ 
Sbjct: 234 EVFILEGKYIYETVFDLTITVLKVILDIIQEVFVPWSITVVYSIFVRSIKAGESFLLVYN 293

Query: 293 IWRNNKQLDDKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLH 352
            W+NNK+L +KL  +SE+QL + D+MCIICMD+++P  +   T     + K LPCGH+LH
Sbjct: 294 YWKNNKKLYEKLSDVSEEQLDDTDSMCIICMDDMLPTTE---TTKMNRRAKMLPCGHMLH 350

Query: 353 LYCLKNWMERSQTCPICRLAVFDEMGNVVQSTVPTTAEVTPTD---EINVPE-------- 401
             CLK+WMERSQTCPICRL+VF    N   +T     E TP D   E  + E        
Sbjct: 351 FGCLKSWMERSQTCPICRLSVFANDSNSHATT--QAREQTPPDLLQERGIDEHIDVIGMQ 408

Query: 402 ------------TVVERSQEQIQDNQQQMGEGQVAVLD----SWYSFPVEETSENLVTFS 445
                       T V R       NQ   G G ++  +     W +FP+E  ++N V F+
Sbjct: 409 DMSVQSISLHEGTAVRRGTTGNCMNQAYDG-GLLSHEERDQAGWVAFPIEFRADNKVFFN 467

Query: 446 MKNS-------ATNETVPASLLI---ERTNASERY------------DDDDDQVET---- 479
           + +S       A+  + P   ++   +  NASE +            +    QV+     
Sbjct: 468 LNDSQGDRQWMASYTSYPRQNMVNSDDPDNASESHSRIPSPSLPGSLEGTSSQVDVTVSA 527

Query: 480 --------IIIPDEVVDQAQTIENLKRRVSELESQVEHLNKRVRKD 517
                    +I    ++Q + +E+LKR+V ELES+VE L+KR++ D
Sbjct: 528 KDAPANACFVIATSKLEQTKEVEHLKRKVEELESRVEELSKRIKTD 573

>Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to
           Ashbya gossypii ACL019C
          Length = 670

 Score =  199 bits (506), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 132/419 (31%), Positives = 215/419 (51%), Gaps = 42/419 (10%)

Query: 3   ISETRKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTEGFNIVIITVFFTLNSVL 62
           +S + + QFI  +   YAL  +S+YN T TS+SFLQ + + T G +++I   F  ++  +
Sbjct: 5   VSWSIRLQFIAVT---YALAAWSLYNCTSTSLSFLQAMYKATYGVHLIIWGNFLLVHYFI 61

Query: 63  LWKLSTSLLFGSLRLIEYEHIFERLPFTIINTM-LMSSMFSEHDFLTVAIYGLLLLFMKV 121
              L   +LFG L L+EYEHIFERL  T+++++ ++ +M  ++  + V      +L  +V
Sbjct: 62  GGWLVVRMLFGRLTLLEYEHIFERLHLTVLSSLSVLITMDRKNSKIGVIAIPFHVL-CQV 120

Query: 122 FHWILRDRLEALLQ-TIQESTTLSDLIFTRFTFNLVLLAIADYQII-----SHCVSNSL- 174
            HW++RDR+E +    I     + DL+F+RF  ++V+L + D++++      H       
Sbjct: 121 LHWVVRDRMEFVFAPPIGTRMAMKDLLFSRFMLSIVVLGVVDFKLMMYFYRQHQAEQGYL 180

Query: 175 ------DNSFGASAS-VHLMMGMEFAXXXXXXXXXXXHAALCFYEFYQSQTHGRR----- 222
                 DN    S   + L +G++F               L F E +++   GRR     
Sbjct: 181 YYLLFSDNGQNTSEDRLSLSLGVDFGLLFLDWLQVVLLNCLKFVELFKA---GRRVQEHQ 237

Query: 223 -----NAVNDDEDDTQFSGLEGKFIYERVIDISTRFLKTVLHALLLVPFRMPIMLIKDVL 277
                   ND EDD  F  LE KFIYE++++     LK +L+  L+       ++  ++ 
Sbjct: 238 LLDNNELENDIEDDGAFI-LEEKFIYEKIVETVLEILKILLNIFLITSGIHSFVVFYNIF 296

Query: 278 WDCLTLHQNAKGLWKIWRNNKQLDDKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRN 337
              +   +    L+  W+NN++L +KL  ++   L  +D  C ICMD+++P +D    + 
Sbjct: 297 IKSIETCERCVLLFNYWKNNRRLHEKLLDVTAGHLDGVDITCTICMDDMLPSKD---VKV 353

Query: 338 TKNKPKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFD----EMGNVVQST--VPTTAE 390
              K K LPCGH+LH  CLK+WM+R+QTCPICR  VF       G    S   VPT +E
Sbjct: 354 NNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVFGSSNPRAGQNANSNGIVPTQSE 412

 Score = 38.5 bits (88), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 26/37 (70%)

Query: 481 IIPDEVVDQAQTIENLKRRVSELESQVEHLNKRVRKD 517
           +IP   ++Q + +E LKRR+SELE+ V  L KR++ D
Sbjct: 634 VIPTSRLEQTEELERLKRRISELENTVGDLLKRIKTD 670

>Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON}
           YDR143C (REAL)
          Length = 624

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 37/85 (43%), Gaps = 16/85 (18%)

Query: 329 EQDEGHTRNT-------KNKPKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFDEMGNVV 381
           E ++ HT N        K+ P RLPCGHV    CL  W     +CP+CR  + +  G  V
Sbjct: 250 ESNQPHTANDEETNPSYKHSPIRLPCGHVFGRECLYKWSRLENSCPLCRHKISESAGVPV 309

Query: 382 QSTVPTTAEVTPTDEINVPETVVER 406
           Q           TDE+   E   ER
Sbjct: 310 QQD---------TDEVAANEAAFER 325

>TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 319 CIICMDEL---IPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICR 370
           C ICM E+   + +  E H  + +      PCGHV H  CL+NWM     CP+CR
Sbjct: 703 CAICMSEVPVYVEDVPETHKVDLQTY-MTTPCGHVFHTQCLENWMSYKLQCPVCR 756

>Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar to
           Ashbya gossypii AFR275W
          Length = 758

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 319 CIICMDEL---IPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICR 370
           C ICM E+   + +  E H  N  N+    PC HV H  CL+NWM     CP+CR
Sbjct: 699 CAICMSEVAIYVEDIPETHKTN-PNEYMVTPCAHVFHTECLENWMSYKLQCPVCR 752

>KLTH0G12408g Chr7 (1055265..1057076) [1812 bp, 603 aa] {ON} weakly
           similar to uniprot|P22470 Saccharomyces cerevisiae
           YDR143C SAN1 Ubiquitin-protein ligase controls turnover
           of a specific class of unstable nuclear proteins
           including Sir4p but not Sir2p or Sir3p san1 mutations
           suppress sir4 spt16 and cdc68 mutations suggesting a
           role in chromatin silencing
          Length = 603

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 5/56 (8%)

Query: 328 PEQDEGHTRNT-----KNKPKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFDEMG 378
           P+++E  T N      K+ P +LPCGH+    C++ W     TCPICR  +    G
Sbjct: 207 PKENEADTNNQESIAYKHSPLKLPCGHIFGRECIRQWTNEHNTCPICRARIVGADG 262

>TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.545
           YKL034W
          Length = 750

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 319 CIICMDEL-IPEQDEGHTRNT-KNKPKRLPCGHVLHLYCLKNWMERSQTCPICR 370
           C ICM E+ +  QD   T N  K+     PC H+ H  CL+NWM     CP+CR
Sbjct: 691 CTICMSEVPVYIQDIEETHNIDKDTYMITPCNHIFHTTCLENWMSYKLQCPVCR 744

>NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 319 CIICMDEL---IPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICR 370
           C ICM E+   I E +E H  + ++     PC H+ H  CL+NWM     CP+CR
Sbjct: 702 CAICMSEVPVYIEEAEETHNID-QHSYMVTPCDHIFHTDCLENWMGYKLQCPVCR 755

>NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2.545
           YKL034W
          Length = 762

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 34/66 (51%), Gaps = 6/66 (9%)

Query: 308 SEDQLRNIDNMCIICMDELIP---EQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQ 364
           S+D+   +D  C ICM   +P   E+ EG  +   +     PC H+ H  CL+NWM    
Sbjct: 694 SKDEPYTVD--CAICMSP-VPVYIEEVEGTHKVDIHSYMVTPCNHIFHTECLENWMGYKL 750

Query: 365 TCPICR 370
            CP+CR
Sbjct: 751 QCPVCR 756

>AFR275W Chr6 (928482..930743) [2262 bp, 753 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKL034W (TUL1)
          Length = 753

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 31/61 (50%), Gaps = 7/61 (11%)

Query: 316 DNMCI---ICMDEL---IPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPIC 369
           DN C+   ICM EL   + +  E H  N  +     PC H+ H  CL+NWM     CP+C
Sbjct: 688 DNYCVSCAICMSELAIHVEDIPETHKANIHDY-MVTPCSHLFHTGCLENWMSYKLQCPVC 746

Query: 370 R 370
           R
Sbjct: 747 R 747

>KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 319 CIICMDEL---IPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICR 370
           C ICM E+   + E  E H +  ++     PC H+ H  CL+NWM     CP+CR
Sbjct: 702 CSICMSEIPVYVEELPETH-KVDQHSYMVTPCNHIFHTSCLENWMSYKLQCPVCR 755

>AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR062C
          Length = 159

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 24/70 (34%), Positives = 32/70 (45%), Gaps = 10/70 (14%)

Query: 302 DKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRLP-CGHVLHLYCLKNWM 360
           D LP + + +L   DN  I C          G+  +       LP CGH   L C+  W+
Sbjct: 74  DTLPRVPKKRLAEGDNCAICCC---------GYLEDEYPLVVELPNCGHTFDLQCVSVWL 124

Query: 361 ERSQTCPICR 370
            RS TCP+CR
Sbjct: 125 SRSTTCPMCR 134

>TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {ON}
           Anc_2.545 YKL034W
          Length = 757

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 319 CIICMDEL---IPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICR 370
           C ICM E+   + +  E H  + ++     PC H+ H  CL+NWM     CP+CR
Sbjct: 698 CAICMSEVPVYVKDIPETHAVDQQSY-MVTPCNHIFHTACLENWMGYKLQCPVCR 751

>ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 765

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 4/55 (7%)

Query: 319 CIICMDEL---IPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICR 370
           C ICM E+   + E  E H  + +      PC H+ H  CL+NWM     CP+CR
Sbjct: 706 CAICMSEVPIRVEEVPETHKVDEQTY-MVTPCAHIFHTQCLENWMSYKLQCPVCR 759

>Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON}
           YDR143C (REAL)
          Length = 612

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 7/68 (10%)

Query: 339 KNKPKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFDEMGNVVQSTVPTTAEVTPTDEIN 398
           K+ P +LPCGH+    C+  W +   +CP+CR  + +  G  +Q+T         TDE+ 
Sbjct: 248 KHSPIKLPCGHIFGRECIYKWSKLENSCPLCRHKISESAG--IQNTA-----QQDTDEVA 300

Query: 399 VPETVVER 406
             E   ER
Sbjct: 301 ANEAAFER 308

>Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034W
           (REAL)
          Length = 759

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 319 CIICMDEL---IPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICR 370
           C ICM ++   I E  E H +  ++     PC HV H  CL+NWM     CP+CR
Sbjct: 700 CAICMSDVPIYIEEVPETH-KVDQHSYMVTPCNHVFHTPCLENWMSYKLQCPVCR 753

>Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 319 CIICMDEL---IPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICR 370
           C ICM ++   I E  E H +  ++     PC HV H  CL+NWM     CP+CR
Sbjct: 699 CAICMSDVPIYIEEIPETH-KVDQHSYMVTPCNHVFHTSCLENWMSYKLQCPVCR 752

>YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}
           TUL1Golgi-localized RING-finger ubiquitin ligase (E3),
           involved in ubiquitinating and sorting membrane proteins
           that contain polar transmembrane domains to
           multivesicular bodies for delivery to the vacuole for
           quality control purposes
          Length = 758

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 319 CIICMDEL---IPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICR 370
           C ICM ++   I E  E H +  ++     PC HV H  CL+NWM     CP+CR
Sbjct: 699 CAICMSDVPIYIEEIPETH-KVDQHSYMVTPCNHVFHTSCLENWMNYKLQCPVCR 752

>Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON}
           (19006..21270) [2265 nt, 755 aa]
          Length = 754

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 319 CIICMDELIPEQDEGHTRNTKNKPKRL--PCGHVLHLYCLKNWMERSQTCPICR 370
           C ICM E+    D+  T +  +    +  PC HV H  CL+NWM     CP+CR
Sbjct: 695 CAICMSEVPVYVDDVPTTHKVDLDSFMITPCNHVFHTQCLENWMGYKLQCPVCR 748

>Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 319 CIICMDEL---IPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICR 370
           C ICM ++   I E  E H +  ++     PC HV H  CL+NWM     CP+CR
Sbjct: 699 CTICMSDVPIYIEEIPETH-KVDQHSYMVTPCDHVFHTSCLENWMSYKLQCPVCR 752

>SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 751

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 319 CIICMDEL---IPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICR 370
           C ICM ++   + + +E H  +  N     PCGH+ H  CL++WM     CP+CR
Sbjct: 692 CAICMTDVPIYVSDIEETHKVDI-NSYMVTPCGHIFHTQCLESWMSYKLQCPVCR 745

>SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]
           {ON} weakly similar to uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 544

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%)

Query: 326 LIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFDEMG 378
           L  E  + HT   K+ P  L CGHV    C+  W + + +CPICR  +    G
Sbjct: 210 LSKEPKKEHTPTYKHSPTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREG 262

>Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {ON}
           YKL034W (TUL1) -  [contig 55] FULL
          Length = 750

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 319 CIICMDELIPEQDEGHTRNTKNKPKRL--PCGHVLHLYCLKNWMERSQTCPICR 370
           C ICM E+    D+    +  +K   +  PC H+ H  CL++WM     CP+CR
Sbjct: 691 CAICMSEVAVYVDDIPETHKVDKDDYMITPCSHIFHTQCLESWMSYKLQCPVCR 744

>Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON}
           YDR143C (REAL)
          Length = 634

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 32/68 (47%), Gaps = 7/68 (10%)

Query: 339 KNKPKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFDEMGNVVQSTVPTTAEVTPTDEIN 398
           K+ P +LPCGH+    C+  W     +CP+CR  + +  G      V   AE   TDE+ 
Sbjct: 259 KHSPIKLPCGHIFGRECIYKWSRLENSCPLCRHKISENAG------VQRAAEQD-TDEVA 311

Query: 399 VPETVVER 406
             E   ER
Sbjct: 312 ANEAAFER 319

>YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}
           SAN1Ubiquitin-protein ligase; involved in the
           proteasome-dependent degradation of aberrant nuclear
           proteins; targets substrates with regions of exposed
           hydrophobicity containing 5 or more contiguous
           hydrophobic residues; contains intrinsically disordered
           regions that contribute to substrate recognition
          Length = 610

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 33/68 (48%), Gaps = 7/68 (10%)

Query: 339 KNKPKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFDEMGNVVQSTVPTTAEVTPTDEIN 398
           K+ P +LPCGH+    C+  W     +CP+CR  + + +G  VQ      A    TDE+ 
Sbjct: 249 KHSPIKLPCGHIFGRECIYKWSRLENSCPLCRQKISESVG--VQR-----AAQQDTDEVA 301

Query: 399 VPETVVER 406
             E   ER
Sbjct: 302 ANEAAFER 309

>TBLA0A09640 Chr1 complement(2375252..2376180,2376263..2376311) [978
           bp, 325 aa] {ON} Anc_5.628 YDR265W
          Length = 325

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 37/79 (46%), Gaps = 22/79 (27%)

Query: 296 NNKQLDDK----LPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVL 351
           NN+++D K    LP + E+  +     CI+CM  +I              P   PCGH+ 
Sbjct: 253 NNEKIDLKNPKILPYIPEESRK-----CILCMSFMI-------------NPSCAPCGHIY 294

Query: 352 HLYCLKNWMERSQTCPICR 370
              CL NW +  + CP+CR
Sbjct: 295 CWNCLINWCKEKEECPLCR 313

>KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 747

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 319 CIICMDELIPEQDEGHTRNTKNKPKRL--PCGHVLHLYCLKNWMERSQTCPICR 370
           C ICM+++    D+    +  +K   +  PC H+ H  CL++WM     CP+CR
Sbjct: 688 CAICMNDVPVYVDDIPKTHKVDKESYMITPCSHIFHTQCLESWMSYKLQCPVCR 741

>KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034W TUL1
           Transmembrane Ubiquitin Ligase
          Length = 757

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 4/56 (7%)

Query: 318 MCIICMDEL---IPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICR 370
           +C ICM ++   + E +E H  + ++     PC H+ H  CL+NWM     CP+CR
Sbjct: 697 VCPICMVDVPVYVEETEETHKIDAQSY-MITPCSHIFHTECLENWMSYKLQCPVCR 751

>Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 bp,
           657 aa] {ON} similar to Ashbya gossypii AGL191W 1-intron
          Length = 657

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%)

Query: 339 KNKPKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFDEMG 378
           K+ P  LPCGH+    C+  W +   +CPICR  + ++ G
Sbjct: 273 KHCPTELPCGHIFGRDCIFKWTKEHNSCPICRSRIVEDEG 312

>KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 704

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 17/32 (53%)

Query: 345 LPCGHVLHLYCLKNWMERSQTCPICRLAVFDE 376
           LPCGHV    CL  W     +CPICR  +  E
Sbjct: 217 LPCGHVFGRECLYKWTTEHNSCPICRAPILSE 248

>CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034w
          Length = 757

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 4/55 (7%)

Query: 319 CIICMDEL---IPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICR 370
           C ICM E    + E  E H  + K+     PC H+ H  CL++WM     CP+CR
Sbjct: 698 CAICMAEFPVYVEELPETHQVD-KDSYMITPCDHMFHTSCLESWMSYKLQCPVCR 751

>NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317
          Length = 570

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 18/71 (25%)

Query: 342 PKRLPCGHVLHLYCLKNWMERSQTCPICRLAV------------------FDEMGNVVQS 383
           P +LPCGH+    CL  W +   TCP+CR  +                  F+ + N+V +
Sbjct: 230 PTKLPCGHIFGRECLYRWCKLENTCPLCRHVIAEVDTTQHQAQDAASDQAFERIRNLVYN 289

Query: 384 TVPTTAEVTPT 394
           T PT+ +  PT
Sbjct: 290 TNPTSNDDQPT 300

>NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [522
           bp, 173 aa] {ON} Anc_3.279 YBR062C
          Length = 173

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 13/81 (16%)

Query: 297 NKQLDDKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKP--KRLP-CGHVLHL 353
           +K+  D LP +  + +++ +  C IC  + + ++           P    LP CGH   L
Sbjct: 82  SKEFIDSLPRIKANSIKDKNAECAICFCKFLEDK----------YPLVAELPHCGHRFDL 131

Query: 354 YCLKNWMERSQTCPICRLAVF 374
            C+  W+ +S TCP+CR +V 
Sbjct: 132 ECISVWLSKSDTCPLCRDSVL 152

>KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 4/55 (7%)

Query: 319 CIICMDEL---IPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICR 370
           C ICM  +   + ++ E H  +  +     PC H+ H  CL+NWM     CP+CR
Sbjct: 703 CSICMSGIPLYVDDKPETHKVDQYSY-MVTPCNHIFHTECLENWMSYKLQCPVCR 756

>Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {ON}
           YDR143C (SAN1) - (putative) transcriptional regulator
           [contig 171] FULL
          Length = 589

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 21/40 (52%)

Query: 339 KNKPKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFDEMG 378
           K+ P +LPC HV    C++ W     TCPICR  +    G
Sbjct: 219 KHSPVQLPCSHVFGRECIRQWTNLHNTCPICRANIVGADG 258

>KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459
           bp, 152 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 152

 Score = 41.6 bits (96), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 10/85 (11%)

Query: 302 DKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRLP-CGHVLHLYCLKNWM 360
           D LP +++  L+  D   I C          G+  +T     +LP C H   L C+  W+
Sbjct: 67  DSLPRVNKCDLKGADACSICCC---------GYLDDTHPLVVKLPHCSHRFDLECVAVWL 117

Query: 361 ERSQTCPICRLAVFDEMGNVVQSTV 385
            +S+TCP+CR  V      V  S V
Sbjct: 118 SKSRTCPLCRDDVLSHKPKVDISNV 142

>Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {ON}
           YBR062C - Hypothetical ORF [contig 35] FULL
          Length = 104

 Score = 40.4 bits (93), Expect = 0.001,   Method: Composition-based stats.
 Identities = 25/85 (29%), Positives = 41/85 (48%), Gaps = 10/85 (11%)

Query: 302 DKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRLP-CGHVLHLYCLKNWM 360
           D LP + + +L++ +   I C +     +D+ +    +     LP C H   L C+  W+
Sbjct: 19  DSLPRVEKGKLKDAEACSICCCNY----RDDKYPLVVE-----LPHCNHRFDLECVAVWL 69

Query: 361 ERSQTCPICRLAVFDEMGNVVQSTV 385
            +S+TCP+CR  V     NV  S V
Sbjct: 70  SKSRTCPLCRDDVLSHKPNVDVSQV 94

>KNAG0G02390 Chr7 complement(548272..550338) [2067 bp, 688 aa] {ON}
           Anc_8.317 YDR143C
          Length = 688

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 342 PKRLPCGHVLHLYCLKNWMERSQTCPICRLAV 373
           P +LPCGH+    C+  W     +CP+CR A+
Sbjct: 335 PTKLPCGHIFGRDCIFKWSHLENSCPLCRKAI 366

>KAFR0B03070 Chr2 complement(638210..640141) [1932 bp, 643 aa] {ON}
           Anc_8.317 YDR143C
          Length = 643

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%)

Query: 342 PKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFDEMGN 379
           P +LPCGH+    CL  W +   TCP+CR  + +   N
Sbjct: 299 PLKLPCGHIFGRECLFKWSKVENTCPLCRHVIIENNQN 336

>ZYRO0C11176g Chr3 (866350..866539,866607..867523) [1107 bp, 368 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import,
           interacts with Pex12p, links ubiquitin-conjugating Pex4p
           to protein import machinery; mutations in human homolog
           cause a variety of peroxisomal disorders
          Length = 368

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 13/52 (25%)

Query: 319 CIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICR 370
           CI+C++E+               P   PCGH+    C+ NW +  + CP+CR
Sbjct: 318 CILCLNEM-------------TDPSCPPCGHLFCWACIMNWCKEREECPLCR 356

>CAGL0M08690g Chr13 complement(865182..866168) [987 bp, 328 aa] {ON}
           similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265w peroxisomal assembly protein - peroxin
          Length = 328

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 13/52 (25%)

Query: 319 CIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICR 370
           CI+C+ E+               P  LPCGHV    C+ +W + +  CP+CR
Sbjct: 277 CILCLMEM-------------TDPSCLPCGHVFCWDCITDWTKENPECPLCR 315

>Kpol_526.34 s526 (83624..84610) [987 bp, 328 aa] {ON}
           (83624..84610) [987 nt, 329 aa]
          Length = 328

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 24/52 (46%), Gaps = 13/52 (25%)

Query: 319 CIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICR 370
           CI+C++ ++              P   PCGH+    C+ NW +    CP+CR
Sbjct: 278 CILCLNSMV-------------DPSAAPCGHIFCWDCIINWCKERPECPLCR 316

>TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON} 
          Length = 260

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 37/94 (39%), Gaps = 23/94 (24%)

Query: 303 KLPTMSEDQLRNIDNMCIICMDEL-------IPEQDEGHTRNTKNKPKR---------LP 346
           +L   + ++L N D  C IC++ L       I  QD    +     P +         +P
Sbjct: 125 ELEKRNPNELANDDETCCICLELLKTQEYDTITTQDGMRVKTKGGPPTKSIKDTDIVMIP 184

Query: 347 CGHVLHLYCLKNWM-------ERSQTCPICRLAV 373
           C H  H  CLK W         R   CP+CR+ +
Sbjct: 185 CQHYFHAGCLKEWFSPQRRGKRRPLVCPLCRMDI 218

>CAGL0E01441g Chr5 (135312..137465) [2154 bp, 717 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143c SAN1 mating-type regulation protein
          Length = 717

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 18/32 (56%)

Query: 342 PKRLPCGHVLHLYCLKNWMERSQTCPICRLAV 373
           P ++PCGH+    CL  W     +CP+CR  +
Sbjct: 290 PVKIPCGHIFGRSCLYEWTRLENSCPLCRKKI 321

>TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.279
           YBR062C
          Length = 144

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 22/43 (51%), Gaps = 1/43 (2%)

Query: 344 RLP-CGHVLHLYCLKNWMERSQTCPICRLAVFDEMGNVVQSTV 385
           RLP CGH   L CL  W  +S +CP+CR  V      V  S V
Sbjct: 92  RLPHCGHDFDLECLSVWFSKSTSCPLCRDDVLSHRAEVDTSQV 134

>Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa]
           {ON} complement(182540..184546) [2007 nt, 669 aa]
          Length = 668

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 35/88 (39%), Gaps = 5/88 (5%)

Query: 288 KGLWKIWRNNKQLDDKLPTMSEDQLRNIDN-----MCIICMDELIPEQDEGHTRNTKNKP 342
           +G   + R     +++ P  +E + R  +N              +P Q+E +       P
Sbjct: 200 EGSGNVKRAKVSSENEGPQPNEGETRQTENGPNQGTTSTQNSNTLPNQEESNEPVYLESP 259

Query: 343 KRLPCGHVLHLYCLKNWMERSQTCPICR 370
             LPC H+    CL  W     TCP+CR
Sbjct: 260 VELPCHHIFGRECLYKWTRHENTCPLCR 287

>KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa] {ON}
           Anc_3.405 YPR093C
          Length = 102

 Score = 38.5 bits (88), Expect = 0.004,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 24/58 (41%), Gaps = 15/58 (25%)

Query: 319 CIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWME------RSQTCPICR 370
           C ICM+E+ P +  G           LPC H  H  C++ W        R   CP CR
Sbjct: 10  CPICMEEIGPHEPLGEL---------LPCHHKFHSDCIRKWHTTTTGEIRRPLCPFCR 58

>SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, 599
           aa] {ON} some similarities with uniprot|P22470
           Saccharomyces cerevisiae YDR143C SAN1 Ubiquitin-protein
           ligase controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 599

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 20/40 (50%)

Query: 339 KNKPKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFDEMG 378
           K+ P +L CGH     C+  W +   +CPICR  +    G
Sbjct: 239 KHSPTQLKCGHRFGRMCIYQWTKEHNSCPICRAEIVGREG 278

>SAKL0G07370g Chr7 (604332..604383,604452..605365) [966 bp, 321 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import
          Length = 321

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 13/52 (25%)

Query: 319 CIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICR 370
           CI+C+ E+               P   PCGH+    C+ NW +    CP+CR
Sbjct: 271 CILCLTEM-------------KDPSCAPCGHIFCWNCIINWCKERSECPLCR 309

>YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, 180
           aa] {ON} Protein of unknown function that interacts with
           Msb2p; may play a role in activation of the filamentous
           growth pathway.
          Length = 180

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 43/88 (48%), Gaps = 17/88 (19%)

Query: 304 LPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKP--KRLP-CGHVLHLYCLKNWM 360
           LP +++ +L+  DN C IC    + ++           P    LP C H   L CL  W+
Sbjct: 95  LPRINKKKLKATDN-CSICYTNYLEDE----------YPLVVELPHCHHKFDLECLSVWL 143

Query: 361 ERSQTCPICRLAVFDEMGNVVQSTVPTT 388
            RS TCP+CR  V   MG+ + + + TT
Sbjct: 144 SRSTTCPLCRDNV---MGHRIINEIDTT 168

>CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa]
           {ON} similar to uniprot|P38748 Saccharomyces cerevisiae
           YHL010c
          Length = 586

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 2/30 (6%)

Query: 345 LPCGHVLHLYCLKNWMERSQTCPICRLAVF 374
           +PC H  H  CL  W  ++  CP+CRL+ F
Sbjct: 264 IPCQHTFHCQCLDKW--KNSKCPVCRLSSF 291

>NDAI0H00840 Chr8 complement(189570..190595) [1026 bp, 341 aa] {ON}
           Anc_5.628 YDR265W
          Length = 341

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 25/52 (48%), Gaps = 13/52 (25%)

Query: 319 CIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICR 370
           CI+C+++++              P   PCGH+    CL +W +    CP+CR
Sbjct: 290 CILCLNDMV-------------DPSCSPCGHIFCWRCLMDWCQERAECPLCR 328

>ZYRO0D05830g Chr4 (495428..497770) [2343 bp, 780 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 780

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 7/50 (14%)

Query: 342 PKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFD-------EMGNVVQST 384
           P +LPC H+    CL  W +   +CP+CR  + +       E GN   +T
Sbjct: 298 PVQLPCAHIFGRECLDKWSQIENSCPLCRRKIVEVQPEQRPEPGNPAGTT 347

>Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 bp,
           150 aa] {ON} YBR062C (REAL)
          Length = 150

 Score = 38.1 bits (87), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 26/45 (57%), Gaps = 4/45 (8%)

Query: 345 LP-CGHVLHLYCLKNWMERSQTCPICRLAVFDEMGNVVQSTVPTT 388
           LP C H   L CL  W+ RS TCP+CR  V   MG+ V + + TT
Sbjct: 97  LPHCHHKFDLECLSVWLSRSTTCPLCRDDV---MGHRVINEIDTT 138

>NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON} 
          Length = 274

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 42/90 (46%), Gaps = 16/90 (17%)

Query: 302 DKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRLP-CGHVLHLYCLKNWM 360
           ++LP  +  +L N  + C IC    I   D+  T  T      LP C H  H  C+K W+
Sbjct: 193 EQLPRTNCAELSNSSDECPICR---IAYSDDFETEITC-----LPNCSHHFHFECIKLWL 244

Query: 361 ERSQTCPICRLAVFDEMGNVVQSTVPTTAE 390
           +++  CP+CR        NV++    TT E
Sbjct: 245 QKNSLCPLCR-------DNVMECKAETTEE 267

>Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}
           YBR062C (REAL)
          Length = 185

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 43/88 (48%), Gaps = 17/88 (19%)

Query: 304 LPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKP--KRLP-CGHVLHLYCLKNWM 360
           LP +++ +L+  DN C IC    + ++           P    LP C H   L CL  W+
Sbjct: 100 LPRINKRKLKVTDN-CSICYTNYLEDE----------YPLVVELPHCHHKFDLECLSVWL 148

Query: 361 ERSQTCPICRLAVFDEMGNVVQSTVPTT 388
            RS TCP+CR  V   MG+ + + + TT
Sbjct: 149 SRSTTCPLCRDDV---MGHRIINEIDTT 173

>Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON}
           (60008..60319) [312 nt, 104 aa]
          Length = 103

 Score = 37.0 bits (84), Expect = 0.015,   Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 1/28 (3%)

Query: 344 RLP-CGHVLHLYCLKNWMERSQTCPICR 370
           +LP CGH     CL  W+ +++TCP+CR
Sbjct: 51  KLPHCGHNFDYECLSIWLSKNKTCPMCR 78

>TPHA0C00850 Chr3 (177213..179558) [2346 bp, 781 aa] {ON} Anc_8.317
           YDR143C
          Length = 781

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 15/29 (51%)

Query: 342 PKRLPCGHVLHLYCLKNWMERSQTCPICR 370
           P  LPC H+    CL  W     TCP+CR
Sbjct: 276 PTELPCKHIFGRECLYKWTRVQNTCPLCR 304

>KLLA0E16677g Chr5 complement(1481372..1482289) [918 bp, 305 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import interacts
           with Pex12p links ubiquitin-conjugating Pex4p to protein
           import machinery mutations in human homolog cause a
           variety of peroxisomal disorders
          Length = 305

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 29/67 (43%), Gaps = 18/67 (26%)

Query: 304 LPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERS 363
           LP + ED  +     C++C++ ++              P   PCGH+    C+  W    
Sbjct: 245 LPFIKEDSRK-----CVLCLNYML-------------DPSATPCGHLFCWDCIMEWTLER 286

Query: 364 QTCPICR 370
           Q CP+CR
Sbjct: 287 QECPLCR 293

>KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {ON}
           Anc_3.279 YBR062C
          Length = 162

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 42/93 (45%), Gaps = 17/93 (18%)

Query: 302 DKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKP--KRLP-CGHVLHLYCLKN 358
           D LP +  +++  + + C IC +               N P   +LP CGH+  L C+  
Sbjct: 76  DSLPRVPRNKVP-LTDTCSICFERF----------GNDNYPLLAQLPHCGHIFDLQCISM 124

Query: 359 WMERSQTCPICRLAVFDEMGNVVQSTVPTTAEV 391
           W+    TCP+CR  V    G+ VQ    + AE+
Sbjct: 125 WLSNQVTCPMCRDVV---NGHKVQDLDTSKAEL 154

>KLTH0E02464g Chr5 (216256..216301,216358..217301) [990 bp, 329 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import interacts
           with Pex12p links ubiquitin-conjugating Pex4p to protein
           import machinery mutations in human homolog cause a
           variety of peroxisomal disorders
          Length = 329

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 13/52 (25%)

Query: 319 CIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICR 370
           CI+C+  ++              P   PCGH+    CL NW +    CP+CR
Sbjct: 279 CILCLSLMV-------------DPSCAPCGHLFCWDCLLNWSKERPECPLCR 317

>NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317
          Length = 661

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 19/34 (55%)

Query: 342 PKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFD 375
           P +LPC H+    CL  W +   +CP+CR  + +
Sbjct: 241 PVKLPCDHIFGRECLYKWSKLENSCPLCRHKIIE 274

>KAFR0H00560 Chr8 complement(99045..100028) [984 bp, 327 aa] {ON}
           Anc_5.628 YDR265W
          Length = 327

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 29/70 (41%), Gaps = 17/70 (24%)

Query: 301 DDKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWM 360
           DD L T  +   R     CI+C+ +++              P   PCGH+    C+ NW 
Sbjct: 263 DDTLFTFIQGASRT----CILCLSKIV-------------DPSCAPCGHLYCWDCILNWC 305

Query: 361 ERSQTCPICR 370
                CP+CR
Sbjct: 306 NEKPECPLCR 315

>TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 bp,
           184 aa] {ON} Anc_3.279 YBR062C
          Length = 184

 Score = 37.7 bits (86), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 41/87 (47%), Gaps = 13/87 (14%)

Query: 302 DKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPK--RLP-CGHVLHLYCLKN 358
           D L  +++  ++N D +C IC  +   +          + P    LP C H   L C+  
Sbjct: 98  DSLERINKKSIKNKDEICSICRCKFFDD----------DYPLIIELPNCKHYFDLECITL 147

Query: 359 WMERSQTCPICRLAVFDEMGNVVQSTV 385
           W++++ +CPICR  V ++   +  S V
Sbjct: 148 WLQKNSSCPICRNDVLEKKFKIDDSQV 174

>CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483)
           [528 bp, 175 aa] {ON} similar to uniprot|P38239
           Saccharomyces cerevisiae YBR062c
          Length = 175

 Score = 37.7 bits (86), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 14/75 (18%)

Query: 302 DKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKP--KRLP-CGHVLHLYCLKN 358
           D LP + + +L++ D+ C IC    I ++           P    LP CGH     C+  
Sbjct: 88  DSLPRIPQKKLKS-DDTCPICCSNFIADE----------YPLVVELPHCGHKFDFECVSM 136

Query: 359 WMERSQTCPICRLAV 373
           W+ ++ TCP+CR  V
Sbjct: 137 WLTKNTTCPMCRDDV 151

>TBLA0A03900 Chr1 complement(974843..976939) [2097 bp, 698 aa] {ON}
           Anc_8.317 YDR143C
          Length = 698

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 3/56 (5%)

Query: 323 MDELIPEQ---DEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFD 375
           MD  IP     DE       N P +L C H+    CL  W +   +CP+CR  + +
Sbjct: 310 MDSTIPTSSTPDENKKHEYHNSPVQLSCKHIFCRSCLYEWSKLKNSCPLCRKKIVE 365

>Kwal_55.19999 s55 (206149..206607) [459 bp, 152 aa] {ON} YDR265W
           (PEX10) - C3HC4 zinc-binding integral peroxisomal
           membrane protein [contig 157] PARTIAL
          Length = 152

 Score = 37.0 bits (84), Expect = 0.032,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 22/52 (42%), Gaps = 13/52 (25%)

Query: 319 CIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICR 370
           CI+C+  ++              P   PCGHV    CL +W      CP+CR
Sbjct: 102 CILCLGFML-------------DPSCAPCGHVFCWKCLLSWCNERPECPLCR 140

>Ecym_1328 Chr1 complement(681157..682070,682146..682194) [963 bp,
           320 aa] {ON} similar to Ashbya gossypii AER390W
           1-intron
          Length = 320

 Score = 38.5 bits (88), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 24/52 (46%), Gaps = 13/52 (25%)

Query: 319 CIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICR 370
           CI+C+ +++              P  LPCGH+    C+ +W      CP+CR
Sbjct: 270 CILCLVDMV-------------DPSCLPCGHLFCWNCIMHWCTERSECPLCR 308

>Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 bp,
           178 aa] {ON} YBR062C (REAL)
          Length = 178

 Score = 37.4 bits (85), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 34/74 (45%), Gaps = 14/74 (18%)

Query: 304 LPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKP--KRLP-CGHVLHLYCLKNWM 360
           LP ++  +L + DN C IC    + ++           P    LP C H   L CL  W+
Sbjct: 93  LPRINRKKLNSTDN-CSICYTNYLEDE----------YPLVVELPHCNHRFDLECLSVWL 141

Query: 361 ERSQTCPICRLAVF 374
            RS TCP+CR  V 
Sbjct: 142 SRSTTCPLCRDDVM 155

>NDAI0D02810 Chr4 complement(650919..651677) [759 bp, 252 aa] {ON} 
          Length = 252

 Score = 37.7 bits (86), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 43/98 (43%), Gaps = 36/98 (36%)

Query: 301 DDKLPTMSEDQLRNIDNMCIICMD--ELIP------EQDEGHTRNTKNKPKR---LPCGH 349
           DD++P         I+  CIIC++  +++P      +Q  G  + T   P +   LPC H
Sbjct: 140 DDRIP---------INECCIICLERVKVVPSTNDLEKQQNGTEQTTDMIPSKVVKLPCEH 190

Query: 350 VLHLYCLKNWME------RSQT----------CPICRL 371
             H  C+K+W        +S T          CP+CRL
Sbjct: 191 YFHKCCIKDWFSTIRKGMKSSTHSFAIGPTYFCPLCRL 228

>TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.542
           YHL010C
          Length = 674

 Score = 38.5 bits (88), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 2/30 (6%)

Query: 345 LPCGHVLHLYCLKNWMERSQTCPICRLAVF 374
           +PC H  H  CL  W  ++  CPICR +  
Sbjct: 300 IPCQHTFHCQCLNKW--KNSKCPICRFSTL 327

>Suva_2.433 Chr2 (765490..766503) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 30/69 (43%), Gaps = 18/69 (26%)

Query: 302 DKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWME 361
           D+LP + E   +     CI+C+ ++               P   PCGH+    CL +W +
Sbjct: 274 DQLPYIPEASRK-----CILCLMDM-------------TDPSCTPCGHLFCWDCLMSWCK 315

Query: 362 RSQTCPICR 370
               CP+CR
Sbjct: 316 ERPECPLCR 324

>KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.542
           YHL010C
          Length = 560

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 2/30 (6%)

Query: 345 LPCGHVLHLYCLKNWMERSQTCPICRLAVF 374
           +PC H  H  CL  W  ++  CP+CR + F
Sbjct: 258 IPCQHTFHCQCLDKW--KNSQCPVCRYSSF 285

>TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {ON}
           Anc_8.317 YDR143C
          Length = 554

 Score = 38.5 bits (88), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 20/37 (54%)

Query: 339 KNKPKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFD 375
           K+ P  LPC HV    CL  W +   +CP+CR  + +
Sbjct: 210 KHSPVVLPCNHVFGRECLFKWSQLENSCPLCRHKIVE 246

>AER390W Chr5 (1370316..1370364,1370423..1371324) [951 bp, 316 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR265W (PEX10); 1-intron
          Length = 316

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 22/52 (42%), Gaps = 13/52 (25%)

Query: 319 CIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICR 370
           CI+C+ ++               P  LPCGH+    C+  W      CP+CR
Sbjct: 266 CILCLADM-------------TDPSCLPCGHMFCWACVMQWCNERNECPLCR 304

>KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa]
           {ON} Anc_2.542 YHL010C
          Length = 507

 Score = 38.1 bits (87), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 6/49 (12%)

Query: 345 LPCGHVLHLYCLKNWMERSQTCPICRLAVFDEMGNVVQSTVPTTAEVTP 393
           +PC H  H  CL  W  ++  CP+CR + F     + + T+  T+  TP
Sbjct: 188 IPCQHTFHCQCLNRW--KNSKCPVCRYSSF----RLSRDTLMRTSRGTP 230

>NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON}
           Anc_2.542
          Length = 572

 Score = 38.1 bits (87), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 41/97 (42%), Gaps = 27/97 (27%)

Query: 276 VLWDCLTLHQNAKGLWKIWRNNKQLDDKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHT 335
           +L D  T+ QN +   K+ +N  +L    PT            C +C+++L  E     T
Sbjct: 211 LLTDPFTIEQNEQNKMKVKKNPVEL----PT------------CPVCLEQLDCETTGLIT 254

Query: 336 RNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICRLA 372
                    +PC H  H  CL  W  ++  CP+CR +
Sbjct: 255 ---------IPCQHTFHCQCLDKW--KNSRCPVCRYS 280

>KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]
           {ON} similar to uniprot|P38748 YHL010C Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 517

 Score = 38.1 bits (87), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 35/80 (43%), Gaps = 14/80 (17%)

Query: 318 MCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFDEM 377
           MC +C+++L  E     T          PC H  H  CL  W  ++  CP+CR   + ++
Sbjct: 214 MCPVCLEKLDSEVTGLVT---------TPCQHTFHCKCLDQW--KNGNCPVCR---YSQL 259

Query: 378 GNVVQSTVPTTAEVTPTDEI 397
            +V    +P   E   T+ +
Sbjct: 260 KDVNNEPLPRCLECGETNNL 279

>TDEL0A04940 Chr1 (872976..873072,873142..874025) [981 bp, 326 aa]
           {ON} Anc_5.628 YDR265W
          Length = 326

 Score = 37.7 bits (86), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 22/52 (42%), Gaps = 13/52 (25%)

Query: 319 CIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICR 370
           CI+C+             N    P   PCGH+    C+ +W +    CP+CR
Sbjct: 276 CILCL-------------NAMTDPSCAPCGHIFCWDCILSWCKERPECPLCR 314

>NCAS0A11350 Chr1 complement(2249991..2251277) [1287 bp, 428 aa]
           {ON} Anc_3.405 YPR093C
          Length = 428

 Score = 37.7 bits (86), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 10/58 (17%)

Query: 316 DNMCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQT--CPICRL 371
           DN+C IC D+L        T   + K K  PC H  H  C++ W   S    CP+CR 
Sbjct: 9   DNICPICFDDL------NDTDILQGKLK--PCNHKYHYDCIRRWHGYSDNSDCPLCRC 58

>TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.279
           YBR062C
          Length = 175

 Score = 36.6 bits (83), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 1/28 (3%)

Query: 344 RLP-CGHVLHLYCLKNWMERSQTCPICR 370
           +LP CGH     C+  W+ +++TCPICR
Sbjct: 123 QLPHCGHHFDFECISIWLSKNETCPICR 150

>Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON}
           complement(21450..23126) [1677 nt, 559 aa]
          Length = 558

 Score = 37.7 bits (86), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 15/72 (20%)

Query: 301 DDKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWM 360
           D K P+  + +L      C +C++ L    D+G T         +PC H  H  CL  W 
Sbjct: 221 DSKNPSQDQVELP----TCPVCLERL----DDGTTGLIT-----IPCQHTFHCQCLDKW- 266

Query: 361 ERSQTCPICRLA 372
            ++  CP+CR +
Sbjct: 267 -KNSKCPVCRYS 277

>NCAS0C05290 Chr3 (1076165..1077157) [993 bp, 330 aa] {ON} Anc_5.628
           YDR265W
          Length = 330

 Score = 37.4 bits (85), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 32/77 (41%), Gaps = 20/77 (25%)

Query: 296 NNKQLDDK--LPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHL 353
           N+  L DK   P + ED  +     CI+C+  +               P   PCGH+   
Sbjct: 260 NHLNLSDKEIFPFIPEDARK-----CILCLAYM-------------TDPSCSPCGHIFCW 301

Query: 354 YCLKNWMERSQTCPICR 370
            C+ +W +    CP+CR
Sbjct: 302 ECILDWCKERPECPLCR 318

>Kwal_26.8030 s26 (616729..618711) [1983 bp, 660 aa] {ON} [contig
           55] FULL
          Length = 660

 Score = 37.7 bits (86), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 19/30 (63%)

Query: 346 PCGHVLHLYCLKNWMERSQTCPICRLAVFD 375
           PCGH +H +C   + + S  CP C+++V +
Sbjct: 405 PCGHAIHQHCFDEYTKHSYKCPSCQVSVLN 434

>Skud_4.528 Chr4 (941613..942626) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 37.4 bits (85), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 30/69 (43%), Gaps = 18/69 (26%)

Query: 302 DKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWME 361
           ++LP + E   +     CI+C+ ++               P   PCGH+    CL +W +
Sbjct: 274 NQLPYIPESSRK-----CILCLMDM-------------TDPSCTPCGHLFCWNCLMSWCK 315

Query: 362 RSQTCPICR 370
               CP+CR
Sbjct: 316 ERPECPLCR 324

>KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28
           YOL133W
          Length = 114

 Score = 35.0 bits (79), Expect = 0.082,   Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 8/60 (13%)

Query: 315 IDNMCIIC----MDELIPEQDEGHTRNTKNK--PKRLPCGHVLHLYCLKNWMERSQTCPI 368
           +DN C IC    M+  I  Q +  T +T N+       CGH  HL+C+  W++    CP+
Sbjct: 45  VDN-CAICRNHIMEPCIECQPKAMT-DTDNECVAAWGACGHAFHLHCINKWIKTRDACPL 102

>ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR093C
          Length = 328

 Score = 37.0 bits (84), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%), Gaps = 3/29 (10%)

Query: 345 LPCGHVLHLYCLKNWME---RSQTCPICR 370
           +PCGH  HL C++ W      +++CP+CR
Sbjct: 33  MPCGHEYHLACIRKWFHLHSGNRSCPVCR 61

>Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {ON}
           [contig 295] FULL
          Length = 275

 Score = 37.0 bits (84), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 11/53 (20%)

Query: 319 CIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMER-SQTCPICR 370
           C IC ++           N  N    L C HV H YC+  W+ R S  CP+C+
Sbjct: 120 CAICQEDF----------NKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCK 162

>NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_1.389
          Length = 1586

 Score = 37.7 bits (86), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 28/135 (20%), Positives = 51/135 (37%), Gaps = 20/135 (14%)

Query: 304  LPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERS 363
            L T+ +   +N +  C IC+D +              K   L CGH     C+ +W++  
Sbjct: 1252 LNTIKDSIGQNKEFQCTICLDAIT-------------KGCMLKCGHFFCEDCIYDWLQTR 1298

Query: 364  QTCPICR-LAVFDEMGNVVQSTVPTTAEVTPTDEINVPETVVERSQEQ----IQDNQQQM 418
              CPIC+  A  D   N      P   +     ++N  E   ++ Q +    ++      
Sbjct: 1299 TICPICKHKASLDGNYNFTFKNGPLKTDANK--QMNEKENETKKEQPETSPDLKSTNNTF 1356

Query: 419  GEGQVAVLDSWYSFP 433
             E +  + + +  FP
Sbjct: 1357 KEKKTVLGEKYQEFP 1371

>KLTH0D06886g Chr4 (600181..602175) [1995 bp, 664 aa] {ON} conserved
           hypothetical protein
          Length = 664

 Score = 37.4 bits (85), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 19/30 (63%)

Query: 346 PCGHVLHLYCLKNWMERSQTCPICRLAVFD 375
           PCGH +H +C   + + S  CP C++++ +
Sbjct: 404 PCGHAIHQHCFDEYTKHSYKCPSCQVSILN 433

>TDEL0C05420 Chr3 complement(972821..973102) [282 bp, 93 aa] {ON}
           Anc_3.405 YPR093C
          Length = 93

 Score = 34.7 bits (78), Expect = 0.095,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 24/56 (42%), Gaps = 13/56 (23%)

Query: 318 MCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERS--QTCPICRL 371
           MC IC++E   E  E H           PC H  H  C++ W   +    CP CR+
Sbjct: 8   MCAICLEEGHEEFGELH-----------PCRHKFHKECIRRWHTGAIDLKCPTCRI 52

>KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, 157
           aa] {ON} Anc_3.279 YBR062C
          Length = 157

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 36/75 (48%), Gaps = 15/75 (20%)

Query: 302 DKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPK--RLP-CGHVLHLYCLKN 358
           D LP + +D++ N  ++C IC +     +DE         P    LP C H   L C+  
Sbjct: 72  DSLPRVPKDKIPN--DLCSICFENF--REDE--------YPLVIELPHCSHKFDLQCISV 119

Query: 359 WMERSQTCPICRLAV 373
           W+  + TCP+CR  V
Sbjct: 120 WLSSNSTCPVCRDKV 134

>SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468
           bp, 155 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 155

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%)

Query: 347 CGHVLHLYCLKNWMERSQTCPICRLAVFDEMGNVVQSTV 385
           C H   L CL  W+ ++ TCP+CR  V +++ ++  S V
Sbjct: 107 CSHRFDLECLTPWLLKNSTCPLCRDDVMEKVDSIDVSNV 145

>Smik_4.516 Chr4 (931711..932724) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 30/73 (41%), Gaps = 20/73 (27%)

Query: 300 LDDK--LPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLK 357
           L DK  LP + E   +     CI+C+  +               P   PCGH+    CL 
Sbjct: 270 LSDKKQLPYIPESSRK-----CILCLTNM-------------TDPSCAPCGHLFCWDCLM 311

Query: 358 NWMERSQTCPICR 370
           +W +    CP+CR
Sbjct: 312 SWCKERPECPLCR 324

>SAKL0A09526g Chr1 (834338..836326) [1989 bp, 662 aa] {ON} conserved
           hypothetical protein
          Length = 662

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 18/30 (60%)

Query: 346 PCGHVLHLYCLKNWMERSQTCPICRLAVFD 375
           PCGH +H +C   + + S  CP C++ V +
Sbjct: 399 PCGHAIHQHCFDEYTKHSYKCPHCQVTVLN 428

>YDR265W Chr4 (998864..999877) [1014 bp, 337 aa] {ON}
           PEX10Peroxisomal membrane E3 ubiquitin ligase, required
           for for Ubc4p-dependent Pex5p ubiquitination and
           peroxisomal matrix protein import; contains zinc-binding
           RING domain; mutations in human homolog cause various
           peroxisomal disorders
          Length = 337

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 342 PKRLPCGHVLHLYCLKNWMERSQTCPICR 370
           P   PCGH+    CL +W +    CP+CR
Sbjct: 296 PSCAPCGHLFCWSCLMSWCKERPECPLCR 324

>TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.542
           YHL010C
          Length = 556

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 345 LPCGHVLHLYCLKNWMERSQTCPICR 370
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 258 IPCSHTFHCQCLDKW--KNSKCPVCR 281

>CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar to
           uniprot|Q12157 Saccharomyces cerevisiae YDL008w APC11
           subunit of the anaphase promoting complex
          Length = 149

 Score = 35.4 bits (80), Expect = 0.13,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 39/97 (40%), Gaps = 36/97 (37%)

Query: 290 LWKIWRNNKQLDDKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPK---RLP 346
           +W I +N  +LD+ +    ED       +C IC             R + + P    R P
Sbjct: 15  VWDIPKNEDRLDESMADEDED-------VCGIC-------------RASYHAPCPNCRYP 54

Query: 347 ----------CGHVLHLYCLKNWMERSQT---CPICR 370
                     CGH  H++C+  W++   +   CP+CR
Sbjct: 55  GESCAIVLGRCGHNFHVHCISRWVDTPTSKGLCPMCR 91

>KLLA0E18503g Chr5 complement(1645113..1647065) [1953 bp, 650 aa]
           {ON} conserved hypothetical protein
          Length = 650

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 19/30 (63%)

Query: 346 PCGHVLHLYCLKNWMERSQTCPICRLAVFD 375
           PCGH +H +C   +++ S  CP C ++V +
Sbjct: 390 PCGHAIHQHCFDEYIKHSYKCPNCNVSVIN 419

>ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519
           bp, 172 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 172

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 35/87 (40%), Gaps = 14/87 (16%)

Query: 302 DKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKP--KRLP-CGHVLHLYCLKN 358
           D LP +   +++  D+  I C            T    + P    LP C H   L C+  
Sbjct: 87  DSLPRIPASKIKEDDSCPICCC-----------TYKEDDHPLVAELPHCNHKFDLECISV 135

Query: 359 WMERSQTCPICRLAVFDEMGNVVQSTV 385
           W+ +S +CP+CR  V      +  S V
Sbjct: 136 WLSKSTSCPLCRDDVMSHKPGIDTSQV 162

>Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar to
           Ashbya gossypii AGR034W
          Length = 159

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 1/43 (2%)

Query: 344 RLP-CGHVLHLYCLKNWMERSQTCPICRLAVFDEMGNVVQSTV 385
           +LP C H   L C+  W+ +S TCP+CR  V      +  S V
Sbjct: 107 KLPNCNHKFDLQCITLWLSKSSTCPMCRNDVMSSKTKIDTSMV 149

>Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON}
            YOL138C (REAL)
          Length = 1336

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 34/79 (43%), Gaps = 23/79 (29%)

Query: 296  NNKQLDDKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRL-----PCGHV 350
            NNK++ DK      D  +  +++C++C   L                K+L     PCGH 
Sbjct: 1265 NNKKIMDKFGYWYCDSCKKRNSLCVLCERPL----------------KKLTMVLLPCGHE 1308

Query: 351  LHLYCLKNWM--ERSQTCP 367
             H  C++ W   E+ + CP
Sbjct: 1309 GHFQCIQEWFLNEKERECP 1327

>KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON}
           conserved hypothetical protein
          Length = 267

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 30/63 (47%), Gaps = 11/63 (17%)

Query: 319 CIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMER-SQTCPICRLAVFDEM 377
           C+IC ++           N  N  + L C H+ H +C+  W+ R S  CP+C+ +    +
Sbjct: 110 CVICQEQF----------NELNNIRVLGCSHIFHSHCIDRWICRNSACCPLCKRSYSLPV 159

Query: 378 GNV 380
           G+ 
Sbjct: 160 GSC 162

>TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON} Anc_3.405
           YPR093C
          Length = 384

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 13/63 (20%)

Query: 311 QLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQ--TCPI 368
           +L  + ++C IC+D +            K+  K  PC H  H+ C++ W   S    CP 
Sbjct: 11  KLTMVSSICAICLDAI-----------DKSIAKLEPCNHKYHIDCIRTWHNYSNDLNCPT 59

Query: 369 CRL 371
           CR+
Sbjct: 60  CRI 62

>ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} similar
           to uniprot|P38748 YHL010C Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 2/28 (7%)

Query: 345 LPCGHVLHLYCLKNWMERSQTCPICRLA 372
           +PC H  H  CL  W  ++  CP+CR +
Sbjct: 251 IPCQHTFHCQCLDKW--KNSKCPVCRYS 276

>KNAG0I01380 Chr9 (265230..269711) [4482 bp, 1493 aa] {ON} Anc_1.389
            YLR247C
          Length = 1493

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 17/26 (65%)

Query: 345  LPCGHVLHLYCLKNWMERSQTCPICR 370
            + CGH     C+ +W++  +TCPIC+
Sbjct: 1190 MKCGHFFCRDCIHSWLKNQRTCPICK 1215

>Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 345 LPCGHVLHLYCLKNWMERSQTCPICR 370
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 257 IPCQHTFHCQCLNKW--KNSRCPVCR 280

>TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.542
           YHL010C
          Length = 567

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 5/48 (10%)

Query: 345 LPCGHVLHLYCLKNWMERSQTCPICRLAVFDEMGNVVQSTVPTTAEVT 392
           +PC H  H  CL  W  ++  CP+CR +      N   S V  T E++
Sbjct: 251 IPCQHTFHCQCLDKW--KNSRCPVCRYSSIRLSRN---SAVRQTGEIS 293

>TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1.389
            YLR247C
          Length = 1452

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 2/29 (6%)

Query: 345  LPCGHVLHLYCLKNWMERS--QTCPICRL 371
            L CGH     C+ NW+E+S  + CPIC++
Sbjct: 1150 LKCGHYYCQDCIWNWLEKSKKKNCPICKI 1178

>Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON}
           similar to Ashbya gossypii ABR104W
          Length = 321

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 25/58 (43%), Gaps = 14/58 (24%)

Query: 319 CIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWME---RSQTCPICRLAV 373
           C IC D +             N  K +PC H  HL C++ W       +TCP CR+ +
Sbjct: 9   CPICWDSM-----------ADNVAKLIPCQHEFHLSCIRKWYHSRISDRTCPNCRVEI 55

>ZYRO0E05192g Chr5 (393899..398461) [4563 bp, 1520 aa] {ON} similar to
            uniprot|Q06554 Saccharomyces cerevisiae YLR247C
            Hypothetical ORF
          Length = 1520

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 18/26 (69%)

Query: 345  LPCGHVLHLYCLKNWMERSQTCPICR 370
            + CGH     C+ +W++ +Q+CP+C+
Sbjct: 1214 IKCGHFFCRKCIHSWLKNNQSCPLCK 1239

>YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}
           ETP1Putative protein of unknown function that is
           required for growth on ethanol; contains a zinc finger
           region and has homology to human BRAP2, which is a
           cytoplasmic protein that binds nuclear localization
           sequences
          Length = 585

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 345 LPCGHVLHLYCLKNWMERSQTCPICR 370
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 257 IPCQHTFHCQCLNKW--KNSRCPVCR 280

>KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa]
           {ON} similar to uniprot|P38239 Saccharomyces cerevisiae
           YBR062C Hypothetical ORF
          Length = 140

 Score = 34.3 bits (77), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 8/69 (11%)

Query: 302 DKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWME 361
           D LP +   +L+  ++ C IC    +   D+ +    K  P+   C H   L CL  W++
Sbjct: 55  DSLPRVPNSKLK-AEDTCAICQCNFL---DDPYPLVAK-VPR---CNHKFDLECLSIWLQ 106

Query: 362 RSQTCPICR 370
            + TCP+CR
Sbjct: 107 NNHTCPMCR 115

>KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1466

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 51/105 (48%), Gaps = 10/105 (9%)

Query: 273  IKDVLWDCLTLHQNAKG-LWKIWRNNKQLDDKLPTMS--EDQLRNIDNMCIICMDELIPE 329
            I D L   + L  N K  + +  +++KQ  + L  +S  E +++ + N+  I   +LI E
Sbjct: 1088 ISDSLISIIQLEPNVKNSILRSIKDDKQYKENLTKISQIESRIKYLKNLSKI--QDLI-E 1144

Query: 330  QDEGHT----RNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICR 370
            Q++        NT      + CGH    +C+ +W++    CPIC+
Sbjct: 1145 QNKSFNCPICLNTIYMGSIIKCGHFFCKHCIFSWLKNKSVCPICK 1189

>AGL191W Chr7 (339295..341043) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR143C (SAN1)
          Length = 582

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 2/59 (3%)

Query: 328 PEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPIC--RLAVFDEMGNVVQST 384
           P ++E    + K+ P  LPCGHV    C+  W +   +   C  R+   + + + VQ T
Sbjct: 207 PAEEEAEQSHYKHSPTELPCGHVFGRDCIFRWTQEHNSLSYCWARIVENEGLNHAVQDT 265

>CAGL0K08052g Chr11 complement(800991..801908) [918 bp, 305 aa] {ON}
           weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093c
          Length = 305

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 14/59 (23%), Positives = 29/59 (49%), Gaps = 11/59 (18%)

Query: 315 IDNMCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQ--TCPICRL 371
           +  +C IC++++  +    + +         PCGH  H  C++ W   ++   CP+CR+
Sbjct: 2   VSKVCAICLEDICGKSSTSYLK---------PCGHEYHSDCIRKWHGHAEDLKCPMCRI 51

>Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 345 LPCGHVLHLYCLKNWMERSQTCPICR 370
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 257 IPCQHTFHCQCLNKW--KNSRCPVCR 280

>TDEL0A03090 Chr1 (550834..552594) [1761 bp, 586 aa] {ON} 
          Length = 586

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 17/30 (56%)

Query: 346 PCGHVLHLYCLKNWMERSQTCPICRLAVFD 375
           PCGH +H +C   +   S  CP C++ V +
Sbjct: 350 PCGHAIHQHCFDEYTRHSYKCPHCQVTVLN 379

>Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 345 LPCGHVLHLYCLKNWMERSQTCPICR 370
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 257 IPCQHTFHCQCLNKW--KNSRCPVCR 280

>Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON}
            (207883..212532) [4650 nt, 1550 aa]
          Length = 1549

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 8/26 (30%), Positives = 17/26 (65%)

Query: 345  LPCGHVLHLYCLKNWMERSQTCPICR 370
            + CGH     C+++W++   +CP+C+
Sbjct: 1239 IKCGHFFCKKCIQSWLKNKNSCPLCK 1264

>SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 548

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 3/54 (5%)

Query: 345 LPCGHVLHLYCLKNWMERSQTCPICRLAVFD-EMGNVVQSTVPTTAEVTPTDEI 397
           +PC H  H  CL  W  +   CP+CR +      GN+++      +    TD +
Sbjct: 254 IPCQHTFHCQCLDKW--KDSRCPVCRYSNLKLTRGNLLKQGGDVCSICGATDSL 305

>NDAI0I00400 Chr9 complement(80973..82418) [1446 bp, 481 aa] {ON}
           Anc_6.332 YCR066W
          Length = 481

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 20/36 (55%)

Query: 342 PKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFDEM 377
           P   PCGH     C++ +++ +  CP+C L + + M
Sbjct: 38  PVLTPCGHTFCSVCIREYLQSNSKCPLCLLELRESM 73

>KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 540

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 15/28 (53%), Gaps = 2/28 (7%)

Query: 345 LPCGHVLHLYCLKNWMERSQTCPICRLA 372
           +PC H  H  CL  W  +   CP+CR +
Sbjct: 264 IPCQHTFHCQCLNKW--KDSRCPVCRYS 289

>NCAS0A08780 Chr1 (1735117..1739625) [4509 bp, 1502 aa] {ON} Anc_1.389
          Length = 1502

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 9/27 (33%), Positives = 17/27 (62%)

Query: 345  LPCGHVLHLYCLKNWMERSQTCPICRL 371
            L CGH     C+ +W++  + CP+C++
Sbjct: 1204 LKCGHFFCKRCITSWLKNKKNCPMCKM 1230

>Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {ON}
           YDL008W (APC11) - subunit of the anaphase promoting
           complex (APC) [contig 183] FULL
          Length = 135

 Score = 33.9 bits (76), Expect = 0.34,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 17/27 (62%), Gaps = 3/27 (11%)

Query: 347 CGHVLHLYCLKNWMERSQT---CPICR 370
           C H  H++C++ W+E +     CP+CR
Sbjct: 62  CNHNFHVHCIQQWLETATAKGLCPMCR 88

>KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133W HRT1
           RING finger containing subunit of Skp1-Cullin- F-box
           ubiquitin protein ligases (SCF) required for Gic2p Far1p
           Sic1p and Cln2p degradation may tether Cdc34p (a
           ubiquitin conjugating enzyme or E2) and Cdc53p (a
           cullin) subunits of SCF
          Length = 110

 Score = 33.1 bits (74), Expect = 0.37,   Method: Composition-based stats.
 Identities = 15/60 (25%), Positives = 25/60 (41%), Gaps = 6/60 (10%)

Query: 314 NIDNMCIICMDELIPEQDEGHTRNTKNKPKRL-----PCGHVLHLYCLKNWMERSQTCPI 368
           ++DN C IC + ++          T N           C H  HL+C+  W++    CP+
Sbjct: 40  DVDN-CAICRNHIMEPCVNCQQEATFNSEHECVAAWGECNHAFHLHCITQWIKSRNVCPL 98

>NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3.279
           YBR062C
          Length = 118

 Score = 33.5 bits (75), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 19/34 (55%)

Query: 347 CGHVLHLYCLKNWMERSQTCPICRLAVFDEMGNV 380
           C H   L C+  W+ +S TCP+CR  V +   N+
Sbjct: 70  CNHRFDLECISVWLSKSVTCPLCRDNVLEHKLNI 103

>TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {ON}
           Anc_3.28 YOL133W
          Length = 122

 Score = 33.5 bits (75), Expect = 0.41,   Method: Composition-based stats.
 Identities = 8/22 (36%), Positives = 14/22 (63%)

Query: 347 CGHVLHLYCLKNWMERSQTCPI 368
           C H  HL+C+  W++  + CP+
Sbjct: 89  CNHAFHLHCINKWIKTREACPL 110

>Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {ON}
           YHL010C - Hypothetical ORF [contig 55] FULL
          Length = 520

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 15/28 (53%), Gaps = 2/28 (7%)

Query: 345 LPCGHVLHLYCLKNWMERSQTCPICRLA 372
           +PC H  H  CL  W +    CP+CR +
Sbjct: 244 IPCQHTFHCVCLNKWGD--NRCPVCRYS 269

>KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 110

 Score = 33.1 bits (74), Expect = 0.43,   Method: Composition-based stats.
 Identities = 8/22 (36%), Positives = 13/22 (59%)

Query: 347 CGHVLHLYCLKNWMERSQTCPI 368
           C H  HL+C+  W++    CP+
Sbjct: 77  CNHAFHLHCINKWLQTRNACPL 98

>KAFR0D04640 Chr4 complement(911653..912561) [909 bp, 302 aa] {ON}
           Anc_5.339 YDR313C
          Length = 302

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 56/135 (41%), Gaps = 29/135 (21%)

Query: 230 DDTQFSGLEGKFIYERVIDISTRFLKTVLHALLLVPFRMPIMLIKDVLWDCLTLHQNAKG 289
           D ++FSG E   I + + +  TR  +   H    V       L  D   +C T ++N   
Sbjct: 174 DFSEFSGNEE--IEDHIKECLTRAERAQQHQTTSVA----SGLSNDQENNCPT-NRNRML 226

Query: 290 LWKIWRNNKQLDDKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRLPCGH 349
           ++K+ ++N +  ++ P             C IC +E+IP    G          RL C  
Sbjct: 227 VYKVAKDNTKTTEEYPE------------CPICFEEMIPGDKVG----------RLECLC 264

Query: 350 VLHLYCLKNWMERSQ 364
           V H  C+K+W  + Q
Sbjct: 265 VFHYKCIKSWFNKRQ 279

>Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa]
           {ON} YOL133W (HRT1) - subunit of Skp1-Cullin-F-box
           ubiquitin protein ligase (SCF) [contig 124] FULL
          Length = 111

 Score = 33.1 bits (74), Expect = 0.44,   Method: Composition-based stats.
 Identities = 8/22 (36%), Positives = 13/22 (59%)

Query: 347 CGHVLHLYCLKNWMERSQTCPI 368
           C H  HL+C+  W++    CP+
Sbjct: 78  CNHAFHLHCINKWLQTRNACPL 99

>TPHA0I00560 Chr9 (112560..113744) [1185 bp, 394 aa] {ON} Anc_8.808
           YOL054W
          Length = 394

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 33/80 (41%), Gaps = 19/80 (23%)

Query: 318 MCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQT----CPICRLAV 373
           MC IC D +               P    CGH     CLK+W   ++T    CP CR +V
Sbjct: 29  MCSICQDYMF-------------VPMMTACGHNYCYGCLKSWFTSNETTELSCPQCRSSV 75

Query: 374 FDE--MGNVVQSTVPTTAEV 391
             E  + +V+Q  +    EV
Sbjct: 76  GSEPNLNSVLQQGMNCLVEV 95

>CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some
            similarities with uniprot|Q06554 Saccharomyces cerevisiae
            YLR247c
          Length = 1470

 Score = 35.0 bits (79), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 31/67 (46%), Gaps = 13/67 (19%)

Query: 304  LPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERS 363
            L T++ +  +N    C IC+  +      G   N         CGH+    C+ +W++  
Sbjct: 1149 LSTLTYEAQKNTTMECSICLQPIT----NGAMVN---------CGHLFCTSCIFSWLKNR 1195

Query: 364  QTCPICR 370
            +TCP+C+
Sbjct: 1196 KTCPLCK 1202

>TPHA0C00350 Chr3 complement(58374..59210) [837 bp, 278 aa] {ON}
           Anc_5.628 YDR265W
          Length = 278

 Score = 34.7 bits (78), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 14/29 (48%)

Query: 342 PKRLPCGHVLHLYCLKNWMERSQTCPICR 370
           P   PCGH+    C+ +W      CP CR
Sbjct: 238 PSVGPCGHIFCWDCIVDWCRERPECPFCR 266

>SAKL0A01474g Chr1 complement(140890..142296) [1407 bp, 468 aa] {ON}
           similar to gnl|GLV|CAGL0J03586g Candida glabrata
           CAGL0J03586g and weakly similar to YCR066W
           uniprot|P10862 Saccharomyces cerevisiae YCR066W RAD18
           Protein involved in postreplication repair binds
           single-stranded DNA and has single-stranded DNA
           dependent ATPase activity forms heterodimer with Rad6p
           contains RING-finger motif
          Length = 468

 Score = 34.7 bits (78), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 30/69 (43%), Gaps = 15/69 (21%)

Query: 311 QLRNIDNM--CIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPI 368
           QL ++D +  C +C D L               P   PCGH     C++ ++ R   CP+
Sbjct: 34  QLSDLDTLLRCHVCKDFL-------------KTPVLTPCGHTFCSLCIREYLNRELKCPL 80

Query: 369 CRLAVFDEM 377
           C + + + M
Sbjct: 81  CLVELRESM 89

>CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133w HRT1
           RING-box protein
          Length = 102

 Score = 32.3 bits (72), Expect = 0.61,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 8/60 (13%)

Query: 315 IDNMCIIC----MDELIPEQDEGHTRNTKNK--PKRLPCGHVLHLYCLKNWMERSQTCPI 368
           +DN C IC    M+  I  Q +  T +T N+       C H  HL+C+  W++    CP+
Sbjct: 33  VDN-CAICRNHIMEPCIECQPKAMT-DTDNECVAAWGTCNHAFHLHCINKWIKTRDACPL 90

>KAFR0F02840 Chr6 complement(564020..565357) [1338 bp, 445 aa] {ON}
           Anc_6.332 YCR066W
          Length = 445

 Score = 34.7 bits (78), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 15/28 (53%)

Query: 342 PKRLPCGHVLHLYCLKNWMERSQTCPIC 369
           P   PCGH     C++ ++ R   CP+C
Sbjct: 38  PVLTPCGHTFCSICIREYINRQSKCPLC 65

>NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542
          Length = 625

 Score = 34.7 bits (78), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 14/28 (50%), Gaps = 2/28 (7%)

Query: 345 LPCGHVLHLYCLKNWMERSQTCPICRLA 372
           +PC H  H  CL  W      CP+CR +
Sbjct: 285 IPCQHTFHCSCLDKW--NDSRCPVCRYS 310

>CAGL0J03586g Chr10 complement(343893..345128) [1236 bp, 411 aa]
           {ON} similar to uniprot|P10862 Saccharomyces cerevisiae
           YCR066w RAD18 DNA repair protein
          Length = 411

 Score = 34.3 bits (77), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 15/61 (24%)

Query: 311 QLRNIDNM--CIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPI 368
           QL+ +D++  C IC D L            KN P   PCGH     C++ ++     CP+
Sbjct: 17  QLQELDDLLRCHICKDFL------------KN-PVLTPCGHTFCSLCIRGYLSNEPKCPL 63

Query: 369 C 369
           C
Sbjct: 64  C 64

>KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa]
           {ON} similar to uniprot|Q12157 Saccharomyces cerevisiae
           YDL008W APC11 Catalytic core subunit of the Anaphase-
           Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin- protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 162

 Score = 33.5 bits (75), Expect = 0.69,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 3/27 (11%)

Query: 347 CGHVLHLYCLKNWMERSQT---CPICR 370
           C H  H++C+K W+    +   CP+CR
Sbjct: 87  CNHNFHVHCIKQWLSTETSKGLCPLCR 113

>NDAI0E00440 Chr5 (80965..82215) [1251 bp, 416 aa] {ON} Anc_8.808
           YOL054W
          Length = 416

 Score = 34.3 bits (77), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 16/35 (45%), Gaps = 3/35 (8%)

Query: 342 PKRLPCGHVLHLYCLKNWM---ERSQTCPICRLAV 373
           P   PCGH     CL NW+    +   CP CR  +
Sbjct: 40  PMMTPCGHNFCYGCLNNWITGGSKDLNCPQCRSTI 74

>SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 138

 Score = 32.7 bits (73), Expect = 0.74,   Method: Composition-based stats.
 Identities = 8/22 (36%), Positives = 13/22 (59%)

Query: 347 CGHVLHLYCLKNWMERSQTCPI 368
           C H  HL+C+  W++    CP+
Sbjct: 105 CNHAFHLHCINKWLQTRNACPL 126

>SAKL0C03586g Chr3 (337347..341771) [4425 bp, 1474 aa] {ON} weakly
            similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1474

 Score = 34.7 bits (78), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 15/27 (55%)

Query: 347  CGHVLHLYCLKNWMERSQTCPICRLAV 373
            CGH     C+  W++   TCP+C+  V
Sbjct: 1179 CGHFFCYSCIHTWLKEHNTCPLCKTNV 1205

>KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON}
           Anc_3.28 YOL133W
          Length = 118

 Score = 32.3 bits (72), Expect = 0.79,   Method: Composition-based stats.
 Identities = 8/22 (36%), Positives = 13/22 (59%)

Query: 347 CGHVLHLYCLKNWMERSQTCPI 368
           C H  HL+C+  W++    CP+
Sbjct: 85  CNHAFHLHCINKWIKTRDACPL 106

>SAKL0C01760g Chr3 complement(149641..154065) [4425 bp, 1474 aa] {ON}
            weakly similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1474

 Score = 34.7 bits (78), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 15/27 (55%)

Query: 347  CGHVLHLYCLKNWMERSQTCPICRLAV 373
            CGH     C+  W++   TCP+C+  V
Sbjct: 1179 CGHFFCYSCIHTWLKEHNTCPLCKTNV 1205

>Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON}
            (40266..43685) [3420 nt, 1140 aa]
          Length = 1139

 Score = 34.7 bits (78), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 12/21 (57%)

Query: 347  CGHVLHLYCLKNWMERSQTCP 367
            C HV+H YC K W   S  CP
Sbjct: 1105 CQHVMHSYCAKEWWNSSNECP 1125

>ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {ON}
           highly similar to uniprot|Q08273 Saccharomyces
           cerevisiae YOL133W HRT1 RING finger containing subunit
           of Skp1-Cullin-F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 116

 Score = 32.3 bits (72), Expect = 0.86,   Method: Composition-based stats.
 Identities = 8/22 (36%), Positives = 13/22 (59%)

Query: 347 CGHVLHLYCLKNWMERSQTCPI 368
           C H  HL+C+  W++    CP+
Sbjct: 83  CNHAFHLHCINKWIKTRDACPL 104

>Suva_4.521 Chr4 (902071..904143) [2073 bp, 690 aa] {ON} YBR259W
           (REAL)
          Length = 690

 Score = 34.3 bits (77), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 2/63 (3%)

Query: 352 HLYCLKNWMERS--QTCPICRLAVFDEMGNVVQSTVPTTAEVTPTDEINVPETVVERSQE 409
           HLY +KN +ERS  Q+  +   ++   + N+VQS++ +   VT T +   P +V+   Q+
Sbjct: 480 HLYLMKNCLERSVIQSLTMLDPSLVHTINNLVQSSIESLQNVTLTTDDKTPSSVILLPQK 539

Query: 410 QIQ 412
             +
Sbjct: 540 GFK 542

>Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 32.3 bits (72), Expect = 0.86,   Method: Composition-based stats.
 Identities = 8/22 (36%), Positives = 13/22 (59%)

Query: 347 CGHVLHLYCLKNWMERSQTCPI 368
           C H  HL+C+  W++    CP+
Sbjct: 88  CNHAFHLHCINKWIKTRDACPL 109

>NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28
           YOL133W
          Length = 123

 Score = 32.3 bits (72), Expect = 0.90,   Method: Composition-based stats.
 Identities = 8/22 (36%), Positives = 13/22 (59%)

Query: 347 CGHVLHLYCLKNWMERSQTCPI 368
           C H  HL+C+  W++    CP+
Sbjct: 90  CNHAFHLHCINKWIQTRDACPL 111

>Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON}
           complement(29615..29938) [324 nt, 108 aa]
          Length = 107

 Score = 32.0 bits (71), Expect = 0.95,   Method: Composition-based stats.
 Identities = 8/22 (36%), Positives = 13/22 (59%)

Query: 347 CGHVLHLYCLKNWMERSQTCPI 368
           C H  HL+C+  W++    CP+
Sbjct: 74  CNHAFHLHCINKWIKTRDACPL 95

>TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28
           YOL133W
          Length = 118

 Score = 32.3 bits (72), Expect = 0.95,   Method: Composition-based stats.
 Identities = 8/22 (36%), Positives = 13/22 (59%)

Query: 347 CGHVLHLYCLKNWMERSQTCPI 368
           C H  HL+C+  W++    CP+
Sbjct: 85  CNHAFHLHCINKWIKTRDACPL 106

>TBLA0I02360 Chr9 (541190..543124) [1935 bp, 644 aa] {ON} Anc_6.332
           YCR066W
          Length = 644

 Score = 34.3 bits (77), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 9/28 (32%), Positives = 15/28 (53%)

Query: 342 PKRLPCGHVLHLYCLKNWMERSQTCPIC 369
           P   PCGH     C++ ++ +   CP+C
Sbjct: 38  PVLTPCGHTFCSLCIRGYLNKEPKCPLC 65

>YPR093C Chr16 complement(719558..720424) [867 bp, 288 aa] {ON}
           ASR1Ubiquitin ligase that modifies and regulates RNA Pol
           II; involved in a putative alcohol-responsive signaling
           pathway; accumulates in the nucleus under alcohol
           stress; contains a Ring/PHD finger domain similar to the
           mammalian rA9 protein
          Length = 288

 Score = 33.5 bits (75), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 2/27 (7%)

Query: 347 CGHVLHLYCLKNWMERS--QTCPICRL 371
           CGH  HL C++ W + S    CPICR+
Sbjct: 23  CGHKFHLNCIREWHKYSINLKCPICRV 49

>TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {ON}
           Anc_3.28 YOL133W
          Length = 111

 Score = 32.0 bits (71), Expect = 1.0,   Method: Composition-based stats.
 Identities = 8/22 (36%), Positives = 13/22 (59%)

Query: 347 CGHVLHLYCLKNWMERSQTCPI 368
           C H  HL+C+  W++    CP+
Sbjct: 78  CNHAFHLHCINKWIKTRDACPL 99

>KLLA0F12166g Chr6 complement(1116715..1121301) [4587 bp, 1528 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1528

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 17/26 (65%)

Query: 345  LPCGHVLHLYCLKNWMERSQTCPICR 370
            L CGH     C+ +W +++ +CP+C+
Sbjct: 1221 LKCGHFFCKDCVTHWFKKNTSCPMCK 1246

>NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28
          Length = 109

 Score = 32.0 bits (71), Expect = 1.0,   Method: Composition-based stats.
 Identities = 8/22 (36%), Positives = 13/22 (59%)

Query: 347 CGHVLHLYCLKNWMERSQTCPI 368
           C H  HL+C+  W++    CP+
Sbjct: 76  CNHAFHLHCINKWIKTRDACPL 97

>YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}
            RTC1Subunit of the SEA (Seh1-associated) complex, a
            coatomer-related complex that associates dynamically with
            the vacuole; null mutation suppresses cdc13-1 temperature
            sensitivity; has N-terminal WD-40 repeats and a
            C-terminal RING motif
          Length = 1341

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 30/78 (38%), Gaps = 23/78 (29%)

Query: 297  NKQLDDKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRL-----PCGHVL 351
            NK++ DK      D  +  +  C++C   L                K+L     PCGH  
Sbjct: 1271 NKKIMDKFGYWYCDSCKKKNTSCVLCERPL----------------KKLTMVILPCGHEG 1314

Query: 352  HLYCLKNWM--ERSQTCP 367
            H  C++ W   E  Q CP
Sbjct: 1315 HFQCIQEWFLDENEQECP 1332

>SAKL0D08272g Chr4 complement(687452..691927) [4476 bp, 1491 aa] {ON}
            similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1491

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/91 (21%), Positives = 35/91 (38%), Gaps = 14/91 (15%)

Query: 281  LTLHQNAKGLWKIWRNNKQLDDKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKN 340
            L  H+N K +  +    K L+  L  +++   R     C IC  E+              
Sbjct: 1127 LQYHENMKKINGLHSRIKYLE-TLTKLNDAMHRKKKFTCTICFSEIY------------- 1172

Query: 341  KPKRLPCGHVLHLYCLKNWMERSQTCPICRL 371
                + CGH     C+ +W+     CP+C++
Sbjct: 1173 MGSIIKCGHFFCKSCIHSWLRNKNACPLCKM 1203

>KNAG0J01560 Chr10 (287736..288665) [930 bp, 309 aa] {ON} Anc_5.628
           YDR265W
          Length = 309

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 13/29 (44%)

Query: 342 PKRLPCGHVLHLYCLKNWMERSQTCPICR 370
           P   PCGH     CL  W      CP+CR
Sbjct: 268 PSCAPCGHTYCWDCLFKWCNERPECPLCR 296

>ZYRO0B02046g Chr2 (164680..166017) [1338 bp, 445 aa] {ON} conserved
           hypothetical protein
          Length = 445

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 17/30 (56%)

Query: 346 PCGHVLHLYCLKNWMERSQTCPICRLAVFD 375
           PCGH +H +C +     S  CP C++ V +
Sbjct: 239 PCGHAIHQHCFEEHTRHSYKCPHCQVTVLN 268

>YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING finger
           containing subunit of Skp1-Cullin-F-box ubiquitin
           protein ligases (SCF); required for Gic2p, Far1p, Sic1p
           and Cln2p degradation; may tether Cdc34p (a ubiquitin
           conjugating enzyme or E2) and Cdc53p (a cullin) subunits
           of SCF
          Length = 121

 Score = 32.0 bits (71), Expect = 1.2,   Method: Composition-based stats.
 Identities = 8/22 (36%), Positives = 13/22 (59%)

Query: 347 CGHVLHLYCLKNWMERSQTCPI 368
           C H  HL+C+  W++    CP+
Sbjct: 88  CNHAFHLHCINKWIKTRDACPL 109

>Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W
           (REAL)
          Length = 122

 Score = 32.0 bits (71), Expect = 1.2,   Method: Composition-based stats.
 Identities = 8/22 (36%), Positives = 13/22 (59%)

Query: 347 CGHVLHLYCLKNWMERSQTCPI 368
           C H  HL+C+  W++    CP+
Sbjct: 89  CNHAFHLHCINKWIKTRDACPL 110

>Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 32.0 bits (71), Expect = 1.2,   Method: Composition-based stats.
 Identities = 8/22 (36%), Positives = 13/22 (59%)

Query: 347 CGHVLHLYCLKNWMERSQTCPI 368
           C H  HL+C+  W++    CP+
Sbjct: 88  CNHAFHLHCINKWIKTRDACPL 109

>Ecym_7253 Chr7 complement(534000..535853) [1854 bp, 617 aa] {ON}
           similar to KLTH0D06886g KLTH0D06886p Lachancea
           thermotolerans
          Length = 617

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 17/30 (56%)

Query: 346 PCGHVLHLYCLKNWMERSQTCPICRLAVFD 375
           PCGH +H +C  +    S  CP C++ V +
Sbjct: 388 PCGHAIHQHCFNDHTRHSYKCPQCQVTVVN 417

>TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_1.389
            YLR247C
          Length = 1470

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 8/26 (30%), Positives = 16/26 (61%)

Query: 345  LPCGHVLHLYCLKNWMERSQTCPICR 370
            + CGH     C+ +W++   +CP+C+
Sbjct: 1167 IKCGHFFCRSCIHSWLKNHNSCPMCK 1192

>KAFR0B00340 Chr2 (77653..79947) [2295 bp, 764 aa] {ON} Anc_7.537
           YPR181C
          Length = 764

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 50/120 (41%), Gaps = 15/120 (12%)

Query: 304 LPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKP---KRLPCGHVLHLYCLKNWM 360
            P+   D  +N+  + I C+   + E DE +    +  P       C  +L+ YC  +  
Sbjct: 19  FPSTRTDANKNV--VPIGCLYTPLKEMDEDNVNVAQYNPVICAGPQCKSILNPYCAIDPR 76

Query: 361 ERSQTCPIC--RLAVFDEMGNVVQSTVP-----TTAEVTPTDEINVPET---VVERSQEQ 410
             S TCP+C  R  +  +  N+ Q  +P     TT E      + +P     V++ + EQ
Sbjct: 77  SNSWTCPVCNSRNHLPTQYANMTQENMPLELQHTTIEYITNKPVQIPPIFFFVIDITAEQ 136

>AER016C Chr5 complement(659572..660015) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL008W
           (APC11)
          Length = 147

 Score = 32.3 bits (72), Expect = 1.4,   Method: Composition-based stats.
 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 3/29 (10%)

Query: 347 CGHVLHLYCLKNWMERSQT---CPICRLA 372
           C H  H++C+  W+  S +   CP+CR A
Sbjct: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCRQA 94

>NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {ON}
            Anc_3.22 YOL138C
          Length = 1393

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 26/68 (38%), Gaps = 19/68 (27%)

Query: 310  DQLRNIDNMCIIC---MDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWM--ERSQ 364
            D  R  +++C+IC   M +L                  L CGH  H  C KNW   E   
Sbjct: 1337 DSCRKPNSLCVICECPMKKLTLTA--------------LRCGHEAHFQCFKNWFLDEGMN 1382

Query: 365  TCPICRLA 372
            TCP   L 
Sbjct: 1383 TCPAGCLG 1390

>KLLA0C14542g Chr3 (1272215..1273195) [981 bp, 326 aa] {ON} similar
           to uniprot|Q6Q5S5 Saccharomyces cerevisiae YDR313C PIB1
           RING-type ubiquitin ligase of the endosomal and vacuolar
           membranes binds phosphatidylinositol(3)- phosphate
           contains a FYVE finger domain
          Length = 326

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 10/44 (22%)

Query: 319 CIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMER 362
           C IC +E+ P Q  G          RL C  V H +C+K+W ++
Sbjct: 261 CPICFEEMAPGQKVG----------RLECLCVFHYHCIKSWFKK 294

>KLLA0C08756g Chr3 complement(765847..767130) [1284 bp, 427 aa] {ON}
           similar to uniprot|Q75EN0 Ashbya gossypii AAR049C RAD18
           Postreplication repair ubiquitin-protein ligase E3 RAD18
           and weakly similar to YCR066W uniprot|P10862
           Saccharomyces cerevisiae YCR066W RAD18 Protein involved
           in postreplication repair binds single-stranded DNA and
           has single-stranded DNA dependent ATPase activity forms
           heterodimer with Rad6p contains RING-finger motif
          Length = 427

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 8/24 (33%), Positives = 15/24 (62%)

Query: 346 PCGHVLHLYCLKNWMERSQTCPIC 369
           PCGH     C++ ++++   CP+C
Sbjct: 46  PCGHSFCSICIRKYLQKESKCPLC 69

>ADL181W Chr4 (379682..380008) [327 bp, 108 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL133W (HRT1)
          Length = 108

 Score = 31.6 bits (70), Expect = 1.5,   Method: Composition-based stats.
 Identities = 8/22 (36%), Positives = 12/22 (54%)

Query: 347 CGHVLHLYCLKNWMERSQTCPI 368
           C H  HL+C+  W+     CP+
Sbjct: 75  CNHAFHLHCINKWLLTRNACPL 96

>Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON}
            YOL138C (REAL)
          Length = 1326

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 30/78 (38%), Gaps = 23/78 (29%)

Query: 297  NKQLDDKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRL-----PCGHVL 351
            NK++ DK      D  +  + +C++C   L                K+L     PCGH  
Sbjct: 1256 NKKIMDKFGYWYCDSCKKKNTLCVLCERPL----------------KKLTMVILPCGHEG 1299

Query: 352  HLYCLKNWM--ERSQTCP 367
            H  C++ W   E    CP
Sbjct: 1300 HFQCIQEWFLNENEHECP 1317

>Ecym_2684 Chr2 complement(1321556..1322716) [1161 bp, 386 aa] {ON}
           similar to Ashbya gossypii AGL217W
          Length = 386

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 16/36 (44%), Gaps = 4/36 (11%)

Query: 342 PKRLPCGHVLHLYCLKNWMERSQ----TCPICRLAV 373
           P    CGH    YC+ NW+  +      CP CR  +
Sbjct: 4   PVMTSCGHNYCYYCISNWLNNNNATELNCPQCRTTI 39

>Sklu_YGOB_Anc_1.437 Chr4 complement(886967..887182) [216 bp, 71 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 71

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 38/68 (55%), Gaps = 6/68 (8%)

Query: 448 NSATNETVPA-SLLIERTNASERYD--DDDDQVETIIIPDEVVDQAQTIENLKRRVSELE 504
           NS T +T+ A  LL  R N  E +   DD ++ E  II +   D+   +E + +R+ +L 
Sbjct: 7   NSITLKTLTAHQLLSSRENMCELFHLLDDSERQEKAIIRE---DRESVLEAMTKRLEQLR 63

Query: 505 SQVEHLNK 512
           S+VE LNK
Sbjct: 64  SEVEALNK 71

>KLTH0A06556g Chr1 (545636..547018) [1383 bp, 460 aa] {ON} similar
           to uniprot|P10862 Saccharomyces cerevisiae YCR066W RAD18
           Protein involved in postreplication repair binds
           single-stranded DNA and has single-stranded DNA
           dependent ATPase activity forms heterodimer with Rad6p
           contains RING-finger motif
          Length = 460

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 10/32 (31%), Positives = 17/32 (53%)

Query: 346 PCGHVLHLYCLKNWMERSQTCPICRLAVFDEM 377
           PCGH     C++ ++ R   CP+C   + + M
Sbjct: 51  PCGHTFCSLCIREYLNRELKCPLCLAELRESM 82

>CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highly
            similar to uniprot|Q03897 Saccharomyces cerevisiae
            YDR128w
          Length = 1120

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 13/21 (61%)

Query: 347  CGHVLHLYCLKNWMERSQTCP 367
            C HVLHL C K W   S+ CP
Sbjct: 1086 CQHVLHLKCSKEWWNVSKECP 1106

>TPHA0G00290 Chr7 (47777..50185) [2409 bp, 802 aa] {ON} Anc_7.537
           YPR181C
          Length = 802

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 7/61 (11%)

Query: 347 CGHVLHLYCLKNWMERSQTCPIC--RLAVFDEMGNVVQSTVP-----TTAEVTPTDEINV 399
           C  +L+ YC+ +    S TCPIC  R  +  +  N+ Q  +P     TT E      I V
Sbjct: 91  CKSILNPYCIIDPRNNSWTCPICNSRNHLPTQYSNMTQENMPIELQSTTVEYITNKPIQV 150

Query: 400 P 400
           P
Sbjct: 151 P 151

>Kpol_1061.5 s1061 complement(14626..17532) [2907 bp, 968 aa] {ON}
           complement(14626..17532) [2907 nt, 969 aa]
          Length = 968

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 21/30 (70%)

Query: 435 EETSENLVTFSMKNSATNETVPASLLIERT 464
           +ETS+ L T S KN ATN+ VP  +L +RT
Sbjct: 330 DETSKRLTTISTKNKATNQFVPKPILKKRT 359

>Kpol_480.22 s480 (52842..54119) [1278 bp, 425 aa] {ON}
           (52842..54119) [1278 nt, 426 aa]
          Length = 425

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 48/114 (42%), Gaps = 13/114 (11%)

Query: 342 PKRLPCGHVLHLYCLKNWMERSQT----CPICRLAV--FDEMGNVVQSTVPTTAEVTPTD 395
           P  + CGH     CL +W   ++T    CP CR  V     +   +Q  + T AEV+   
Sbjct: 46  PMMVACGHNYCYSCLSSWFTSNETQELSCPQCRANVTTAPALNTTLQQLLETLAEVS--- 102

Query: 396 EINVPETVVERSQEQI-QDNQQQMGEGQVAVLDSWYSFPVEETSENLVTFSMKN 448
              + +T  E+  E + +D  +   + + + +D    +   E S+N      +N
Sbjct: 103 ---LDDTKKEKEGEDVNKDGSENNDDDEKSKIDMNTFYSSMEESKNEYNMDKRN 153

>KLTH0F11044g Chr6 (937668..938543) [876 bp, 291 aa] {ON} weakly
           similar to uniprot|Q06834 Saccharomyces cerevisiae
           YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 291

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 13/55 (23%)

Query: 319 CIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQT--CPICRL 371
           C IC + L           +K   + + CGH  H  C++ W   S+   CP CR+
Sbjct: 4   CPICFESL-----------SKGACRLVECGHKYHFNCIRRWHYHSKNLQCPTCRI 47

>CAGL0L06336g Chr12 (715056..716858) [1803 bp, 600 aa] {ON} some
           similarities with uniprot|P32917 Saccharomyces
           cerevisiae YDR103w STE5 pheromone signal transduction
           pathway protein
          Length = 600

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 10/77 (12%)

Query: 310 DQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPIC 369
           D+   I+++C +C DE I  +  G       K   L CGH+ H+ CL  ++  S   PIC
Sbjct: 31  DKRSFINHICTLC-DEPIAYKSGGE------KVIELECGHMCHMDCLMLFV-NSTALPIC 82

Query: 370 RLAVFDEMGNVVQSTVP 386
           +     +  N  +  +P
Sbjct: 83  KYC--KKFNNRAKECIP 97

>SAKL0B08976g Chr2 complement(766719..767687) [969 bp, 322 aa] {ON}
           weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 322

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 13/55 (23%)

Query: 319 CIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQ--TCPICRL 371
           C IC++ L            +N  + + C H  HL C++ W   SQ   CP CR+
Sbjct: 6   CSICLEAL-----------GQNIGRLVTCQHEYHLECIREWHNHSQDFKCPTCRV 49

>Ecym_2029 Chr2 (47083..47427) [345 bp, 114 aa] {ON} similar to
           Ashbya gossypii ADL181W
          Length = 114

 Score = 31.2 bits (69), Expect = 2.2,   Method: Composition-based stats.
 Identities = 8/22 (36%), Positives = 12/22 (54%)

Query: 347 CGHVLHLYCLKNWMERSQTCPI 368
           C H  HL+C+  W+     CP+
Sbjct: 81  CNHAFHLHCINKWLLTRNACPL 102

>KNAG0I02880 Chr9 complement(562281..563666) [1386 bp, 461 aa] {ON}
           Anc_6.332 YCR066W
          Length = 461

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 9/24 (37%), Positives = 14/24 (58%)

Query: 346 PCGHVLHLYCLKNWMERSQTCPIC 369
           PCGH     C++  + +S  CP+C
Sbjct: 42  PCGHTFCSICIREAINKSAKCPLC 65

>Kwal_14.1287 s14 (263082..267638) [4557 bp, 1518 aa] {ON} YLR247C -
            Hypothetical ORF [contig 244] FULL
          Length = 1518

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 8/27 (29%), Positives = 17/27 (62%)

Query: 345  LPCGHVLHLYCLKNWMERSQTCPICRL 371
            + CGH     C+ +W++   +CP+C++
Sbjct: 1202 IKCGHFFCQDCICSWLKNHSSCPLCKM 1228

>Kpol_1028.46 s1028 complement(110464..110775,110777..111811) [1347
           bp, 448 aa] {ON}
           complement(110464..110775,110777..111811) [1347 nt, 449
           aa]
          Length = 448

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 18/36 (50%)

Query: 342 PKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFDEM 377
           P   PCGH     C+++++     CP+C   V + M
Sbjct: 39  PVLTPCGHTFCSICIRSYVNSESKCPLCLHEVRESM 74

>KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} similar
           to uniprot|Q06834 Saccharomyces cerevisiae YPR093C ASR1
           Protein involved in a putative alcohol- responsive
           signaling pathway accumulates in the nucleus under
           alcohol stress contains a Ring/PHD finger domain
          Length = 304

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 12/55 (21%)

Query: 318 MCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQ--TCPICR 370
           +C IC+ E + E D+G           LPC H  H+ C++ W   S    CP CR
Sbjct: 4   ICGICL-ESMNETDQGEL---------LPCEHRYHVSCIRKWHLYSNDFKCPTCR 48

>KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1554

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 8/27 (29%), Positives = 17/27 (62%)

Query: 345  LPCGHVLHLYCLKNWMERSQTCPICRL 371
            + CGH     C+ +W++   +CP+C++
Sbjct: 1236 IKCGHFFCQSCIFSWLKNHASCPLCKM 1262

>TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1576

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 31/69 (44%), Gaps = 13/69 (18%)

Query: 302  DKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWME 361
            D L T+ E   +N    C IC+  +       HT +       + CGH     C+ +W++
Sbjct: 1254 DSLTTLQESIEQNKTFTCPICLGLI-------HTGSM------ISCGHFFCNNCIFSWLK 1300

Query: 362  RSQTCPICR 370
             +  CP+C+
Sbjct: 1301 LNSNCPLCK 1309

>TDEL0A07470 Chr1 (1302286..1303512) [1227 bp, 408 aa] {ON}
           Anc_6.332 YCR066W
          Length = 408

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 8/24 (33%), Positives = 14/24 (58%)

Query: 346 PCGHVLHLYCLKNWMERSQTCPIC 369
           PCGH     C++ ++ +   CP+C
Sbjct: 42  PCGHTFCSLCIRQYLRQDPKCPLC 65

>AAL030C Chr1 complement(284758..289377) [4620 bp, 1539 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR247C
          Length = 1539

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 15/23 (65%)

Query: 348  GHVLHLYCLKNWMERSQTCPICR 370
            GH     C+ +W+E  Q+CP+C+
Sbjct: 1235 GHFYCQECISSWLETKQSCPLCK 1257

>Suva_2.481 Chr2 complement(853097..853960) [864 bp, 287 aa] {ON}
           YDR313C (REAL)
          Length = 287

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 11/67 (16%)

Query: 297 NKQLDDKLPTMSEDQLRNID-NMCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYC 355
           N+ L  K+P +S +   +++   C IC +++ P +  G          RL C  V H  C
Sbjct: 203 NRMLVYKIPPISTNDENHVEIKECPICFEDMEPGEKVG----------RLECLCVFHYKC 252

Query: 356 LKNWMER 362
           +KNW  +
Sbjct: 253 IKNWFHK 259

>TBLA0A03050 Chr1 complement(731447..732532) [1086 bp, 361 aa] {ON}
           Anc_5.339 YDR313C
          Length = 361

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 14/66 (21%)

Query: 297 NKQLDDKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCL 356
           N+ L  K+P  S  +++     C IC ++L+P++  G          RL C  V H  C+
Sbjct: 283 NRMLIYKIPADSTAKIQE----CPICFEDLLPDEKIG----------RLECLCVFHYRCI 328

Query: 357 KNWMER 362
           K W ++
Sbjct: 329 KRWYKK 334

>SAKL0A10384g Chr1 complement(908415..910298) [1884 bp, 627 aa] {ON}
           similar to uniprot|P32368 Saccharomyces cerevisiae
           YKL212W SAC1 Lipid phosphoinositide phosphatase of the
           ER and Golgi involved in protein trafficking and
           secretion
          Length = 627

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%)

Query: 1   MAISETRKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTEG 46
           ++I +TR   FI   I+ YA  I +V+NAT  SI  +    RL  G
Sbjct: 171 LSIDDTRVSDFIQPMIYGYAKVIDTVFNATPISIGLITRRSRLRAG 216

>KNAG0I02090 Chr9 complement(407893..409176) [1284 bp, 427 aa] {ON}
           Anc_2.157 YHR115C
          Length = 427

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 38/82 (46%), Gaps = 17/82 (20%)

Query: 297 NKQLDDKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCL 356
            K L++++  ++ED       +C IC++E             +++    PC H  H  C+
Sbjct: 320 GKVLEERMNNLTEDTRHE---LCSICLEEC----------KLQHRLFFAPCSHCWHSACI 366

Query: 357 KNWMERSQ---TCPICRLAVFD 375
           + +M +     TCP CR  +FD
Sbjct: 367 QPYMNKDVPLFTCPNCR-CIFD 387

>ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa]
           {ON} weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 273

 Score = 31.2 bits (69), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 15/28 (53%), Gaps = 2/28 (7%)

Query: 346 PCGHVLHLYCLKNWMERSQ--TCPICRL 371
           PC H  H  CL+ W   +    CPICR+
Sbjct: 24  PCNHKFHRDCLRRWHLYAHDLVCPICRV 51

>Smik_12.320 Chr12 complement(573526..578187) [4662 bp, 1553 aa] {ON}
            YLR247C (REAL)
          Length = 1553

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 345  LPCGHVLHLYCLKNWMERSQTCPICR 370
            + CGH     C+  W+     CPIC+
Sbjct: 1249 IKCGHYFCKNCILTWLRAHSKCPICK 1274

>KLLA0E04885g Chr5 complement(433298..435580) [2283 bp, 760 aa] {ON}
           highly similar to uniprot|P15303 Saccharomyces
           cerevisiae YPR181C SEC23 cytoplasmic GTPase-activating
           protein
          Length = 760

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 41/90 (45%), Gaps = 12/90 (13%)

Query: 347 CGHVLHLYCLKNWMERSQTCPIC--RLAVFDEMGNVVQSTVP-----TTAEVTPTDEINV 399
           C  VL+ YC  +    + TCPIC  R  +     N+ Q T+P     TT E   +  + V
Sbjct: 61  CKSVLNPYCEIDVRSNTWTCPICKTRNILPQHYANMTQETLPLELTNTTVEYITSVPVQV 120

Query: 400 PET---VVERSQEQIQDNQQQMGEGQVAVL 426
           P     +V+ + E  ++N Q + E  +  L
Sbjct: 121 PPIFFFIVDTTAE--EENLQALKESIITSL 148

>Smik_4.566 Chr4 complement(1020697..1021569) [873 bp, 290 aa] {ON}
           YDR313C (REAL)
          Length = 290

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 10/58 (17%)

Query: 305 PTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMER 362
           PT + D+       C IC + + P +  G          RL C  V H  C+KNW  +
Sbjct: 215 PTATHDENHVAIKECPICFENMEPGEKVG----------RLECLCVFHYKCIKNWFHK 262

>ZYRO0B16258g Chr2 complement(1317605..1319344) [1740 bp, 579 aa]
           {ON} similar to uniprot|P53924 Saccharomyces cerevisiae
           YNL116W DMA2 Protein involved in regulating spindle
           position and orientation functionally redundant with
           Dma1p homolog of S. pombe Dma1 and H. sapiens Chfr
          Length = 579

 Score = 31.2 bits (69), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 30/140 (21%), Positives = 56/140 (40%), Gaps = 16/140 (11%)

Query: 239 GKFI-YERVIDISTRFLKTVLHALLLVPFRMPIMLIKDVLWDCLTLHQNAKGLWKIWRN- 296
           G F+ ++R+   ST    T++H   ++   M      + ++ C+ +       WK   N 
Sbjct: 410 GTFLNHQRLAPASTMSKDTLIHDGDILQLGMDFRGGTEEIYRCVKMRVEINRSWKRRANA 469

Query: 297 -NKQLDDKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYC 355
            NK+   ++  +    +   +  C IC+ ++ P Q    +          PC H  H  C
Sbjct: 470 FNKEALQRIKNIQRMTMGLEEEDCSICLSKIKPCQAMFIS----------PCSHSWHFQC 519

Query: 356 LKNWMERSQT---CPICRLA 372
           ++  +  S     CP CR A
Sbjct: 520 IRRLVMTSYPQFVCPNCRCA 539

>Kwal_27.11401 s27 complement(788598..791831) [3234 bp, 1077 aa]
           {ON} YGL151W (NUT1) - negative regulator of HO
           endonuclease [contig 27] FULL
          Length = 1077

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 46/91 (50%), Gaps = 3/91 (3%)

Query: 228 DEDDTQFSGLEGKF--IYERVIDISTRFLKTVLHALLLVPFRMPIMLIKDVLWDCLTLHQ 285
           D+DD +  G E  F  +  + +DI   FLK ++   L  P  +   L +D + D ++L  
Sbjct: 392 DKDDVKNRG-EDLFDDVPNKNMDIRHDFLKNLIIIGLQPPSILNDYLREDQVADVMSLPT 450

Query: 286 NAKGLWKIWRNNKQLDDKLPTMSEDQLRNID 316
           N   + K  +  K+L DK P+  +D++  +D
Sbjct: 451 NDAVVVKNAQGVKELVDKFPSFIKDKIEELD 481

>CAGL0H07315g Chr8 (715930..716766) [837 bp, 278 aa] {ON} similar to
           uniprot|Q06651 Saccharomyces cerevisiae YDR313c PIB1
          Length = 278

 Score = 30.8 bits (68), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 13/70 (18%)

Query: 297 NKQLDDKLPTMS--EDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLY 354
           N+ L  K+PT +  E++ +     C IC +E++P +  G          RL C  V H  
Sbjct: 200 NRMLVYKIPTTTAPENEPQGYQE-CPICFEEMVPGEKVG----------RLECLCVYHYS 248

Query: 355 CLKNWMERSQ 364
           C+K+W  + +
Sbjct: 249 CIKSWFRKKR 258

>ZYRO0D08404g Chr4 complement(728281..729510) [1230 bp, 409 aa] {ON}
           similar to uniprot|P10862 Saccharomyces cerevisiae
           YCR066W RAD18 Protein involved in postreplication repair
           binds single-stranded DNA and has single-stranded DNA
           dependent ATPase activity forms heterodimer with Rad6p
           contains RING-finger motif
          Length = 409

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 8/24 (33%), Positives = 13/24 (54%)

Query: 346 PCGHVLHLYCLKNWMERSQTCPIC 369
           PC H     C++ ++ R   CP+C
Sbjct: 42  PCSHTFCSLCIREYLTREPKCPLC 65

>NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa] {ON}
           Anc_8.808 YOL054W
          Length = 392

 Score = 30.8 bits (68), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 18/38 (47%), Gaps = 4/38 (10%)

Query: 342 PKRLPCGHVLHLYCLKNWM----ERSQTCPICRLAVFD 375
           P    CGH     CLK+W+    ++   CP CR  + D
Sbjct: 40  PMMTSCGHNYCYGCLKSWISTNSKKELACPQCRSDITD 77

>Kwal_56.23543 s56 complement(591514..594411) [2898 bp, 965 aa] {ON}
           YDR103W (STE5) - scaffold protein for MAP kinase cascade
           [contig 176] FULL
          Length = 965

 Score = 31.2 bits (69), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 24/58 (41%), Gaps = 13/58 (22%)

Query: 319 CIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTC------PICR 370
           C +C++ +         R    K   L CGH++H  CL  + E   +C      P CR
Sbjct: 162 CCLCLEYI-------SCRTVGEKVVSLECGHLVHEECLMTYFENPTSCHIDELFPFCR 212

>NDAI0G05740 Chr7 (1421943..1424516) [2574 bp, 857 aa] {ON}
           Anc_1.317 YJL062W
          Length = 857

 Score = 30.8 bits (68), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 42/74 (56%), Gaps = 15/74 (20%)

Query: 30  TRTSISFLQTVLRLTEGFNIVIITVFFTLNSVLLWKLSTSLLFGSLRLIEYEHIFERLPF 89
           T+T+ ++   +L +  G++I++I+  FT  S+L+WK  +            ++IF+ +P 
Sbjct: 406 TKTATNYNYNLLII--GYSILVISTLFT--SLLIWKDYSK-----------KNIFQLIPI 450

Query: 90  TIINTMLMSSMFSE 103
           T+I+ ML  S FS 
Sbjct: 451 TVISIMLGVSTFSS 464

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.136    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,177,567
Number of extensions: 2245593
Number of successful extensions: 11342
Number of sequences better than 10.0: 305
Number of HSP's gapped: 11680
Number of HSP's successfully gapped: 316
Length of query: 517
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 403
Effective length of database: 40,409,475
Effective search space: 16285018425
Effective search space used: 16285018425
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 68 (30.8 bits)