Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G040606.65ON2202209681e-134
ZYRO0D14190g6.65ON2951645595e-71
Smik_15.3526.65ON2881645082e-63
Suva_8.2276.65ON2871645055e-63
NCAS0F003306.65ON2811645038e-63
Skud_15.3366.65ON2861644985e-62
YOR174W (MED4)6.65ON2841644951e-61
Kpol_1042.116.65ON2921644892e-60
TBLA0G005506.65ON3181724737e-58
NDAI0J013206.65ON3341634687e-57
KAFR0G025006.65ON2891634631e-56
AGR270W6.65ON2941634588e-56
CAGL0L04620g6.65ON2641644523e-55
KNAG0M010206.65ON2791644517e-55
SAKL0A08426g6.65ON2991644528e-55
KLLA0F20185g6.65ON2851664431e-53
Kwal_56.232426.65ON2561634411e-53
KLTH0G15444g6.65ON2631624411e-53
TPHA0F025906.65ON3061634432e-53
Ecym_31246.65ON2741634263e-51
CAGL0E01925g3.48ON43360711.0
SAKL0H23408g2.492aON21558672.8
KLTH0D07590g2.559ON127967683.0
SAKL0A04752g6.204ON54984664.7
Ecym_70204.300ON41293655.9
KNAG0C042007.272ON99550665.9
TBLA0I029204.240ON1337110656.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G04060
         (220 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON...   377   e-134
ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} simil...   219   5e-71
Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W...   200   2e-63
Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W (...   199   5e-63
NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65 Y...   198   8e-63
Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W...   196   5e-62
YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subuni...   195   1e-61
Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON} (21260.....   192   2e-60
TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65...   186   7e-58
NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {...   184   7e-57
KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON...   182   1e-56
AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic h...   181   8e-56
CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} simila...   178   3e-55
KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {O...   178   7e-55
SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {O...   178   8e-55
KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa] ...   175   1e-53
Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W...   174   1e-53
KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa] ...   174   1e-53
TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65...   175   2e-53
Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON} ...   168   3e-51
CAGL0E01925g Chr5 complement(191834..193135) [1302 bp, 433 aa] {...    32   1.0  
SAKL0H23408g Chr8 (2027635..2028282) [648 bp, 215 aa] {ON} simil...    30   2.8  
KLTH0D07590g Chr4 (657085..660924) [3840 bp, 1279 aa] {ON} simil...    31   3.0  
SAKL0A04752g Chr1 (434100..435749) [1650 bp, 549 aa] {ON} simila...    30   4.7  
Ecym_7020 Chr7 complement(37877..39115) [1239 bp, 412 aa] {ON} s...    30   5.9  
KNAG0C04200 Chr3 complement(820365..823352) [2988 bp, 995 aa] {O...    30   5.9  
TBLA0I02920 Chr9 complement(693705..697718) [4014 bp, 1337 aa] {...    30   6.9  

>TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON}
           Anc_6.65 YOR174W
          Length = 220

 Score =  377 bits (968), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 192/220 (87%), Positives = 192/220 (87%)

Query: 1   MSQVYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQ 60
           MSQVYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQ
Sbjct: 1   MSQVYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQ 60

Query: 61  RLDRESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYAT 120
           RLDRESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYAT
Sbjct: 61  RLDRESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYAT 120

Query: 121 KLSKFTKAPAGVAVGPNNFVWPAEDALRRGQLAVAALHSEEITLGSTGERXXXXXXXXXX 180
           KLSKFTKAPAGVAVGPNNFVWPAEDALRRGQLAVAALHSEEITLGSTGER          
Sbjct: 121 KLSKFTKAPAGVAVGPNNFVWPAEDALRRGQLAVAALHSEEITLGSTGERSGSVESSEPV 180

Query: 181 XXXXXXXXRKYEPRRVEPAKEEASESPVXXXXXXXXXXEF 220
                   RKYEPRRVEPAKEEASESPV          EF
Sbjct: 181 QPSESAEPRKYEPRRVEPAKEEASESPVDLDLDLFDPDEF 220

>ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 295

 Score =  219 bits (559), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 125/164 (76%), Gaps = 3/164 (1%)

Query: 3   QVYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRL 62
           Q+Y DLT+YEE L  LVESVD F+PD+    EL+E D++L KSLD F  YD +D EL RL
Sbjct: 47  QIYADLTQYEEKLAALVESVDNFKPDVKIVHELIEVDKSLYKSLDSFAEYDRIDSELNRL 106

Query: 63  DRESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKL 122
           D+ES  L+R T   LETL ECY  L+ LPMLEQV+FE++ +L+QR +VNS+VLL YATKL
Sbjct: 107 DKESNELDRKTKEVLETLSECYEMLNGLPMLEQVEFEKQSILKQRSKVNSSVLLNYATKL 166

Query: 123 SKFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEEIT 163
           SKFTK P       +GPNNFVWPAEDALRRG LA+A+LHS+E+T
Sbjct: 167 SKFTKIPPTFDKGTIGPNNFVWPAEDALRRGMLAIASLHSKEMT 210

>Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W
           (REAL)
          Length = 288

 Score =  200 bits (508), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 88/164 (53%), Positives = 126/164 (76%), Gaps = 3/164 (1%)

Query: 3   QVYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRL 62
           Q+Y DL RYE+ L +LVESVD+F+PD+  AR+L++ D +L  ++D    YD +D+ L+++
Sbjct: 41  QLYEDLCRYEDTLKKLVESVDRFKPDIDVARDLIKIDESLFNNVDLLSEYDNIDRNLRKI 100

Query: 63  DRESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKL 122
           D++SE L+  T R LE ++EC+  L ALPMLEQV+FE+  +L+QR ++NS  LL+YATKL
Sbjct: 101 DKDSEELDSKTKRILEIMNECHDELGALPMLEQVEFEKNTILQQRSKINSTALLDYATKL 160

Query: 123 SKFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEEIT 163
           SKFT+ P      ++GPNNF+WPAEDALRRG LA+A+LHS+E+T
Sbjct: 161 SKFTRIPPTFDKGSIGPNNFIWPAEDALRRGMLAMASLHSKELT 204

>Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W
           (REAL)
          Length = 287

 Score =  199 bits (505), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 127/164 (77%), Gaps = 3/164 (1%)

Query: 3   QVYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRL 62
           Q+Y DL RYE+ LG+LVESVD+F+P+L  A++L++ D +L  ++     YD++D  L+++
Sbjct: 41  QLYEDLCRYEDILGKLVESVDRFKPNLEIAKDLIKTDESLFNNVKLLADYDKIDLNLRKI 100

Query: 63  DRESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKL 122
           D++SE L+  T + LE L+EC+  LSALPMLEQV+FE++ +L+QR ++NS  LL+YATKL
Sbjct: 101 DKDSEELDSKTRKILEILNECHDELSALPMLEQVEFEKKTILQQRSKINSTALLDYATKL 160

Query: 123 SKFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEEIT 163
           SKFT+ P       VGPNNF+WPAEDALRRG LA+A+LHS+E+T
Sbjct: 161 SKFTRIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHSKELT 204

>NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65
           YOR174W
          Length = 281

 Score =  198 bits (503), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 90/164 (54%), Positives = 124/164 (75%), Gaps = 3/164 (1%)

Query: 3   QVYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRL 62
           Q+Y DL  YE+ L  LV SVD+F+PD++ AREL+E DR L ++LD F  YD++D  L++L
Sbjct: 45  QIYSDLCSYEQKLANLVNSVDKFKPDMNAARELIEVDRHLFQTLDSFEEYDKIDNSLKKL 104

Query: 63  DRESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKL 122
           + ES  L+  T   L  L+EC+  L+ALPML+QV+FE   +L+QR ++NS+VLL+YATKL
Sbjct: 105 NAESIELDARTKEILGILNECHDELNALPMLKQVEFEMETILQQRSKINSSVLLDYATKL 164

Query: 123 SKFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEEIT 163
           SKFTK P      ++GPNNF+WPAEDALRRG LA+A+LH++E+T
Sbjct: 165 SKFTKIPPTFDKGSIGPNNFIWPAEDALRRGMLALASLHADELT 208

>Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W
           (REAL)
          Length = 286

 Score =  196 bits (498), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 90/164 (54%), Positives = 122/164 (74%), Gaps = 3/164 (1%)

Query: 3   QVYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRL 62
           Q+Y DL RYE  L +LVESVD+F+PDL  AR+L+ AD +L  ++     YD +D+ LQ++
Sbjct: 41  QLYEDLCRYEGVLSKLVESVDRFKPDLDVARDLISADESLFNNVKLLADYDNIDRNLQKI 100

Query: 63  DRESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKL 122
           D++SE L+  + + LE L+EC+  LS LP LEQV+FE+  +L+QR ++NS  LL+YATKL
Sbjct: 101 DKDSEELDSKSRKILEILNECHDELSGLPTLEQVEFEKNTILQQRSKINSTALLDYATKL 160

Query: 123 SKFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEEIT 163
           SKFTK P       VGPNNF+WPAEDALRRG LA+A+LHS+E+T
Sbjct: 161 SKFTKIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHSKELT 204

>YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subunit
           of the RNA polymerase II mediator complex; associates
           with core polymerase subunits to form the RNA polymerase
           II holoenzyme; essential for transcriptional regulation
          Length = 284

 Score =  195 bits (495), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 90/164 (54%), Positives = 124/164 (75%), Gaps = 3/164 (1%)

Query: 3   QVYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRL 62
           Q+Y DL RYE+ L +LVESVD+F+P+L  A++L+  D AL +++     YD + + LQ++
Sbjct: 41  QLYEDLCRYEDTLSKLVESVDRFKPNLDIAKDLIRTDEALFENVKLLAEYDNIYRNLQKI 100

Query: 63  DRESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKL 122
           D++SE L+  T + LE L+EC+  L ALPMLEQV+FE+  +L+QR ++NS  LL+YATKL
Sbjct: 101 DKDSEELDSKTRKILEILNECHDELKALPMLEQVEFEKNTILQQRSKINSTELLDYATKL 160

Query: 123 SKFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEEIT 163
           SKFTK P      AVGPNNF+WPAEDALRRG LA+A+LHS+E+T
Sbjct: 161 SKFTKIPPTFDKGAVGPNNFIWPAEDALRRGMLAMASLHSKELT 204

>Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON}
           (21260..22138) [879 nt, 293 aa]
          Length = 292

 Score =  192 bits (489), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 123/164 (75%), Gaps = 3/164 (1%)

Query: 3   QVYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRL 62
           Q+Y D++ YE  L +LVESVD+F+PD+  A +L++ D  L KSLD F  YD++  +L+  
Sbjct: 46  QIYNDISEYENTLFKLVESVDKFKPDVKLAHQLIDVDERLFKSLDSFVEYDKISTKLEEC 105

Query: 63  DRESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKL 122
           D+E+  L+  T   L TL+EC+  L++LPMLEQV+FE+  +L+QR ++NS +LL+YATKL
Sbjct: 106 DKEAAELDTKTKEILGTLNECHGLLNSLPMLEQVEFEKDIILKQRSKINSKLLLDYATKL 165

Query: 123 SKFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEEIT 163
           SKFTK P      ++GPNNF+WPAEDALRRG LA+A+LHS+E+T
Sbjct: 166 SKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAMASLHSKELT 209

>TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65
           YOR174W
          Length = 318

 Score =  186 bits (473), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 87/172 (50%), Positives = 125/172 (72%), Gaps = 5/172 (2%)

Query: 3   QVYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRL 62
           Q Y DL +YEE L +L  SVD+++PDL  A +L++ DR L  +LD F  YDE+  +L++L
Sbjct: 41  QTYNDLIQYEETLSKLSSSVDKYKPDLQYAYDLIDIDRKLYSTLDSFVKYDEISTKLKKL 100

Query: 63  DRESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKL 122
           + +++ L+  T   L++L++C+  L+ LPMLEQV+FE+  +L+QR ++NS VLL+YATKL
Sbjct: 101 EIDTKALDEKTKSVLDSLNDCHELLNTLPMLEQVEFEKNTMLKQREKINSKVLLDYATKL 160

Query: 123 SKFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEEITL--GSTGE 169
           +KFTK P       +GPNNF+WPAEDALRRG LAVA+ H+EE+T   GS G+
Sbjct: 161 AKFTKIPPTFNKNTLGPNNFIWPAEDALRRGMLAVASAHTEELTALPGSVGD 212

>NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {ON}
           Anc_6.65 YOR174W
          Length = 334

 Score =  184 bits (468), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 124/163 (76%), Gaps = 3/163 (1%)

Query: 4   VYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRLD 63
           +Y D+  YE+AL RL++SVD+F+P+L+ A+EL++AD++L  +L+ F  YDE+D  L+ L+
Sbjct: 81  IYDDIITYEKALSRLIDSVDKFKPNLNIAQELIQADKSLFDTLNSFIQYDEIDLHLKALE 140

Query: 64  RESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKLS 123
            ++ +++  T  TL+TL+EC+  L+ LP L Q++FE   +L QR ++NS +LL+YATKLS
Sbjct: 141 TKASKIDELTQSTLQTLNECHDDLNKLPTLPQIEFELNTILNQRTKINSTILLDYATKLS 200

Query: 124 KFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEEIT 163
           KFTK P      ++GPNNF+WPAED+LRRG LA+A+L ++++T
Sbjct: 201 KFTKIPPTFDKGSIGPNNFIWPAEDSLRRGMLAMASLKADQLT 243

>KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON}
           Anc_6.65 YOR174W
          Length = 289

 Score =  182 bits (463), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 83/163 (50%), Positives = 116/163 (71%), Gaps = 3/163 (1%)

Query: 4   VYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRLD 63
           +Y DL++YEE L RL++S+D ++PD   A+EL++ D  L  SLD F  YD +   L+  +
Sbjct: 46  IYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDIDSKLFNSLDSFVQYDRISSRLKDFE 105

Query: 64  RESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKLS 123
           ++ +     T   LETL+EC+ AL+ LP ++QV FE   +LEQR ++NS+VLL+YATKLS
Sbjct: 106 KQEKESTLKTKEILETLNECHNALNLLPTVDQVHFEMNTMLEQRKKINSSVLLDYATKLS 165

Query: 124 KFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEEIT 163
           KFTK P      ++GPNNFVWPAEDALRRG LA+AA H++E+T
Sbjct: 166 KFTKIPPTFDKGSIGPNNFVWPAEDALRRGMLALAASHTDELT 208

>AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR174W (MED4)
          Length = 294

 Score =  181 bits (458), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 86/163 (52%), Positives = 121/163 (74%), Gaps = 3/163 (1%)

Query: 4   VYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRLD 63
           +Y DL +YEE+L RLV SVD+F+PDL  A+EL+E D  L  +L +   YD +D +L++L+
Sbjct: 52  IYEDLCQYEESLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDLIDSQLKKLE 111

Query: 64  RESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKLS 123
            ES+ ++  TA+ L  L ECY  L++LPM+EQV+FE   + +Q+ +VNS+VLLEYA KLS
Sbjct: 112 EESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSVLLEYAMKLS 171

Query: 124 KFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEEIT 163
           KFT+ P      A+GPNNF+WPAEDA+RRG LA+A+L S+E+T
Sbjct: 172 KFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSKELT 214

>CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174w MED4
          Length = 264

 Score =  178 bits (452), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 118/164 (71%), Gaps = 3/164 (1%)

Query: 3   QVYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRL 62
           Q+Y DL  YEEAL +LV+SVD F+P L   ++L+EAD+ L  +LD    YD V   L+ L
Sbjct: 21  QLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKLYSTLDLLPQYDSVFTRLRTL 80

Query: 63  DRESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKL 122
           D E  ++++ T   L  L+EC+  L+ALP+LE+V+FE++ +L+QR ++ S VLLEYATKL
Sbjct: 81  DDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKMILKQREKIKSNVLLEYATKL 140

Query: 123 SKFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEEIT 163
           +KFTK P       +GPNNF+WPAEDALR+G LA+A+LH +E+T
Sbjct: 141 AKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHGKELT 184

>KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {ON}
           Anc_6.65 YOR174W
          Length = 279

 Score =  178 bits (451), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 116/164 (70%), Gaps = 3/164 (1%)

Query: 3   QVYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRL 62
           ++Y  +  YE+ L  LVESVD ++PD++ A+ LV+AD+ L  SLDKF  YDE+   L  L
Sbjct: 44  RIYSGIVEYEDTLAALVESVDSYKPDMAVAQRLVDADKELFASLDKFKEYDEISTRLGEL 103

Query: 63  DRESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKL 122
             +S  L+  T   LE L+EC+  L+ LP LEQV+FE   +LEQR ++NS+ LL+YATKL
Sbjct: 104 KGKSTALDTKTRDILEKLNECHDELNKLPYLEQVQFEMDTILEQREKINSSELLDYATKL 163

Query: 123 SKFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEEIT 163
           SKFT+ P      ++GPNNF+WPAEDALR+G LA+AALHS E+T
Sbjct: 164 SKFTRIPPTFDKGSIGPNNFIWPAEDALRKGMLAIAALHSRELT 207

>SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {ON}
           similar to gnl|GLV|KLLA0F20185g Kluyveromyces lactis
           KLLA0F20185g and weakly similar to YOR174W
           uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 299

 Score =  178 bits (452), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 122/164 (74%), Gaps = 3/164 (1%)

Query: 3   QVYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRL 62
           +VY D+  YEE LG+LV SVD+F+PDL  A+EL+E D+ L K+L++F  YD++D  L  L
Sbjct: 48  EVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKIDGRLNDL 107

Query: 63  DRESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKL 122
           +++S+ +++ T++ LE L+ C+  L++LP LEQV  E+  +L+QR ++ S VLL+YA KL
Sbjct: 108 EKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVLLDYAMKL 167

Query: 123 SKFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEEIT 163
           +KFT+ P       VGPNNF+WPAEDA+RRG LA+A+L S+E+T
Sbjct: 168 AKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELT 211

>KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa]
           {ON} similar to uniprot|Q12343 Saccharomyces cerevisiae
           YOR174W MED4 Member of RNA Polymerase II transcriptional
           regulation mediator Stoichiometric member of mediator
           complex
          Length = 285

 Score =  175 bits (443), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 79/166 (47%), Positives = 123/166 (74%), Gaps = 3/166 (1%)

Query: 4   VYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRLD 63
           +Y DL RYEE + +L +SVD F+PDLS   +++E D+ L ++L++F  Y ++++EL RLD
Sbjct: 37  IYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDKKLYETLEEFDEYYKIEEELSRLD 96

Query: 64  RESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKLS 123
           +E + ++  T   LETL+ CY +L+ LPMLEQV+FEQ+ +L+QR +++S V+L+YA KL+
Sbjct: 97  KEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQKVMLKQREKIHSKVVLDYAMKLA 156

Query: 124 KFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEEITLGS 166
           KFT+ P       +GPNNF+WPAED+LR+G LA+A+L  +E+ L +
Sbjct: 157 KFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMASLKKKELLLDA 202

>Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W
           (MED4) - Stoichiometric member of mediator complex
           [contig 183] FULL
          Length = 256

 Score =  174 bits (441), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 84/163 (51%), Positives = 113/163 (69%), Gaps = 3/163 (1%)

Query: 2   SQVYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQR 61
           +Q+Y D+  +EE LG+LV SVD+F PDL  A  L+E D+ L K+L+    YDE+D   + 
Sbjct: 25  AQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIEVDKRLSKTLESLPRYDEIDLRAKE 84

Query: 62  LDRESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATK 121
           LD++    +    R LETL EC   L+ALPMLEQV+FE++ +L+QR +V + VLL+YA K
Sbjct: 85  LDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFERQTMLKQREKVFTNVLLDYAMK 144

Query: 122 LSKFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEE 161
           L+KFT  P      AVGPNNFVWPAEDA+RRG LA+A+L + E
Sbjct: 145 LAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAIASLQASE 187

>KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa]
           {ON} some similarities with uniprot|Q12343 Saccharomyces
           cerevisiae YOR174W MED4 Member of RNA Polymerase II
           transcriptional regulation mediator Stoichiometric
           member of mediator complex
          Length = 263

 Score =  174 bits (441), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 112/162 (69%), Gaps = 3/162 (1%)

Query: 3   QVYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRL 62
           QVY D+  +E+ LG+LV SVD+F PDL  AR L+EAD+ L KSL+    YDE+D   + L
Sbjct: 26  QVYNDICEFEDTLGKLVASVDRFNPDLELARALIEADKQLYKSLECLPKYDEIDTRAKTL 85

Query: 63  DRESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKL 122
           D E    +  T R LETL EC   L+ALPMLEQV+FE+  +L+QR +V + VLL+YA KL
Sbjct: 86  DEEHRDTDEKTIRILETLTECGSDLNALPMLEQVEFERETMLKQREKVFTDVLLDYAMKL 145

Query: 123 SKFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEE 161
           +KFT  P       VGPNNFVWPAEDA+RRG LA+A+L + E
Sbjct: 146 AKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAIASLRASE 187

>TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65
           YOR174W
          Length = 306

 Score =  175 bits (443), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 76/163 (46%), Positives = 116/163 (71%), Gaps = 3/163 (1%)

Query: 4   VYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRLD 63
           +Y D+  YE+ L +LV S+D FRPD+  A+ L+E D+ L K+L  F  YDE+D ++ ++ 
Sbjct: 62  IYNDIKNYEDTLIKLVSSIDNFRPDVEVAKTLIEVDKRLYKNLGSFKEYDEIDTKISKIK 121

Query: 64  RESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKLS 123
            +SE+L+  T   L+ L++    L++LPMLE++ FE+  + E++ ++NS +LL+YATK+S
Sbjct: 122 DDSEKLDLQTKHILDILNDSRNMLNSLPMLEEIYFERDVMHEKQKKINSKILLDYATKIS 181

Query: 124 KFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEEIT 163
           KFTK P      ++GPNNF+WPAEDALRRG LAVA++H  E+T
Sbjct: 182 KFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAVASIHRSELT 224

>Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON}
           similar to Ashbya gossypii AGR270W
          Length = 274

 Score =  168 bits (426), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 81/163 (49%), Positives = 119/163 (73%), Gaps = 3/163 (1%)

Query: 4   VYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRLD 63
           +Y DL ++EE L +LV SVD+F PDL  A++L+ +D  L  +L++  LYD +D +L++LD
Sbjct: 27  LYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYDSIDIQLKQLD 86

Query: 64  RESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKLS 123
            ES+ ++  T + L  LD+CY  L+ LPM+EQV+FE + + +Q+ ++ S VLLEYA KL+
Sbjct: 87  NESQEIDERTGKILSILDKCYNNLNKLPMVEQVEFEMKMMKKQKEKIKSGVLLEYAMKLA 146

Query: 124 KFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEEIT 163
           KFT+ P      A+GPNNF+WPAEDA+RRG LA+A+L SEE+T
Sbjct: 147 KFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELT 189

>CAGL0E01925g Chr5 complement(191834..193135) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|Q12463 Saccharomyces
           cerevisiae YOL124c
          Length = 433

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 2/60 (3%)

Query: 52  YDEVDKELQRLDRESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVN 111
           YDE+   +Q  D  +E   R+   T +   ECYR  S    + Q+  E    LE +G++N
Sbjct: 75  YDELHNSIQNGDHFNELKQRYQNDTFKFEFECYRGNSKANRVSQI--ESFGYLEFKGKIN 132

>SAKL0H23408g Chr8 (2027635..2028282) [648 bp, 215 aa] {ON} similar
           to uniprot|Q04272 Saccharomyces cerevisiae YMR077C VPS20
           vaculolar protein sorting (putative)
          Length = 215

 Score = 30.4 bits (67), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 8   LTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRLDRE 65
           LT+  E    + + +D  +  ++   E+   D AL  S+   GL DE+D+ELQ LD E
Sbjct: 114 LTKLNEEFRNVDDLLDNVQEQINYQEEI---DTALANSVVGGGLEDELDRELQALDNE 168

>KLTH0D07590g Chr4 (657085..660924) [3840 bp, 1279 aa] {ON} similar to
            uniprot|Q03690 Saccharomyces cerevisiae YMR012W
          Length = 1279

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/67 (22%), Positives = 35/67 (52%)

Query: 47   DKFGLYDEVDKELQRLDRESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQ 106
            D +   ++++  L+ +    E   R      ET  +C + ++++  L + + +QRK+ +Q
Sbjct: 1164 DLYATLNDLNGSLKAITEAREVFQRELGLNDETTAQCNQWVTSIEALMESQLQQRKLTQQ 1223

Query: 107  RGRVNSA 113
            +  VNS+
Sbjct: 1224 QSTVNSS 1230

>SAKL0A04752g Chr1 (434100..435749) [1650 bp, 549 aa] {ON} similar
           to uniprot|P20447 Saccharomyces cerevisiae YGL078C DBP3
           Putative ATP-dependent RNA helicase of the DEAD-box
           family involved in ribosomal biogenesis
          Length = 549

 Score = 30.0 bits (66), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 42/84 (50%), Gaps = 11/84 (13%)

Query: 16  GRLVESVDQFRPDLSCARELV--EADRALGKSLDKFGLYDEVDKELQRLDRESERLNRHT 73
           GRL++ + +   DLS    LV  EADR L K  ++         +++R+ RE++  NR T
Sbjct: 266 GRLLDLIQEGSVDLSHVNYLVLDEADRMLEKGFEE---------DIKRIIRETDARNRQT 316

Query: 74  ARTLETLDECYRALSALPMLEQVK 97
                T  +  R L++  M + VK
Sbjct: 317 LMFTATWPKEVRELASTFMNQPVK 340

>Ecym_7020 Chr7 complement(37877..39115) [1239 bp, 412 aa] {ON}
           similar to Ashbya gossypii AER106C
          Length = 412

 Score = 29.6 bits (65), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 40/93 (43%), Gaps = 12/93 (12%)

Query: 1   MSQVYGDLTRYEEALGR---LVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDK 57
           M ++ GD T+YEE L     + ES+  F+   SC ++       + K  +    YD    
Sbjct: 285 MVKILGDFTKYEEYLSVFQGVNESIANFKN--SCIQD-------IKKVQELCDFYDNFLN 335

Query: 58  ELQRLDRESERLNRHTARTLETLDECYRALSAL 90
             Q+L RE +R  +   R    L  C   L+ L
Sbjct: 336 SYQQLLREVDRRRKLAERMKSILQSCENQLAEL 368

>KNAG0C04200 Chr3 complement(820365..823352) [2988 bp, 995 aa] {ON}
           Anc_7.272 YIL073C
          Length = 995

 Score = 30.0 bits (66), Expect = 5.9,   Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 12  EEALGRLVESVD---QFRPDLSCARELVEADRALGKSLDKFGLYDEVDKE 58
           EE L +++ SVD    F   L CA+ELVE +  +G +   + L ++++ E
Sbjct: 358 EEVLMKMISSVDIAPNFAQVLECAKELVEVNIKMGATCLDYILSNKLEPE 407

>TBLA0I02920 Chr9 complement(693705..697718) [4014 bp, 1337 aa] {ON}
            Anc_4.240 YLR384C
          Length = 1337

 Score = 29.6 bits (65), Expect = 6.9,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 52/110 (47%), Gaps = 22/110 (20%)

Query: 9    TRYEE-----ALGRLVESVDQFRPDLS------CARELVEADRALGKSLDKF--GLYDEV 55
            T YEE     ++GRL+E +DQ RPD +      C R   E    + K+  +    L D V
Sbjct: 1236 TIYEEEYLVKSIGRLIERLDQTRPDAAKLIDGLCRRNKREQAYQIQKTFIEVLDLLKDNV 1295

Query: 56   DKELQRLDRESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLE 105
            ++     +++ ER+N +         E Y  +  +P+ E   FE+ K+++
Sbjct: 1296 EEIYTISEKDRERINEN--------GEIYY-IPEIPVPEIKDFEKNKIVD 1336

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 17,559,518
Number of extensions: 627487
Number of successful extensions: 1806
Number of sequences better than 10.0: 43
Number of HSP's gapped: 1786
Number of HSP's successfully gapped: 44
Length of query: 220
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 115
Effective length of database: 41,441,469
Effective search space: 4765768935
Effective search space used: 4765768935
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 63 (28.9 bits)