Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G023702.307ON74774736460.0
ZYRO0A02420g2.307ON74577520850.0
YDL122W (UBP1)2.307ON80973120230.0
Smik_4.1152.307ON79072620140.0
Suva_4.1252.307ON79373719900.0
Skud_4.1332.307ON78775519800.0
Kpol_1003.532.307ON78873319780.0
NCAS0B061302.307ON77073919430.0
CAGL0H10582g2.307ON79075119360.0
SAKL0E07106g2.307ON79177319220.0
Kwal_27.114442.307ON75775619160.0
KLTH0G10934g2.307ON75876418940.0
NDAI0B034302.307ON85672918590.0
TPHA0G008502.307ON78275118500.0
KAFR0A069102.307ON67870017630.0
AGR389C2.307ON77572017270.0
KNAG0A054502.307ON76476016460.0
KLLA0E08801g2.307ON77159114960.0
TBLA0B060802.307ON82455014500.0
TBLA0B071602.307ON3843468022e-99
NCAS0G036802.307ON4824053502e-34
NDAI0G007802.307ON4864543309e-32
Ecym_11668.540ON6964231387e-08
TBLA0H036008.540ON4822061351e-07
Skud_16.2098.540ON5031831314e-07
Smik_16.1638.540ON5011831315e-07
SAKL0H10076g8.540ON7671791291e-06
CAGL0G02563gsingletonON6311911243e-06
Suva_16.2408.540ON5231831243e-06
YPL072W (UBP16)8.540ON4991881217e-06
AEL242W8.540ON6134361182e-05
KAFR0E009308.540ON4981841145e-05
AFR551W8.742ON4691741136e-05
KLTH0E12540g8.540ON7521801129e-05
KLLA0E23387g8.540ON7821831121e-04
Kwal_27.120308.540ON7491771111e-04
NDAI0C059008.188ON826831083e-04
YBL067C (UBP13)7.390ON747991074e-04
Skud_4.3238.188ON926821074e-04
KNAG0F012202.69ON784771065e-04
Smik_13.4318.742ON471581056e-04
Skud_15.2865.443ON1278831066e-04
NCAS0G018002.69ON875671057e-04
NCAS0C021108.540ON4941651047e-04
NDAI0E028208.540ON4951911020.001
KNAG0D019308.188ON986781030.001
YMR223W (UBP8)8.742ON471581020.001
Skud_13.3928.742ON473581020.001
Smik_15.3015.443ON1272631020.001
Suva_13.4078.742ON471581010.002
YNL186W (UBP10)2.69ON792601000.002
ZYRO0A05962g8.742ON46558990.003
AFR296C5.712ON11692001000.003
KAFR0L017307.390ON70186990.003
NDAI0E008108.742ON49358980.003
YDR069C (DOA4)8.188ON92684990.004
YOR124C (UBP2)5.443ON127263990.004
CAGL0G05247g8.188ON94778990.004
Kwal_26.91518.742ON45478980.004
TPHA0C027708.188ON97078980.005
KLTH0H07678g8.188ON861291980.005
ZYRO0G01606g5.443ON130553970.006
CAGL0J11352g2.69ON77160970.006
SAKL0E13002g2.69ON73960970.006
Smik_14.1442.69ON76360970.007
TDEL0B036708.742ON46379960.007
Kwal_33.144302.69ON51165960.008
KAFR0A042108.742ON44060950.008
Skud_11.3385.712ON712419960.008
TBLA0B097602.69ON89860960.008
KLTH0B07150g2.69ON75660960.008
NDAI0E041807.390ON82770960.008
Smik_4.3078.188ON92982960.008
Suva_8.1765.443ON127063960.009
TBLA0D010708.742ON48379950.009
Kpol_1062.235.443ON126665950.010
Suva_14.1562.69ON78860940.012
Kpol_1044.242.69ON72460940.013
TDEL0D025805.443ON127265940.014
CAGL0M11198g8.742ON46176930.015
Ecym_45145.443ON124663940.016
Suva_2.2288.188ON92784930.016
Kwal_14.20088.188ON424291920.017
NDAI0F034102.69ON87060930.017
KAFR0A075802.69ON80260930.018
Ecym_62488.742ON46668920.019
Skud_14.1482.69ON77660920.024
NDAI0A036808.188ON111679920.027
KLTH0D12760g8.742ON453157910.027
TBLA0A064705.443ON132051910.031
NCAS0B042808.188ON92283910.032
Smik_11.3625.712ON721269910.034
NCAS0H021005.443ON126949910.034
Kpol_513.255.18ON119051910.035
Skud_2.387.390ON74868900.038
Smik_2.497.390ON74565900.041
KLLA0D08459g2.69ON75065900.041
KAFR0C025908.188ON97880900.042
NCAS0B005808.742ON46658890.042
TDEL0B020805.712ON1025277900.044
Suva_2.507.390ON75087890.046
KNAG0G029308.742ON45961890.049
KNAG0B041905.443ON126249890.060
SAKL0G02728g5.443ON123765890.061
ZYRO0G06798g8.188ON87779880.067
SAKL0H18986g8.188ON89382880.073
Skud_10.221.137ON125566880.073
ZYRO0C17908g1.137ON120463880.077
Smik_10.371.137ON124766880.078
ABL145W2.69ON74960870.081
TPHA0P006807.390ON72789870.086
Ecym_40095.712ON1517418870.089
NDAI0C015505.443ON129563870.091
Kpol_2001.785.712ON403194860.093
Kpol_1064.488.742ON46657860.10
Suva_6.2761.137ON125666870.10
TBLA0D006207.390ON117165870.11
SAKL0H04994g8.742ON45459860.11
CAGL0I06600g8.202ON81649860.12
ACL164C5.443ON138951860.12
Kwal_55.213935.443ON123351860.12
ZYRO0C09812g2.69ON70260860.13
CAGL0I06765g8.188ON88776860.13
NCAS0A039108.188ON79568860.14
KLLA0C06974g8.742ON44658850.14
Kpol_1032.288.188ON88282850.14
TDEL0B030608.540ON734172850.15
TPHA0O016402.69ON74659850.15
KLTH0F15862g5.443ON124151850.16
TDEL0A011002.69ON66160850.17
CAGL0H05335g8.540ON48323840.18
NDAI0I025305.18ON119771850.19
TBLA0F036108.188ON114479840.20
TBLA0C070205.18ON124751840.21
YJL197W (UBP12)1.137ON125466840.22
KNAG0C019401.369ON49973830.25
Suva_13.4955.18ON123071830.26
AGR370W7.390ON74094830.26
KAFR0I026005.18ON121350830.27
ZYRO0D07062g5.18ON119351830.27
TDEL0B042208.188ON82579830.30
YBR058C (UBP14)3.270ON78145820.34
Kwal_33.136281.137ON116054820.36
Skud_13.4785.18ON123172820.36
Smik_7.3141.369ON49973810.37
YFR010W (UBP6)1.369ON49973810.37
TDEL0C056401.137ON117838820.38
ZYRO0D03982g8.540ON821197820.40
KLLA0E02377g5.443ON122067820.41
TPHA0E017105.443ON128351820.41
NCAS0D006001.369ON49373810.41
AGL357W5.18ON116660820.42
Kpol_1024.448.540ON496200810.42
Klac_YGOB_Anc_5.18b5.18ON116650810.44
KAFR0C045201.369ON49973800.48
NCAS0D023905.18ON121147810.50
Kpol_1045.417.390ON71265810.50
KNAG0C035807.390ON776107810.51
Skud_2.1773.270ON78239800.58
Smik_13.5215.18ON123172800.61
NCAS0G001705.712ON1030203800.65
Smik_5.3098.188ON80531790.71
KLTH0B09944g5.18ON118951790.85
YMR304W (UBP15)5.18ON123050790.88
KAFR0D050705.443ON122743790.96
Kwal_27.119458.518ON583144780.98
Ecym_61848.188ON85157781.1
Suva_5.2728.188ON78870781.1
YKR098C (UBP11)5.712ON717189781.1
KNAG0G015908.188ON67158771.2
Skud_5.2818.188ON82370771.2
Suva_4.2953.270ON78221771.3
KLLA0E10275g8.188ON79674771.3
AFR007W8.188ON84827771.3
KLTH0F03674g1.137ON1198110771.3
Smik_2.1893.270ON78221771.4
KAFR0C004103.270ON76923771.4
CAGL0H10186g3.270ON77853771.5
KAFR0H001505.712ON656192761.6
TPHA0G005608.742ON46357761.7
KNAG0A019708.540ON47196761.7
CAGL0H06721g5.712ON108126761.7
KLLA0C03476g1.137ON125230752.3
NCAS0I031401.137ON120121752.4
Skud_6.941.369ON49954752.5
KNAG0J008003.270ON76562752.7
KLTH0E00814g5.712ON974268752.7
TDEL0G004105.18ON118651752.7
Kpol_534.231.369ON49618742.9
TPHA0D043508.202ON85428743.0
SAKL0E03938g2.432ON76788743.0
Ecym_56715.18ON117684743.2
TDEL0D035503.270ON78033743.3
Kpol_1018.937.390ON75532743.5
TPHA0J026205.443ON122554743.6
AGR023C3.270ON78021733.6
Suva_11.3355.712ON724193734.3
TBLA0J006001.137ON146218734.4
Ecym_46857.390ON77831734.7
TPHA0L022905.18ON119347725.2
Kwal_56.238448.303ON149456725.3
NCAS0A143707.390ON72979725.9
TPHA0H026007.93ON45826716.0
KAFR0D021605.712ON84672726.2
TPHA0L016708.540ON52434716.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G02370
         (747 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.3...  1409   0.0  
ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} simila...   807   0.0  
YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}  UBP1Ubiqui...   783   0.0  
Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W ...   780   0.0  
Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W ...   771   0.0  
Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W ...   767   0.0  
Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON} (1216...   766   0.0  
NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] ...   753   0.0  
CAGL0H10582g Chr8 complement(1029876..1032248) [2373 bp, 790 aa]...   750   0.0  
SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {...   744   0.0  
Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {...   742   0.0  
KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} simila...   734   0.0  
NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}    720   0.0  
TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.3...   717   0.0  
KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] ...   683   0.0  
AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}...   669   0.0  
KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.3...   638   0.0  
KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} simila...   580   0.0  
TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2...   563   0.0  
TBLA0B07160 Chr2 complement(1696047..1697201) [1155 bp, 384 aa] ...   313   2e-99
NCAS0G03680 Chr7 complement(682617..684065) [1449 bp, 482 aa] {O...   139   2e-34
NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON}              131   9e-32
Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar t...    58   7e-08
TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {O...    57   1e-07
Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072...    55   4e-07
Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072...    55   5e-07
SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} simila...    54   1e-06
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...    52   3e-06
Suva_16.240 Chr16 (429066..430637) [1572 bp, 523 aa] {ON} YPL072...    52   3e-06
YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}  UBP16Deub...    51   7e-06
AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic ho...    50   2e-05
KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.5...    49   5e-05
AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic ...    48   6e-05
KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa]...    48   9e-05
KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa]...    48   1e-04
Kwal_27.12030 s27 complement(1056215..1058464) [2250 bp, 749 aa]...    47   1e-04
NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa] ...    46   3e-04
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    46   4e-04
Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON...    46   4e-04
KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.6...    45   5e-04
Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223...    45   6e-04
Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] ...    45   6e-04
NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69      45   7e-04
NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.5...    45   7e-04
NDAI0E02820 Chr5 (598119..599606) [1488 bp, 495 aa] {ON} Anc_8.5...    44   0.001
KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.1...    44   0.001
YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}  UBP8Ubiqu...    44   0.001
Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223...    44   0.001
Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] ...    44   0.001
Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223...    44   0.002
YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}  UBP10Ubiq...    43   0.002
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    43   0.003
AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...    43   0.003
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    43   0.003
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    42   0.003
YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}  ...    43   0.004
YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}...    43   0.004
CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {...    43   0.004
Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] ...    42   0.004
TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.1...    42   0.005
KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} simila...    42   0.005
ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...    42   0.006
CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa...    42   0.006
SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]...    42   0.006
Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186...    42   0.007
TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {O...    42   0.007
Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186...    42   0.008
KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.7...    41   0.008
Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {...    42   0.008
TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] ...    42   0.008
KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {...    42   0.008
NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {O...    42   0.008
Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON...    42   0.008
Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...    42   0.009
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    41   0.009
Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON} (51365...    41   0.010
Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186...    41   0.012
Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON} (56564....    41   0.013
TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5....    41   0.014
CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} sim...    40   0.015
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...    41   0.016
Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON...    40   0.016
Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C...    40   0.017
NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {O...    40   0.017
KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] ...    40   0.018
Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar t...    40   0.019
Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186...    40   0.024
NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON}              40   0.027
KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} simi...    40   0.027
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...    40   0.031
NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188     40   0.032
Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {...    40   0.034
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...    40   0.034
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    40   0.035
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    39   0.038
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    39   0.041
KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {...    39   0.041
KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {O...    39   0.042
NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742       39   0.042
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....    39   0.044
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    39   0.046
KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.7...    39   0.049
KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5....    39   0.060
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...    39   0.061
ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some s...    39   0.067
SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} simi...    39   0.073
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    39   0.073
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    39   0.077
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    39   0.078
ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic ho...    38   0.081
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    38   0.086
Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to...    38   0.089
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....    38   0.091
Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa] ...    38   0.093
Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON} (88495....    38   0.10 
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    38   0.10 
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    38   0.11 
SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {...    38   0.11 
CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} simila...    38   0.12 
ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON} Sy...    38   0.12 
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...    38   0.12 
ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {...    38   0.13 
CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} simila...    38   0.13 
NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188     38   0.14 
KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {...    37   0.14 
Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {O...    37   0.14 
TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.5...    37   0.15 
TPHA0O01640 Chr15 complement(325844..328084) [2241 bp, 746 aa] {...    37   0.15 
KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} sim...    37   0.16 
TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.6...    37   0.17 
CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {...    37   0.18 
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    37   0.19 
TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8....    37   0.20 
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    37   0.21 
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    37   0.22 
KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {O...    37   0.25 
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    37   0.26 
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    37   0.26 
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    37   0.27 
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    37   0.27 
TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.1...    37   0.30 
YBR058C Chr2 complement(353672..356017) [2346 bp, 781 aa] {ON}  ...    36   0.34 
Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL19...    36   0.36 
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    36   0.36 
Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W ...    36   0.37 
YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}  UBP6Ubiqui...    36   0.37 
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    36   0.38 
ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly...    36   0.40 
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...    36   0.41 
TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....    36   0.41 
NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.3...    36   0.41 
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    36   0.42 
Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON} (1180...    36   0.42 
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    36   0.44 
KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500...    35   0.48 
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    36   0.50 
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    36   0.50 
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    36   0.51 
Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON...    35   0.58 
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    35   0.61 
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712      35   0.65 
Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON...    35   0.71 
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    35   0.85 
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    35   0.88 
KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {...    35   0.96 
Kwal_27.11945 s27 (1012266..1014017) [1752 bp, 583 aa] {ON} YBR1...    35   0.98 
Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar t...    35   1.1  
Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON...    35   1.1  
YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON} ...    35   1.1  
KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {O...    34   1.2  
Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON...    34   1.2  
Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON...    34   1.3  
KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} simila...    34   1.3  
AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic ho...    34   1.3  
KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} simil...    34   1.3  
Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON...    34   1.4  
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    34   1.4  
CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {...    34   1.5  
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...    34   1.6  
TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {O...    34   1.7  
KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.5...    34   1.7  
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...    34   1.7  
KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} simil...    33   2.3  
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    33   2.4  
Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}...    33   2.5  
KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {...    33   2.7  
KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...    33   2.7  
TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON...    33   2.7  
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    33   2.9  
TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {O...    33   3.0  
SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} simila...    33   3.0  
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    33   3.2  
TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.2...    33   3.3  
Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON} (2480...    33   3.5  
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...    33   3.6  
AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON} S...    33   3.6  
Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {...    33   4.3  
TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1...    33   4.4  
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    33   4.7  
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    32   5.2  
Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] ...    32   5.3  
NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7...    32   5.9  
TPHA0H02600 Chr8 (607962..609338) [1377 bp, 458 aa] {ON} Anc_7.9...    32   6.0  
KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.7...    32   6.2  
TPHA0L01670 Chr12 complement(351116..352690) [1575 bp, 524 aa] {...    32   6.2  

>TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.307
           YDL122W
          Length = 747

 Score = 1409 bits (3646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 688/747 (92%), Positives = 688/747 (92%)

Query: 1   MSFILETLQRKIISFIIEPLNRNTNSEVPITTAIILVSTAFFFIKYKSFIMNNLSHIGDM 60
           MSFILETLQRKIISFIIEPLNRNTNSEVPITTAIILVSTAFFFIKYKSFIMNNLSHIGDM
Sbjct: 1   MSFILETLQRKIISFIIEPLNRNTNSEVPITTAIILVSTAFFFIKYKSFIMNNLSHIGDM 60

Query: 61  TRNFNPTNGFRRWMPRGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           TRNFNPTNGFRRWMPRGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL
Sbjct: 61  TRNFNPTNGFRRWMPRGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120

Query: 121 XXXXXXXXXXXXXXLLQDEEKPTSVEPDTIERXXXXXXXXXXXXHANRKLANGVSDEEKT 180
                         LLQDEEKPTSVEPDTIER            HANRKLANGVSDEEKT
Sbjct: 121 DDEIAKKEEIDETELLQDEEKPTSVEPDTIERKVKGKSYGKAKKHANRKLANGVSDEEKT 180

Query: 181 PDVTFSLALREMLNKLNTKYYKERPCFKTNKLLKSMTKSPNKNIILGYDQEDAQEFFQTI 240
           PDVTFSLALREMLNKLNTKYYKERPCFKTNKLLKSMTKSPNKNIILGYDQEDAQEFFQTI
Sbjct: 181 PDVTFSLALREMLNKLNTKYYKERPCFKTNKLLKSMTKSPNKNIILGYDQEDAQEFFQTI 240

Query: 241 LSELEKNVKSLEGKPSEATPIPNAELPKNAVIGQAHLDKVGDVYLPSDQIDPNLVLTNEG 300
           LSELEKNVKSLEGKPSEATPIPNAELPKNAVIGQAHLDKVGDVYLPSDQIDPNLVLTNEG
Sbjct: 241 LSELEKNVKSLEGKPSEATPIPNAELPKNAVIGQAHLDKVGDVYLPSDQIDPNLVLTNEG 300

Query: 301 KQLYTPFRLVTPLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLLN 360
           KQLYTPFRLVTPLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLLN
Sbjct: 301 KQLYTPFRLVTPLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLLN 360

Query: 361 QWIKPEIIEGVSCNRCALEAVRDHLLEQLKQYENKGDSIPEKLLQAFKARVEELNVSLSK 420
           QWIKPEIIEGVSCNRCALEAVRDHLLEQLKQYENKGDSIPEKLLQAFKARVEELNVSLSK
Sbjct: 361 QWIKPEIIEGVSCNRCALEAVRDHLLEQLKQYENKGDSIPEKLLQAFKARVEELNVSLSK 420

Query: 421 PMVSDEDYKRLHTENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVLF 480
           PMVSDEDYKRLHTENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVLF
Sbjct: 421 PMVSDEDYKRLHTENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVLF 480

Query: 481 KSRLNLSPWCCDVDEINLDARLPMSKKQEQVQESSEDENLGGEYYAKLHQTYXXXXXXXX 540
           KSRLNLSPWCCDVDEINLDARLPMSKKQEQVQESSEDENLGGEYYAKLHQTY        
Sbjct: 481 KSRLNLSPWCCDVDEINLDARLPMSKKQEQVQESSEDENLGGEYYAKLHQTYEKEFEDSD 540

Query: 541 XXXXXXGDRYVNRDVSEYDPLNGEIDSVSSYSDNEDAHHSSEEFLEEVDALGNTVTKKVA 600
                 GDRYVNRDVSEYDPLNGEIDSVSSYSDNEDAHHSSEEFLEEVDALGNTVTKKVA
Sbjct: 541 EEVEQDGDRYVNRDVSEYDPLNGEIDSVSSYSDNEDAHHSSEEFLEEVDALGNTVTKKVA 600

Query: 601 KLQSHFGDEDGVEVEIKXXXXXXXXXXXXXXXXXXXIMPPPVNTAPIPSTVPAGPLTYVL 660
           KLQSHFGDEDGVEVEIK                   IMPPPVNTAPIPSTVPAGPLTYVL
Sbjct: 601 KLQSHFGDEDGVEVEIKENGAEELSSSESEGEQEDGIMPPPVNTAPIPSTVPAGPLTYVL 660

Query: 661 RSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVEEAEVLSTSGVFMLFYEYDYDEAT 720
           RSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVEEAEVLSTSGVFMLFYEYDYDEAT
Sbjct: 661 RSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVEEAEVLSTSGVFMLFYEYDYDEAT 720

Query: 721 GKMREDLESDLEDENQEEDEKLDGEIE 747
           GKMREDLESDLEDENQEEDEKLDGEIE
Sbjct: 721 GKMREDLESDLEDENQEEDEKLDGEIE 747

>ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} similar
           to uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
           Ubiquitin-specific protease that removes ubiquitin from
           ubiquitinated proteins cleaves at the C terminus of
           ubiquitin fusions irrespective of their size capable of
           cleaving polyubiquitin chains
          Length = 745

 Score =  807 bits (2085), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/775 (53%), Positives = 528/775 (68%), Gaps = 61/775 (7%)

Query: 1   MSFILETLQRKIISFIIEPLNRNTNSEVPITTAIILVSTAFFFIKYKSFIMNNLSHIGDM 60
           MSF+L  + +KI SFI    N N  + +PI   I+++STAF F+K K     + S++GD+
Sbjct: 1   MSFVLGPIVQKISSFIS---NNNNKTSIPIALGIVILSTAFLFLKSKK----HNSNVGDI 53

Query: 61  TRNFNPTNGFRRWMPRGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
            R     +GFRRWMPR GQ++   L +GG + GLVNDGNTCFMN V+QS+ASS EL+KFL
Sbjct: 54  ARGMTSKSGFRRWMPRSGQMENEVLKRGGNIGGLVNDGNTCFMNCVLQSMASSKELLKFL 113

Query: 121 XXXXXXXXXXXXXXLLQDE---EKPTSVEPDTIERXXXXXXXXXXXXHANRKLANGVSDE 177
                            D+   EKP +                       ++     S+ 
Sbjct: 114 DEEIACKAKLDEDQSNGDDVNNEKPHNT-----------------SKQQQKREEEAKSEG 156

Query: 178 EKTPDVTFSLALREMLNKLNTKYYKERPCFKTNKLLKSMTKSPNKNIILGYDQEDAQEFF 237
           E  PDVTFS AL+E+L+KLN KYY++RP FK NKLLKSM+K+PNKNI+LGYDQEDAQEFF
Sbjct: 157 ETVPDVTFSAALKELLDKLNAKYYRDRPYFKANKLLKSMSKAPNKNILLGYDQEDAQEFF 216

Query: 238 QTILSELEKNVKSLEGKPSEATPIPNAELPKNAVIGQAHLDKVGDVYLPSDQIDPNLVLT 297
           QT+LSELEKN KSL+    +   I   +LP+ AVIGQA LD VG VY+P++Q+ PNL+  
Sbjct: 217 QTMLSELEKNAKSLDNTTIDKHAILEKDLPETAVIGQARLDHVGAVYIPTEQVTPNLIPP 276

Query: 298 NEGKQLYTPFRLVTPLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSD 357
              ++ +T F+L+TPLDGI AERIGCLQCGE GGIRYSV+S +SLNLPS+++GS+LKLSD
Sbjct: 277 GSKEKYFTKFKLITPLDGILAERIGCLQCGETGGIRYSVSSGLSLNLPSDNMGSSLKLSD 336

Query: 358 LLNQWIKPEIIEGVSCNRCALEAVRDHLLEQLKQYEN-KGDSIPEKLLQAFKARVEELNV 416
           LL  +IKPEIIEGV CNRCAL AVRDHL EQL+QYE+ K ++IP KL QAF++R++EL  
Sbjct: 337 LLKDYIKPEIIEGVECNRCALIAVRDHLKEQLQQYEDKKANAIPAKLCQAFQSRIQELEK 396

Query: 417 SLSKPMVSDEDYKRLHTENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNS 476
            LSKP++ DE+YK+LHTENM RK SKSKQ+L  RPPPLL+IHINRSVFDPRT+MIRKNN+
Sbjct: 397 VLSKPVIDDEEYKKLHTENMVRKSSKSKQVLISRPPPLLAIHINRSVFDPRTFMIRKNNA 456

Query: 477 RVLFKSRLNLSPWCCDVDEINLDARLPMSKKQEQVQESSEDENLGGEYYAKLHQTYXXXX 536
           RVLFKSRLNLSPWCCD+DEIN+DAR+PMS+K+E + +SSEDEN+GGE+Y KLHQ Y    
Sbjct: 457 RVLFKSRLNLSPWCCDIDEINMDARMPMSQKEEVIMDSSEDENVGGEFYTKLHQKYEREF 516

Query: 537 XXXXXXXXXXGDRYVNRDVSEYDPLNGEIDSVSSYSDNEDAHHSSEEFLEEVDALGNTVT 596
                          ++ VS YDPL G+ +S+SSYSD E+++ S  +++E+ DALGNT+ 
Sbjct: 517 EDSDEDSDQPIGSSDDKLVSNYDPLGGDGNSLSSYSDEEESNES--DYIEKTDALGNTIR 574

Query: 597 KKVAKLQSHFGDEDGVEVEIKXXXXXXX----------XXXXXXXXXXXXIMPPPVNT-- 644
           +  A+        D VEV ++                                 P NT  
Sbjct: 575 EPRARAN------DKVEVAVRENASGASSSEEEEEPEDKNQEMDGDDEDERASAPQNTES 628

Query: 645 ----------APIPS--TVPAGPLTYVLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDET 692
                      P+PS  +VPA PLTY LRSV+VHYGTHNYGHYIAFR+YRG WWRISDET
Sbjct: 629 EGEDEGEATNGPLPSKFSVPATPLTYSLRSVVVHYGTHNYGHYIAFRRYRGYWWRISDET 688

Query: 693 VYVVEEAEVLSTSGVFMLFYEYDYDEATGKMREDLESDLEDENQEEDEKLDGEIE 747
           VY+V+E EVLST GVFMLFYEYDYDE+TG+ +++ +  LE+E   E  ++ GE E
Sbjct: 689 VYIVDETEVLSTPGVFMLFYEYDYDESTGQTKQE-DWQLEEEYNPEKIEIAGEPE 742

>YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}
           UBP1Ubiquitin-specific protease that removes ubiquitin
           from ubiquitinated proteins; cleaves at the C terminus
           of ubiquitin fusions irrespective of their size; capable
           of cleaving polyubiquitin chains
          Length = 809

 Score =  783 bits (2023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/731 (55%), Positives = 506/731 (69%), Gaps = 34/731 (4%)

Query: 24  TNSEVPITTAIILVSTAFFFIKYKSFIMNNLSHIGDMTRNFNPTNGFRRWMPRGG--QVD 81
           +N+   ++  +++     FF K    +   +  + +MT NF   N   RW+PR     +D
Sbjct: 31  SNNNNNLSIYLLIFGIVVFFYKKPDHLNYIVESVSEMTTNFRNNNSLSRWLPRSKFTHLD 90

Query: 82  QHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFLXXXXXXXXXXXXXXLLQDE-E 140
           +  L +GG++AGLVNDGNTCFMNSV+QSLASS ELM+FL                 +E  
Sbjct: 91  EEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNNVIRTYEEIEQNEHNEEGN 150

Query: 141 KPTSVEPDTIERXXXXXXXXXXXXHA---NRKLANGVSDEEKT--PDVTFSLALREMLNK 195
              S + +   +            H    NRK ++   DEEK+  PD+TFS+ALR++L+ 
Sbjct: 151 GQESAQDEATHKKNTRKGGKVYGKHKKKLNRK-SSSKEDEEKSQEPDITFSVALRDLLSA 209

Query: 196 LNTKYYKERPCFKTNKLLKSMTKSPNKNIILGYDQEDAQEFFQTILSELEKNVKSLEGKP 255
           LN KYY+++P FKTN LLK+M+KSP KNI+LGYDQEDAQEFFQ IL+ELE NVKSL  + 
Sbjct: 210 LNAKYYRDKPYFKTNSLLKAMSKSPRKNILLGYDQEDAQEFFQNILAELESNVKSLNTEK 269

Query: 256 SEATPIPNAELPKNAVIGQAHLDKVGDVYLPSDQIDPNLVLTNEGKQLYTPFRLVTPLDG 315
            + TP+  +ELP +A++GQ +L +VG VY+P++QIDPN +L ++  Q +TPF+L+TPLDG
Sbjct: 270 LDTTPVAKSELPDDALVGQLNLGEVGTVYIPTEQIDPNSILHDKSIQNFTPFKLMTPLDG 329

Query: 316 ITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLLNQWIKPEIIEGVSCNR 375
           ITAERIGCLQCGENGGIRYSV S +SLNLP+E+IGSTLKLS LL+ W KPEIIEGV CNR
Sbjct: 330 ITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEIIEGVECNR 389

Query: 376 CALEAVRDHLLEQLKQYENKGD-SIPEKLLQAFKARVEELNVSLSKPMVSDEDYKRLHTE 434
           CAL A   HL  QLK++E K + SIPEKL+ A K RV ++   L+KP++ DEDYK+LHT 
Sbjct: 390 CALTAAHSHLFGQLKEFEKKPEGSIPEKLINAVKDRVHQIEEVLAKPVIDDEDYKKLHTA 449

Query: 435 NMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVLFKSRLNLSPWCCDVD 494
           NM RKCSKSKQIL  RPPPLLSIHINRSVFDPRTYMIRKNNS+VLFKSRLNL+PWCCD++
Sbjct: 450 NMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFKSRLNLAPWCCDIN 509

Query: 495 EINLDARLPMSKKQEQVQE-SSEDENLGGEYYAKLHQTYXXXXXXXXX------XXXXXG 547
           EINLDARLPMSKK++  Q+ SSEDEN+GGEYY KLH+ +                     
Sbjct: 510 EINLDARLPMSKKEKAAQQDSSEDENIGGEYYTKLHERFEQEFEDSEEEKEYDDAEGNYA 569

Query: 548 DRYVN-RDVSEYDPLNGEIDSVSSYSDNEDAHHSSEEFLEEVDALGNTVTKKVAKLQS-- 604
             Y + +D+S YDPLNGE+D V+S  D+ED      E++EE DALGNT+ K++ +     
Sbjct: 570 SHYNHTKDISNYDPLNGEVDGVTS--DDED------EYIEETDALGNTIKKRIIEHSDVE 621

Query: 605 --HFGDEDGVE----VEIKXXXXXXXXXXXXXXXXXXXIMPPPVNTAPIPSTVPAGPLTY 658
             +  D + ++    V +                    I  PP+N A   STVPA PLTY
Sbjct: 622 NENVKDNEELQEIDNVSLDEPKINVEDQLETSSDEEDVIPAPPINYARSFSTVPATPLTY 681

Query: 659 VLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVEEAEVLSTSGVFMLFYEYDYDE 718
            LRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVV+EAEVLST GVFMLFYEYD+DE
Sbjct: 682 SLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVDEAEVLSTPGVFMLFYEYDFDE 741

Query: 719 ATGKMREDLES 729
            TGKM++DLE+
Sbjct: 742 ETGKMKDDLEA 752

>Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W
           (REAL)
          Length = 790

 Score =  780 bits (2014), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/726 (55%), Positives = 500/726 (68%), Gaps = 37/726 (5%)

Query: 30  ITTAIILVSTAFFFIKYKSFIMNNLSHIGDMTRNFNPTNGFRRWMPRGG--QVDQHTLDK 87
           ++  +++     FF K    +   +  I +MT NF   N   RW+PR     +D+  L +
Sbjct: 37  LSIYLLIFGVVVFFYKKPDHLNYVVESIREMTTNFRNNNSLSRWLPRSKFTHLDEEILKR 96

Query: 88  GGYVAGLVNDGNTCFMNSVIQSLASSAELMKFLXXXXXXXXXXXXXXLLQDEEKPTSVEP 147
           GG++AGLVNDGNTCFMNSV+QSLASS ELM+FL                  EE  +  EP
Sbjct: 97  GGFIAGLVNDGNTCFMNSVLQSLASSKELMEFLDNNVIKTYEEMEQNEHNKEE--SEHEP 154

Query: 148 DTIERXXXXXXXXXXXXHA------NRKLANGVSDEE-KTPDVTFSLALREMLNKLNTKY 200
           +  E             +       NRKL++   + E + PD+TFS ALR++L  LN KY
Sbjct: 155 EQGEYNNKKNSNRSGKVYGKHKKKLNRKLSSKEEERENQEPDITFSTALRDLLAALNDKY 214

Query: 201 YKERPCFKTNKLLKSMTKSPNKNIILGYDQEDAQEFFQTILSELEKNVKSLEGKPSEATP 260
           Y+++P FKTN LLKSM+KSP KNI+LGYDQEDAQEFFQ IL+ELE NVKSL  +  ++TP
Sbjct: 215 YRDKPYFKTNSLLKSMSKSPRKNILLGYDQEDAQEFFQNILAELESNVKSLNTEKLDSTP 274

Query: 261 IPNAELPKNAVIGQAHLDKVGDVYLPSDQIDPNLVLTNEGKQLYTPFRLVTPLDGITAER 320
           I  + LP++A++GQ +L +VG VY+P++QIDPN +L ++  Q  TPFRL+TPLDGITAER
Sbjct: 275 IAKSNLPEDALVGQQNLGEVGTVYIPTEQIDPNSILHDKSIQNLTPFRLMTPLDGITAER 334

Query: 321 IGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLLNQWIKPEIIEGVSCNRCALEA 380
           IGCLQCGENGGIRYSV S +SLNLP+E+IGSTLKLS LL+ W KPEIIEGV CNRCAL A
Sbjct: 335 IGCLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEIIEGVECNRCALTA 394

Query: 381 VRDHLLEQLKQYENKGD-SIPEKLLQAFKARVEELNVSLSKPMVSDEDYKRLHTENMTRK 439
              HL+EQL Q++ K + SIPEKL+ A K RV+++   L+KP++ DEDYK+LHT NM RK
Sbjct: 395 AHSHLMEQLDQFQKKPEGSIPEKLMNAVKDRVQQIQEVLAKPVIDDEDYKKLHTANMVRK 454

Query: 440 CSKSKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVLFKSRLNLSPWCCDVDEINLD 499
           CSKSKQIL  RPPPLLSIHINRSVFDPRTYMIRKNNS+VLFKSRLNL+PWCCD+DEINLD
Sbjct: 455 CSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFKSRLNLAPWCCDIDEINLD 514

Query: 500 ARLPMSKKQEQVQE-SSEDENLGGEYYAKLHQTYXXXXXXXXXXXXXXG--DRYV----- 551
           ARLPMSKK++ VQ+ SSEDEN+GGEYY KLH+ +                 + Y      
Sbjct: 515 ARLPMSKKEKTVQQDSSEDENIGGEYYTKLHERFEQEFEDSEEERDYNDGEENYTSHYSH 574

Query: 552 NRDVSEYDPLNGEIDSVSSYSDNEDAHHSSEEFLEEVDALGNTVTKKVAKLQSHFGD--- 608
           +++ + YDPLNGE D ++  SD+ED H      +EE DALGNT+ K++ +  +   D   
Sbjct: 575 SKNNNNYDPLNGEADDLT--SDDEDEH------IEETDALGNTIRKRITENTNDENDYVK 626

Query: 609 EDGVE------VEIKXXXXXXXXXXXXXXXXXXXIMPPPVNTAPIPSTVPAGPLTYVLRS 662
           +D  E      V I                    I  PP+N     STVPA PLTY LRS
Sbjct: 627 DDEKELHNIDSVNIDEPKVNVEDQLETSSDEEDVIPAPPINYTRSFSTVPATPLTYSLRS 686

Query: 663 VIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVEEAEVLSTSGVFMLFYEYDYDEATGK 722
           VIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVV+EAEVLST GVFMLFYEYDYDE TG+
Sbjct: 687 VIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVDEAEVLSTPGVFMLFYEYDYDEETGQ 746

Query: 723 MREDLE 728
           M++DLE
Sbjct: 747 MKDDLE 752

>Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W
           (REAL)
          Length = 793

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/737 (54%), Positives = 501/737 (67%), Gaps = 39/737 (5%)

Query: 21  NRNTNSEVPITTAIILVSTAFFFIKYKSFIMNNLSHIGDMTRNFNPTNGFRRWMPRGG-- 78
           N N+N+  PI   +++     F  K    +   +  I +MT NF   N   RW+PR    
Sbjct: 31  NNNSNN-FPI--YLLIFGVVVFLYKRPDHLNRIVDSISEMTTNFRNNNSLSRWLPRSKFT 87

Query: 79  QVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFLXXXXXXX----XXXXXXX 134
            +D+  L +GG++AGLVNDGNTCFMNSV+QSLASS ELM FL                  
Sbjct: 88  HLDEEVLKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMDFLDNNVIKTYEELEENAENK 147

Query: 135 LLQDEEKPTSVEPDTIERXXXXXXXXXXXXHANRKLAN-GVSDEEKTPDVTFSLALREML 193
                E     +    +               NRKL++ G  +E + PDVTFS+ LR++L
Sbjct: 148 EENGHEHEDEEDGHKKKSAKNGKVYGKHKKKLNRKLSSKGEEEENQEPDVTFSVTLRDLL 207

Query: 194 NKLNTKYYKERPCFKTNKLLKSMTKSPNKNIILGYDQEDAQEFFQTILSELEKNVKSLEG 253
             LN KYY+++P FKTN+LLK+M+KSP KN++LGYDQEDAQEFFQ +L+ELE N+KSL  
Sbjct: 208 AALNDKYYRDKPYFKTNRLLKAMSKSPRKNMLLGYDQEDAQEFFQNLLAELENNIKSLNS 267

Query: 254 KPSEATPIPNAELPKNAVIGQAHLDKVGDVYLPSDQIDPNLVLTNEGKQLYTPFRLVTPL 313
           +  + TPI   ELP +A++GQ +L+KVG VY+P++QIDPN +L ++  + +TP++L+TPL
Sbjct: 268 EKLDTTPIAKTELPADALVGQNNLEKVGTVYIPTEQIDPNSILHDKSIKNFTPYKLITPL 327

Query: 314 DGITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLLNQWIKPEIIEGVSC 373
           DGITAERIGCLQCGENGGIRYSV S +SLNLP+E+IG TLKLS LL+ W KPEIIEGV C
Sbjct: 328 DGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIGCTLKLSQLLSDWSKPEIIEGVEC 387

Query: 374 NRCALEAVRDHLLEQLKQYENKGD-SIPEKLLQAFKARVEELNVSLSKPMVSDEDYKRLH 432
           NRCAL A   HLL QLK++  K + SIPEKL+ A + RV+++   L+KP++ DEDY++LH
Sbjct: 388 NRCALTAAHSHLLGQLKEFRKKPEGSIPEKLINAVEDRVQQIEEVLAKPVIDDEDYEKLH 447

Query: 433 TENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVLFKSRLNLSPWCCD 492
           T NM RKCSKSKQIL  RPPPLLSIHINRSVFDPRTYMIRKNNS+VLFKSRLNL+PWCCD
Sbjct: 448 TANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFKSRLNLAPWCCD 507

Query: 493 VDEINLDARLPMSKKQEQVQE-SSEDENLGGEYYAKLHQTYXXXXXXXXXX------XXX 545
           +DEINLDARLPMSKK++ +Q+ SSEDEN+GGEYY+KLH+ +                   
Sbjct: 508 IDEINLDARLPMSKKEKAMQQDSSEDENIGGEYYSKLHERFEQEFEDSEEEREYDDGEEN 567

Query: 546 XGDRYV-NRDVSEYDPLNGEIDSVSSYSDNEDAHHSSEEFLEEVDALGNTVTKK------ 598
               Y  NRD + YDPLNGE D ++S  D+ED      E++EE DALGNT+ K+      
Sbjct: 568 QASHYNDNRDTNNYDPLNGEADGLTS--DDED------EYIEETDALGNTIRKRNIEHAN 619

Query: 599 VAKLQSHFGDEDGVEVEIKXXXXXXXXXXX------XXXXXXXXIMPPPVNTAPIPSTVP 652
             +   H  +++G E++                           I  PP+N A   STVP
Sbjct: 620 TNEEHEHVVEDNGEEMDNTGNANHSELKVNVEDELDSSSDEEDAIPAPPINYARSFSTVP 679

Query: 653 AGPLTYVLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVEEAEVLSTSGVFMLFY 712
           A PLTY LRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVV+EAEVLST GVFMLFY
Sbjct: 680 ATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVDEAEVLSTPGVFMLFY 739

Query: 713 EYDYDEATGKMREDLES 729
           EYDYDE TG+M++DLE+
Sbjct: 740 EYDYDEETGEMKDDLEA 756

>Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W
           (REAL)
          Length = 787

 Score =  767 bits (1980), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/755 (53%), Positives = 500/755 (66%), Gaps = 39/755 (5%)

Query: 1   MSFILETLQRKIISFIIEPLNRNTNSEVPITTAIILVSTAFFFIKYKSFIMNNLSHIGDM 60
           + F+  + Q  + +F I   N N N+    +  +++     FF K    +   +  I +M
Sbjct: 13  LQFLFGSRQDFLRNFKI--WNSNNNN---FSIYLLIFGVVVFFYKKPDHLKYIVDGISEM 67

Query: 61  TRNFNPTNGFRRWMPRGG--QVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMK 118
           T NF   N   RW+PR     +D+  L +GG++AGLVNDGNTCFMNSV+QSLASS ELM 
Sbjct: 68  TTNFKNNNSLSRWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMD 127

Query: 119 FLXXXXXXXXXXXXXXLLQDEEKPTSVEPDTIERXXXXXXXXXXXXHANRKLANGVSDE- 177
           FL                  E      E D                   +KL   +S + 
Sbjct: 128 FLDNNVIKTYEDIERSEQNKENNGNEREQDEDNHKTKSSRSGKVYGKHRKKLNRKLSSKE 187

Query: 178 ----EKTPDVTFSLALREMLNKLNTKYYKERPCFKTNKLLKSMTKSPNKNIILGYDQEDA 233
                + PD+TFS+ L+++L  LN KYY+++P FKTN+LLK+M+KSP KNI+LGYDQEDA
Sbjct: 188 EEEENQEPDITFSVTLKDLLAALNDKYYRDKPYFKTNRLLKAMSKSPRKNILLGYDQEDA 247

Query: 234 QEFFQTILSELEKNVKSLEGKPSEATPIPNAELPKNAVIGQAHLDKVGDVYLPSDQIDPN 293
           QEFFQ IL+ELE NVKSL  +  + TP   ++LP +A++GQ  LD+VG VY+P++QIDPN
Sbjct: 248 QEFFQNILAELESNVKSLNSETLDTTPTAKSDLPDDALVGQRDLDRVGTVYIPTEQIDPN 307

Query: 294 LVLTNEGKQLYTPFRLVTPLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTL 353
            +L ++  + +TP++L+TPLDGITAERIGCLQCGENGGIRYSV S +SLNLP+E+IGSTL
Sbjct: 308 SILHDKSIKNFTPYKLMTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIGSTL 367

Query: 354 KLSDLLNQWIKPEIIEGVSCNRCALEAVRDHLLEQLKQYENKGD-SIPEKLLQAFKARVE 412
           KLS LL+ W KPEIIEGV CNRCAL A   HLL QLKQ+E K D SIPEKL+ A K RV 
Sbjct: 368 KLSQLLSDWSKPEIIEGVECNRCALTAAHSHLLGQLKQFEKKPDGSIPEKLINAVKERVH 427

Query: 413 ELNVSLSKPMVSDEDYKRLHTENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTYMIR 472
           ++   L+KP++ D+DYK+LHT NM RKCSKSKQIL  RPPPLLSIHINRSVFDPRTY IR
Sbjct: 428 QIEQVLAKPVIDDDDYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYTIR 487

Query: 473 KNNSRVLFKSRLNLSPWCCDVDEINLDARLPMSKKQEQV-QESSEDENLGGEYYAKLHQT 531
           KNNS+VLFKSRLNLSPWCCD+DEINLDARLPMSKK++ V QESSEDEN+GGEYY KLH+ 
Sbjct: 488 KNNSKVLFKSRLNLSPWCCDIDEINLDARLPMSKKEKVVQQESSEDENIGGEYYTKLHER 547

Query: 532 YXXXXXXXXXXXXXXGDR-------YVNRDVSEYDPLNGEIDSVSSYSDNEDAHHSSEEF 584
           +               ++         N+  S YDPL  E D ++  SD+ED      E+
Sbjct: 548 FEQEFEDSEEEREYNDEKENYASHYASNKGNSNYDPLKDEADDLT--SDDED------EY 599

Query: 585 LEEVDALGNTVTKKVAKLQSHFG------DEDGVE----VEIKXXXXXXXXXXXXXXXXX 634
           +EE DALGNT+ K+  +            DE+ ++    +                    
Sbjct: 600 IEETDALGNTIRKRTIEHADEKNEHVIEDDEEALDSINNINHDKPKIDVEDQLEPSSDED 659

Query: 635 XXIMPPPVNTAPIPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVY 694
             I  PP+N A   STVPA PLTY LRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVY
Sbjct: 660 DVIPAPPINYARSFSTVPATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVY 719

Query: 695 VVEEAEVLSTSGVFMLFYEYDYDEATGKMREDLES 729
           VV+EAEVLST GVFMLFYEYDYD+ TG+M++DLE+
Sbjct: 720 VVDEAEVLSTPGVFMLFYEYDYDKETGEMKDDLEA 754

>Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON}
           (121699..124065) [2367 nt, 789 aa]
          Length = 788

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/733 (54%), Positives = 497/733 (67%), Gaps = 54/733 (7%)

Query: 34  IILVSTAFFFIKYKSFIMNNLSHIGDMTRNFNPTNGFRRWMP-RGGQVDQHTLDKGGYVA 92
           +++++T +F    K   M  LS  G+     N T  FRR++P    Q+++  L++GG+VA
Sbjct: 37  LLILTTIYFIYTKKHLFMERLSAFGN-----NST--FRRFLPGNNSQLEEKILNRGGFVA 89

Query: 93  GLVNDGNTCFMNSVIQSLASSAELMKFLXXX---------XXXXXXXXXXXLLQDEEKPT 143
           GLVNDGNTCFMNSV+QSLASS  L++FL                         ++E+   
Sbjct: 90  GLVNDGNTCFMNSVLQSLASSKTLLEFLDSEIILKAEELEEKENNVEVDNEEEKEEDDED 149

Query: 144 SVEPDTIERXXXXXXXXXXXXHANRK---------LANGVSDEEKTPDVTFSLALREMLN 194
             E  T E             +  RK         +A    + E+  +VTFSL  +E+L+
Sbjct: 150 KDEESTSEEVEKGTKTARSKTYGKRKKKLARKMDEIALKKDENEQERNVTFSLTFKELLD 209

Query: 195 KLNTKYYKERPCFKTNKLLKSMTKSPNKNIILGYDQEDAQEFFQTILSELEKNVKSLEGK 254
           KLN KYY+ER  FKTNKLL++M+K+PNKNIILGYDQEDAQEFFQ+IL ELEKNVKSL  +
Sbjct: 210 KLNFKYYRERHYFKTNKLLRTMSKAPNKNIILGYDQEDAQEFFQSILLELEKNVKSLGDE 269

Query: 255 PSEATPIPNAELPKNAVIGQAHLDKVGDVYLPSDQIDPNLVL-TNEGKQLYTPFRLVTPL 313
            ++  P+P +ELP+NA+IGQ  L +VG VY+P+DQIDPN +L ++   + YTPF++VTPL
Sbjct: 270 TNKQEPVPESELPENALIGQNKLGEVGTVYIPTDQIDPNSILNSDNSTKFYTPFKMVTPL 329

Query: 314 DGITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLLNQWIKPEIIEGVSC 373
           DGITAERIGCLQCGENGGIRYS++S +SLNLP+E+IGS LKLS LL +WIKPEIIEGV C
Sbjct: 330 DGITAERIGCLQCGENGGIRYSISSGISLNLPAENIGSNLKLSQLLKEWIKPEIIEGVEC 389

Query: 374 NRCALEAVRDHLLEQLKQYENK-GDSIPEKLLQAFKARVEELNVSLSKPMVSDEDYKRLH 432
           NRCAL AVR+HL +QLKQ+E K   +IP+KL++A   R+E+L  +LSKP++ D+DYK +H
Sbjct: 390 NRCALNAVREHLTDQLKQFEAKESGAIPDKLIKAISERIEKLEQTLSKPVIDDDDYKEMH 449

Query: 433 TENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVLFKSRLNLSPWCCD 492
           TENM R+CSKSKQIL  RPPPLLSIHINRSVFDPRTYMIRKNNSRVLFKSRLNL+PWCC+
Sbjct: 450 TENMVRRCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSRVLFKSRLNLAPWCCN 509

Query: 493 VDEINLDARLPMSKKQEQVQESSEDENLGGEYYAKLHQTYXXXXXXXXXXXXXXGDRYVN 552
           +DEINLDARLPMSKKQE   ESSEDEN+GGEYYAKLHQ +               + Y +
Sbjct: 510 IDEINLDARLPMSKKQEFASESSEDENVGGEYYAKLHQRFEQEFEDSDEEDEYGEEEYAD 569

Query: 553 RDVSEYDPLNGEIDSVSSYSDNEDAHHSSEEFLEEVDALGNTVTKKVAKLQS-------- 604
           RDV +YDPLNGE    +            EE++EE DALGNT+ ++  +  +        
Sbjct: 570 RDVKDYDPLNGEFSEDN-------DDGDEEEYIEEQDALGNTIRRRRVERDTLNEDEPLD 622

Query: 605 ----------HFGDEDGVEVEI-KXXXXXXXXXXXXXXXXXXXIMPPPVNTAPIPSTVPA 653
                      + +E  V  E+ +                   I  PP  TAP  STVP 
Sbjct: 623 DEDDDDENDVDYEEEKAVSEEVSELQHGDEKSDVDSEEELDNSISVPPTITAPSASTVPV 682

Query: 654 GPLTYVLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVEEAEVLSTSGVFMLFYE 713
           GPLTY LRSVIVHYGTHNYGHYIAFRKYRGCWWRISDE+V +V+EAEVLST GVFMLFYE
Sbjct: 683 GPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDESVTIVDEAEVLSTPGVFMLFYE 742

Query: 714 YDYDEATGKMRED 726
           YD+DE TG M +D
Sbjct: 743 YDFDEETGMMGDD 755

>NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa]
           {ON} Anc_2.307 YDL122W
          Length = 770

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/739 (54%), Positives = 491/739 (66%), Gaps = 71/739 (9%)

Query: 35  ILVSTAFFFIKYKSFIMNNLSHIGDMTRNFNPTNGFRRWMPRGGQVDQHTLDKGGYVAGL 94
            ++ T   FIKYK         + D+T  F   N FRRW+PR G +D   L KGG+V GL
Sbjct: 43  FILLTNLQFIKYK---------MSDLTNKFKNNNMFRRWIPRAGNIDDKILKKGGFVGGL 93

Query: 95  VNDGNTCFMNSVIQSLASSAELMKFLXXXXXXXXXXXXXXLLQDEEKPTSVEPDTIERXX 154
           VNDGNTCFMNSV+QSLASS EL  FL                + EEK             
Sbjct: 94  VNDGNTCFMNSVLQSLASSKELNAFLDDSIIKK-------FQEQEEK------------- 133

Query: 155 XXXXXXXXXXHANRKLANGVSDEEKTPDVTFSLALREMLNKLNTKYYKERPCFKTNKLLK 214
                                +EEK  DV FS+A +E+L+KLN+KYY+++P F+TNKLLK
Sbjct: 134 ---------IQNEEDPNEKEEEEEKDVDVRFSVAFKELLDKLNSKYYRDKPYFRTNKLLK 184

Query: 215 SMTKSPNKNIILGYDQEDAQEFFQTILSELEKNVKSLEGKPSEATPIPNAELPKNAVIGQ 274
           +M+ +PNKN++LGYDQEDAQEFFQ ILSELEKNVKSL+ K  + TPIP  ELP +A+IGQ
Sbjct: 185 TMSNAPNKNMLLGYDQEDAQEFFQNILSELEKNVKSLDPKKFDNTPIPENELPDDAIIGQ 244

Query: 275 AHLDKVGDVYLPSDQIDPNLVLTNE--GKQLYTPFRLVTPLDGITAERIGCLQCGENGGI 332
           A+L  VG V+LP++QI+PN VL N+    + YTPF+L+TPLDGI+AERIGCLQCGENGGI
Sbjct: 245 ANLGDVGTVFLPTEQIEPNSVLNNDENDTKFYTPFKLITPLDGISAERIGCLQCGENGGI 304

Query: 333 RYSVTSSMSLNLPSEDIGSTLKLSDLLNQWIKPEIIEGVSCNRCALEAVRDHLLEQLKQY 392
           RYSV S +SLNLP E+IGSTLKL+ LL +WIKPEIIEGV C RC LEA+R HLLEQL+QY
Sbjct: 305 RYSVFSGLSLNLPGENIGSTLKLTGLLKEWIKPEIIEGVECYRCGLEAIRSHLLEQLEQY 364

Query: 393 ENKGDSIPEKLLQAFKARVEELNVSLSKPMVSDEDYKRLHTENMTRKCSKSKQILFLRPP 452
                 IPEKLL A   R++ L   L+KP++ DEDYK+LHTENM RKCSKSKQI+  RPP
Sbjct: 365 RESNSGIPEKLLVAVSDRIKVLESILAKPVIEDEDYKKLHTENMVRKCSKSKQIIISRPP 424

Query: 453 PLLSIHINRSVFDPRTYMIRKNNSRVLFKSRLNLSPWCCDVDEINLDARLPMSKKQEQVQ 512
           PLLSIHINRSVFDPRTY IRKNNSRVLFKSRLNL PWCC+  EINLDARLPMSKK++  Q
Sbjct: 425 PLLSIHINRSVFDPRTYQIRKNNSRVLFKSRLNLEPWCCNSSEINLDARLPMSKKEQFAQ 484

Query: 513 ESSEDENLGGEYYAKLHQTYXXXXXXXXXXXXXXGDRYVNRDVSEYDPLNGEIDSVSSYS 572
           ESSEDEN+GGEYYAKLHQ +                        EYD  +   +  S   
Sbjct: 485 ESSEDENIGGEYYAKLHQKFEQEFDDSDEED-------EPSSDDEYDNYSRNREFPSMED 537

Query: 573 DNEDAHHSSEEFLEEVDALGNTVTKKVA------------KLQSHFGDED----GVEVEI 616
            + +  +  +E++EE DALGNTV K+V             +++    ++D      ++++
Sbjct: 538 SSSEDENEEDEYIEETDALGNTVRKRVVNEQAGMDGTIEERIEGCLNEQDEETQDADIDL 597

Query: 617 KXXXXXXXXXXXXXXXXXXXIMPP-----PVNTAPIPSTVPAGPLTYVLRSVIVHYGTHN 671
           +                      P     P++T P P T PAGPLTY LRSVIVHYGTHN
Sbjct: 598 RGEKLPSSPLSSCDEEENVEEEEPSIPLEPLSTVPPPVTAPAGPLTYSLRSVIVHYGTHN 657

Query: 672 YGHYIAFRKYRGCWWRISDETVYVVEEAEVLSTSGVFMLFYEYDYDEATGKMREDLESDL 731
           YGHYIAFRK+RGCWWRISDETVY+V+EAEVLST GVFMLFYEYDYDEATGK+++DL+++ 
Sbjct: 658 YGHYIAFRKFRGCWWRISDETVYIVDEAEVLSTPGVFMLFYEYDYDEATGKLKDDLDNEK 717

Query: 732 EDENQE---EDEKLDGEIE 747
           ED + E   EDE  +  I+
Sbjct: 718 EDMDIEIEIEDEPANKTID 736

>CAGL0H10582g Chr8 complement(1029876..1032248) [2373 bp, 790 aa]
           {ON} similar to uniprot|P25037 Saccharomyces cerevisiae
           YDL122w UBP1 ubiquitin-specific protease
          Length = 790

 Score =  750 bits (1936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/751 (52%), Positives = 491/751 (65%), Gaps = 54/751 (7%)

Query: 30  ITTAIILVSTAFFFIKYKSFIMNNLSHIGDMTRNFNPT--NGFRRWMPRG---GQVDQHT 84
           +T   +++ T F    YK+   +  + + +  RN      +  RR  P       +D+  
Sbjct: 29  LTAIGLIILTYFLLFIYKTGDQSIKARMNEFGRNLKDAGNSALRRMAPNSNYFSNIDEQI 88

Query: 85  LDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFLXXXXXXXXXXXXXXLLQDEEK--P 142
           L +GGYV GL+NDGN CFMNSVIQSLASS EL+KFL              L+ DE+    
Sbjct: 89  LQRGGYVGGLLNDGNFCFMNSVIQSLASSKELLKFLDDEIIGRYESLEKDLVADEDSVSE 148

Query: 143 TSVEPDTIERXXXXXXXXXXXXHANRKLANGVSDEEKTPDVTFSLALREMLNKLNTKYYK 202
           ++ +    ++              NR + NG +D E  PD+ F++A +E+L+KLN KYYK
Sbjct: 149 SNEQNGKKQKASNGKVYGKSKKKHNRSVDNGDNDTE--PDIQFTIAFKELLDKLNYKYYK 206

Query: 203 ERPCFKTNKLLKSMTKSPNKNIILGYDQEDAQEFFQTILSELEKNVKSLEGKPSEATPIP 262
           ERP FKTN ++  M+ SP K++++ YDQEDAQEFFQTILSELEKN+K+LE +  + TP+P
Sbjct: 207 ERPYFKTNSMVNKMSNSPKKSMLMAYDQEDAQEFFQTILSELEKNIKTLESRKDDKTPVP 266

Query: 263 NAELPKNAVIGQAHLDKVGDVYLPSDQIDPNLVLTNEGKQLYTPFRLVTPLDGITAERIG 322
              L ++ +IGQAHL ++G VY+PS+QIDPN       ++ +TPF+LVTPLDGITAERIG
Sbjct: 267 AKNLSEDDMIGQAHLGRMGTVYIPSEQIDPNSYTEGSTEKSFTPFKLVTPLDGITAERIG 326

Query: 323 CLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLLNQWIKPEIIEGVSCNRCALEAVR 382
           CLQCGENGGIRYSV S +SLNLPSE+IGSTLKLS LLN+WIKPEIIEGV CNRCALEAVR
Sbjct: 327 CLQCGENGGIRYSVFSGLSLNLPSENIGSTLKLSSLLNEWIKPEIIEGVECNRCALEAVR 386

Query: 383 DHLLEQLKQYENKGDSIPEKLLQAFKARVEELNVSLSKPMVSDEDYKRLHTENMTRKCSK 442
           +HLL Q+K+ +   ++ P KL+ A + R+ EL  +L KP++ D+DYK+LHTENM RKCSK
Sbjct: 387 EHLLSQMKEIDGSANT-PAKLVDAMRTRLAELEETLKKPVIDDDDYKKLHTENMVRKCSK 445

Query: 443 SKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVLFKSRLNLSPWCCDVDEINLDARL 502
           SKQ++  RPP LLSIHINRSVFDPRTYMIRKNNSRVLFKSR+NL PWCCD+DEINLDARL
Sbjct: 446 SKQVVISRPPALLSIHINRSVFDPRTYMIRKNNSRVLFKSRMNLEPWCCDIDEINLDARL 505

Query: 503 PMSKKQEQVQESSEDENLGGEYYAKLHQTYXXXXXXXXXXXXXXGDR------YVNRDVS 556
           PMSKKQ +V ESSEDEN+GG+YY+KLHQ +               D       Y +R+VS
Sbjct: 506 PMSKKQ-KVVESSEDENIGGDYYSKLHQKFEKAFEDEDEEEYDDEDEEYNNGIYESRNVS 564

Query: 557 EYDPLNGEIDSVSSYSDNEDAHHSSEEFLEEVDALGNTVTKK------------VAKLQS 604
           EYDPLNGE+ S       + +        EEVDALGNT+ KK            ++    
Sbjct: 565 EYDPLNGELSS-------DYSEEDEISSDEEVDALGNTIPKKKTVTLNDGSLTEISVANG 617

Query: 605 HFGDEDGVEVEI------------------KXXXXXXXXXXXXXXXXXXXIMPPPVNTAP 646
           +  D DG E                                         +  PP+N AP
Sbjct: 618 NIVDGDGNEDNSENEDDDDDDDDGDENYTDNDAEDDEAVDSDESNRSQDAVQAPPINLAP 677

Query: 647 IPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVEEAEVLSTSG 706
             STV   PLTY LRSVIVHYGTHNYGHYIA+RK+RG WWRISDE+VYVV+EAEVLST G
Sbjct: 678 RYSTVNPSPLTYALRSVIVHYGTHNYGHYIAYRKFRGVWWRISDESVYVVDEAEVLSTPG 737

Query: 707 VFMLFYEYDYDEATGKMREDLESDLEDENQE 737
           VFMLFYEYDYDE TG+M++D+E + +  N E
Sbjct: 738 VFMLFYEYDYDEKTGRMKDDIEYEFQLHNAE 768

>SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {ON}
           similar to uniprot|P25037 Saccharomyces cerevisiae
           YDL122W UBP1 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions irrespective of their size
           capable of cleaving polyubiquitin chains
          Length = 791

 Score =  744 bits (1922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/773 (52%), Positives = 500/773 (64%), Gaps = 83/773 (10%)

Query: 31  TTAIILVSTAFFFIKYKSFI---MNNLSHIG-DMTRNFNPT-----NGFRRWMPRGGQVD 81
            T ++L+ +     K K F+   M NLS  G ++TR F  +     N    W  R  + +
Sbjct: 30  ATVLVLIVSTLLLFKKKKFVHQLMENLSKAGGELTRGFRSSYYSRANMLGGWGQRRSEQE 89

Query: 82  QHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFLXXXXXXXXXXXXXXL------ 135
           +  L KGGYV GLVNDGNTCFMNSV+QSLASS +L++FL                     
Sbjct: 90  ERVLKKGGYVGGLVNDGNTCFMNSVLQSLASSQQLLEFLDEEIVERSQDDEEPEEFEVEG 149

Query: 136 -----------------LQDEEKPTSVEPDTIERXXXXXXXXXXXXHANRKLANGVSDEE 178
                            +++E KP       ++              A  ++ +  ++EE
Sbjct: 150 GRRSADNADGLDGGLEKMEEESKPK------VKGKSYGKRKKKQTRDAEARVLSEKAEEE 203

Query: 179 KTPDVTFSLALREMLNKLNTKYYKERPCFKTNKLLKSMTKSPNKNIILGYDQEDAQEFFQ 238
           +  DV FS+ L+E+ +KLN K+Y ERP FKTN+LLK+M+K+PNKNIILGYDQEDAQEFFQ
Sbjct: 204 EEADVQFSITLKELFDKLNAKHYSERPYFKTNRLLKTMSKAPNKNIILGYDQEDAQEFFQ 263

Query: 239 TILSELEKNVKSLEGKPSEA-TPIPNAELPKNAVIGQAHLDKVGDVYLPSDQIDPNLVLT 297
           TILSELEKNVKS++ K  E+ TPIP  ELP +A+IGQ HLDK+G VY+P++QIDPN VL 
Sbjct: 264 TILSELEKNVKSIKTKKKESKTPIPETELPADALIGQQHLDKIGTVYIPTEQIDPNTVLN 323

Query: 298 NEGKQLYTPFRLVTPLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSD 357
           N   + YTPF+ VTPLDGITAERIGCL CGENGGIRYSV S +SLNLPSE+IGSTLKLS 
Sbjct: 324 NSELKTYTPFQQVTPLDGITAERIGCLNCGENGGIRYSVFSGLSLNLPSENIGSTLKLSG 383

Query: 358 LLNQWIKPEIIEGVSCNRCALEAVRDHLLEQLKQYENKGDSIPEKLLQAFKARVEELNVS 417
           L+N+W KPEIIEGV CNRCAL AVRDHL + L  YE  G+ IPEKL+ A + R+  LN  
Sbjct: 384 LMNEWAKPEIIEGVECNRCALNAVRDHLQQSLSSYEQAGN-IPEKLVAAVQKRLNLLNEI 442

Query: 418 LSKPMVSDEDYKRLHTENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSR 477
           L+KP++ DEDYK+LHT NM RKCSKSKQIL  RPPPLLS+HINRSVFDPRT+ IRKNNSR
Sbjct: 443 LNKPVIDDEDYKKLHTVNMVRKCSKSKQILISRPPPLLSVHINRSVFDPRTFSIRKNNSR 502

Query: 478 VLFKSRLNLSPWCCDVDEINLDARLPMSKKQEQVQESSEDENLGGEYYAKLHQTYXXXXX 537
           VLFK R NL+PWCC++DEINLDARLPMSKKQE  QESSEDE +GGEY+AKLH+ +     
Sbjct: 503 VLFKPRFNLAPWCCNIDEINLDARLPMSKKQEAPQESSEDEAIGGEYFAKLHRKFQEEFE 562

Query: 538 XXXXXXXXXGDRYVN-RDVSEYDPLNGEIDSVSSYSDNEDAHHSSEEFLEEVDALGNTVT 596
                     D Y N RDVS+YDPL GEI    + S++E+      E + EVD+LGN + 
Sbjct: 563 DSDSEDDEGRDTYYNKRDVSDYDPLKGEI---LTSSEDEEELEDGGEDVVEVDSLGNIIP 619

Query: 597 KKVAKLQSHFGDEDGVEVEIK--------------------------------XXXXXXX 624
           K+   +Q    DE+G  V+ +                                       
Sbjct: 620 KQ-KPVQETQEDENGYAVKEEIEEIDEEEGDDDDDDDDDIGEEDYADDRKHEGEEKEQNG 678

Query: 625 XXXXXXXXXXXXIMPPPVNTAPIPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAFRKYRGC 684
                       + PP  ++  +P    A PLTY LRSVIVHYGTHNYGHYIAFRK+RG 
Sbjct: 679 AQIDGDNDERLDVPPPIPSSYTVP----ACPLTYSLRSVIVHYGTHNYGHYIAFRKHRGF 734

Query: 685 WWRISDETVYVVEEAEVLSTSGVFMLFYEYDYDEATGKMREDLESDLEDENQE 737
           WWRISDETVY+V+EAEVLST GVFMLFYEYDYDE TGK+++DL+  LE++ +E
Sbjct: 735 WWRISDETVYIVDEAEVLSTPGVFMLFYEYDYDEQTGKLKDDLQ--LEEKEEE 785

>Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {ON}
           YDL122W (UBP1) - Ubiquitin-specific protease [contig 27]
           FULL
          Length = 757

 Score =  742 bits (1916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/756 (53%), Positives = 494/756 (65%), Gaps = 48/756 (6%)

Query: 12  IISFIIEPLNRNTNSEVPITTAIILVSTAFFFIKYKSFIMNNLSHIG----DMTRNF-NP 66
           I+S  I+ LN +  S    T  +I+ ST     K + +I N +  +G    D+TR F N 
Sbjct: 14  ILSLFIKNLNIDHKSP---TFLVIVASTGLLIYKNRRYIRNIMDALGTVGGDLTRGFRNS 70

Query: 67  TNG--FRRWMPRGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFLXXXX 124
             G  F +W  R    +   L +GGYV GL+NDGNTCFMNSVIQSLASS  LM+FL    
Sbjct: 71  YKGSVFNKWGSRNPAQEATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEEL 130

Query: 125 XXXXXX----XXXXLLQDEEKPTSVEPDTIERXXXXXXXXXXXXHANRKLANGVSDEEKT 180
                            +EE       +   R               R      + E++ 
Sbjct: 131 MEASKELENPNETSSAVEEEGNLGSNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEG 190

Query: 181 PDVTFSLALREMLNKLNTKYYKERPCFKTNKLLKSMTKSPNKNIILGYDQEDAQEFFQTI 240
            ++ FS AL+E+L KLN KY++++P FKTNKLLK+M+K+PNKNIILGYDQEDAQEFFQTI
Sbjct: 191 VNMEFSAALKELLEKLNDKYHRDKPYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTI 250

Query: 241 LSELEKNVKSLEGKP-SEATPIPNAELPKNAVIGQAHLDKVGDVYLPSDQIDPNLVLTNE 299
           LSELEKN+KSL GK   +  P   A++PKNA+IGQ  L ++G VYLP++QIDPN VL +E
Sbjct: 251 LSELEKNIKSLRGKSDKDNEPTELADIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHE 310

Query: 300 GKQLYTPFRLVTPLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLL 359
            KQL+ PF LVTPLDGITAERIGCLQCGENGGIRYSV S +SLNLPS+ +GS LKLS LL
Sbjct: 311 AKQLFFPFDLVTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLL 370

Query: 360 NQWIKPEIIEGVSCNRCALEAVRDHLLEQLKQYENKGDSIPEKLLQAFKARVEELNVSLS 419
            +W+KPEIIEGV CNRCAL+AV +HL + L QYE   D + EKL+ A  +RVEEL   L+
Sbjct: 371 REWVKPEIIEGVECNRCALKAVLEHLEKTLTQYE-INDKVSEKLVSAVSSRVEELKAILA 429

Query: 420 KPMVSDEDYKRLHTENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVL 479
           KP+V D+DYK+LHTENM RKCSKSKQIL  RPPPLLSIHINRSVFDPRTY IRKNNS+VL
Sbjct: 430 KPVVDDDDYKKLHTENMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYTIRKNNSKVL 489

Query: 480 FKSRLNLSPWCCDVDEINLDARLPMSKKQEQVQESSEDENLGGEYYAKLHQTYXXXXXXX 539
           FKSRLNL+PW C  DEINLDARLPMSKK ++  ESSEDEN+GGEY+AKLH+ +       
Sbjct: 490 FKSRLNLAPWSCGPDEINLDARLPMSKKDQRAMESSEDENIGGEYFAKLHRRFEEEFEDS 549

Query: 540 XXXXXXXGDRYVNRDVSEYDPLNGEIDSVSSYSDNEDAHHSSEEFLEEVDALGNTVTKKV 599
                   ++  NR  S+YDPL GE+DS S     ED  +S  E+  E+D+LGN V K  
Sbjct: 550 DEESDNYSEK--NRLNSDYDPLKGELDSSS-----EDDEYSEGEY--EIDSLGNRVFK-C 599

Query: 600 AKLQSHFGDEDGVE---------------VEIKXXXXXXXXXXXXXXXXXXXIMPPPVN- 643
             +QS   D + VE                EI                      P  +N 
Sbjct: 600 KNIQSD-SDVNSVEEASEEDKPDTNDLENREITGGVGQENSDSEVESEDEVETQPTELNP 658

Query: 644 -----TAPIPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVEE 698
                 AP  STVP+GPLTY LRSVIVHYG+HNYGHYIAFRK+RG WWRISDETVYVV+E
Sbjct: 659 LSAGQLAPSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRKFRGLWWRISDETVYVVDE 718

Query: 699 AEVLSTSGVFMLFYEYDYDEATGKMREDLESDLEDE 734
           AEVLST GVFMLFYE+DY++   KM +DLE + ++E
Sbjct: 719 AEVLSTPGVFMLFYEHDYNQTLQKMNDDLEWEEQEE 754

>KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} similar
           to uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
           Ubiquitin-specific protease that removes ubiquitin from
           ubiquitinated proteins cleaves at the C terminus of
           ubiquitin fusions irrespective of their size capable of
           cleaving polyubiquitin chains
          Length = 758

 Score =  734 bits (1894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/764 (52%), Positives = 497/764 (65%), Gaps = 53/764 (6%)

Query: 1   MSFILETLQRKIISFIIEPLNRNTNSEVPITTAIILVSTAFFFIKYKSFIMNNLSHIG-- 58
           M+F+LE L     +  I   N +       T  +++ ST     K K    N + +IG  
Sbjct: 1   MNFVLEKLSALFSTLSIFVRNLSHIDNKSSTLIVLIASTGILLYKNKRIFRNIMENIGTV 60

Query: 59  --DMTRNF-NPTNG--FRRWMPRGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASS 113
             D+TR+F N   G  F +W  +  + +   L +GGYV GLVNDGNTCFMNSV+QSLASS
Sbjct: 61  GGDLTRSFRNNYKGSMFNKWGSKDPEQEAAMLKRGGYVGGLVNDGNTCFMNSVLQSLASS 120

Query: 114 AELMKFLXXXXXXXXXXXXXXLLQDE---EKPTSVEPDTIERXXX--XXXXXXXXXHANR 168
             L++FL                +DE   EK    E    E                  R
Sbjct: 121 KTLLQFLDNEVIQAYKEAEES--EDEHVAEKEFESEKKLSESKTKPKKKVYGKRKKRLTR 178

Query: 169 KLANGVSDEEKTPDVTFSLALREMLNKLNTKYYKERPCFKTNKLLKSMTKSPNKNIILGY 228
                  D+++  ++ FS  L+E+LNKLN K+Y++RP FKTNKLLK+M+K+PNK+IILGY
Sbjct: 179 NAEKDALDDDQDANIEFSTTLKELLNKLNAKHYRDRPYFKTNKLLKTMSKAPNKSIILGY 238

Query: 229 DQEDAQEFFQTILSELEKNVKSLEGKPS--EATPIPNAELPKNAVIGQAHLDKVGDVYLP 286
           DQEDAQEFFQTILSELEKNVKSL GK S  E  P+   +LP+++++GQ  L ++G VY+P
Sbjct: 239 DQEDAQEFFQTILSELEKNVKSLYGKSSKDEEAPVQFDQLPEDSMVGQERLGEMGTVYIP 298

Query: 287 SDQIDPNLVLTNEGKQLYTPFRLVTPLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPS 346
           ++QIDPN VL +E K LY+PF+L+TPLDG+TAERIGCLQCGENGGIRYSV S +SLNLPS
Sbjct: 299 TEQIDPNCVLAHENKSLYSPFKLITPLDGLTAERIGCLQCGENGGIRYSVFSGLSLNLPS 358

Query: 347 EDIGSTLKLSDLLNQWIKPEIIEGVSCNRCALEAVRDHLLEQLKQYENKGDSIPEKLLQA 406
           E++GSTLKLS+LL +WIKPEIIEGV CNRCAL AV +HL + L QYE    S  EKL+ A
Sbjct: 359 ENLGSTLKLSELLREWIKPEIIEGVECNRCALNAVLEHLEKTLIQYEGSEHS-SEKLVAA 417

Query: 407 FKARVEELNVSLSKPMVSDEDYKRLHTENMTRKCSKSKQILFLRPPPLLSIHINRSVFDP 466
            KARVE+L   L+KP + D+DYK+LHTENM RKCSKSKQI+  RPPPLL IHINRSVFDP
Sbjct: 418 VKARVEQLKDILAKPAIDDDDYKKLHTENMVRKCSKSKQIIISRPPPLLCIHINRSVFDP 477

Query: 467 RTYMIRKNNSRVLFKSRLNLSPWCCDVDEINLDARLPMSKKQEQVQESSEDENLGGEYYA 526
           RTYMIRKNNSRVLFKS+LNL+PWCC  DEINLDARLPMSKK+++  ESSEDEN+GGEY+A
Sbjct: 478 RTYMIRKNNSRVLFKSKLNLAPWCCAPDEINLDARLPMSKKEQKSLESSEDENVGGEYFA 537

Query: 527 KLHQTYXXXXXXXXXXXXXXGDRYVNRDVSEYDPLNG-----------------EIDSVS 569
           KLH+ +                   NRDVS+YDPL G                 E+D++ 
Sbjct: 538 KLHRHFEEEFEDSEEEEGNF--EASNRDVSDYDPLRGEIESSSDENESSSDGEYEVDALG 595

Query: 570 SYSDNEDAHHSSEEFLEEVDALGNTVTKKVAKLQSHFGDE--DGVEVEIKXXXXXXXXXX 627
           +    ++   + +E ++     G +   +VA L+     E  DG+E E            
Sbjct: 596 NRVFKQNGAQTEQELVD-----GTSADPEVASLEGSDAAERLDGIEPET------LDNED 644

Query: 628 XXXXXXXXXIMPPP----VNTAPIPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAFRKYRG 683
                    +  PP    ++ AP  STVP GPLTY LRSVIVHYGTHNYGHYIAFRK+RG
Sbjct: 645 EEDSESDHEVKQPPSLSSLHHAPSSSTVPVGPLTYALRSVIVHYGTHNYGHYIAFRKFRG 704

Query: 684 CWWRISDETVYVVEEAEVLSTSGVFMLFYEYDYDEATGKMREDL 727
            WWRISDETVYVV+EAEVLST G+FMLFYE+DY+E+   M +DL
Sbjct: 705 LWWRISDETVYVVDEAEVLSTPGIFMLFYEHDYNESLHAMNDDL 748

>NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}
          Length = 856

 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/729 (52%), Positives = 462/729 (63%), Gaps = 114/729 (15%)

Query: 70  FRRWMPRGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFLXXXXXXXXX 129
            RRWMPR  Q+D + L+ GGY+AGL+NDGNTCFMNSV+QSLASS ELM FL         
Sbjct: 106 MRRWMPRSSQMDSNVLNHGGYIAGLLNDGNTCFMNSVLQSLASSKELMDFLDTTIKQEQE 165

Query: 130 XXXXXLLQDEEKPTSVEPDTIERXXXXXXXXXXXXHANRKLANGVSDEEKTPDVTFSLAL 189
                    +EK   V                                    D+ F+L+L
Sbjct: 166 QEQEQEQVGDEKKEDV------------------------------------DIGFTLSL 189

Query: 190 REMLNKLNTKYYKERPCFKTNKLLKSMTKSPNKNIILGYDQEDAQEFFQTILSELEKNVK 249
            E+L++LN KYYKERP FKTNKLLK+M  +PNKN++LGYDQEDAQEFFQ ILSELEKN+K
Sbjct: 190 NELLSQLNAKYYKERPYFKTNKLLKTMKNAPNKNMLLGYDQEDAQEFFQNILSELEKNLK 249

Query: 250 SLEGK---------------PSEATPIPNAELPKNAVIGQAHLDKVGDVYLPSDQIDPN- 293
           S+  +                +E   I   +LPK+A+IGQ  L KVG VY+P++QI+PN 
Sbjct: 250 SISSQNNKEEEEEKKEQEKNSNECVKILKKDLPKDAIIGQEQLGKVGTVYIPTEQIEPNT 309

Query: 294 ---LVLTNEGKQLYTPFRLVTPLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIG 350
              L  +N  ++LYTPF+L+TPLDGI+AERIGCLQCGENGGIRYSV S +SLNLP+E+IG
Sbjct: 310 STALPSSNPQEKLYTPFKLITPLDGISAERIGCLQCGENGGIRYSVFSGLSLNLPNENIG 369

Query: 351 STLKLSDLLNQWIKPEIIEGVSCNRCALEAVRDHLLEQLKQYENKGDSIPEKLLQAFKAR 410
            TLKLS+LLN+WIKPEII+GV CNRCALEA++ HLL+QL+QY N    IP+KL+ A K R
Sbjct: 370 MTLKLSNLLNEWIKPEIIDGVECNRCALEAIKSHLLDQLEQYHNNSTEIPQKLIDAVKDR 429

Query: 411 VEELNVSLSKPMVSDEDYKRLHTENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTYM 470
           VE L   LSKP++ +EDYK+LHTENM RKCSKSKQIL  RPPPLLSIHINRSVFD RTY 
Sbjct: 430 VECLQKILSKPVIDEEDYKKLHTENMVRKCSKSKQILISRPPPLLSIHINRSVFDVRTYQ 489

Query: 471 IRKNNSRVLFKSRLNLSPWCCDVDEINLDARLPMSKKQEQV--QESSEDE--NLGGEYYA 526
           IRKNNSRVLFKS+LNL PW CD+DEINLDARLPMSKK+  +   E SED+     GEYY 
Sbjct: 490 IRKNNSRVLFKSKLNLEPWTCDIDEINLDARLPMSKKESSLGQDEFSEDDEATTNGEYYN 549

Query: 527 KLHQTYXXX----------XXXXXXXXXXXGDRYVNRDVSEYDPLNGEID---SVSSYSD 573
           +LHQ Y                          R   +DV  YDPLNGEI+   SV S +D
Sbjct: 550 RLHQKYQQEFEDSSDEDDDSDDNEIYSMDNNRRRTRKDVRNYDPLNGEIEDSSSVYSSAD 609

Query: 574 NEDAHHSSEEFLEEVDALGNTVTKKVAKLQSHFGDEDGVEV------------------- 614
            +D H S    +EE D+LGNT+ K+V K ++    ED +E                    
Sbjct: 610 EKDTHDS----IEETDSLGNTIRKRVIKQETFERAEDSIEKENEGAEANHDDDNDDNNDE 665

Query: 615 ---------EIKXXXXXXXXXXXXXXXXXXXIMPPPVNTAPIPSTV-------PAGPLTY 658
                    E+                     + P   +  IP T+       P GPLTY
Sbjct: 666 QEHKGNNDDELPSSSPLAASEEEEDGEVQETSLSP---SGAIPQTIRKKFDSTPIGPLTY 722

Query: 659 VLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVEEAEVLSTSGVFMLFYEYDYDE 718
            LRSVIVHYGTHNYGHYIAFRKYRG WWRISDETVY+V+EAEVLST GVFMLFYEYDYDE
Sbjct: 723 SLRSVIVHYGTHNYGHYIAFRKYRGVWWRISDETVYIVDEAEVLSTPGVFMLFYEYDYDE 782

Query: 719 ATGKMREDL 727
            TGK+++DL
Sbjct: 783 ITGKLKDDL 791

>TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.307
           YDL122W
          Length = 782

 Score =  717 bits (1850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/751 (53%), Positives = 490/751 (65%), Gaps = 62/751 (8%)

Query: 35  ILVSTAFFFIKY--KSFIMNNLSHIGDMTRNFNPTNGFRRWMPRGGQVDQHTLDKGGYVA 92
            L  T+  +I Y  + +IMNNLS I    RN +  N   R++P    +D   L +GG++A
Sbjct: 34  FLFFTSVIYILYSKRHYIMNNLSSI----RNNSTLN---RFLPSYNSMDDTILKRGGHIA 86

Query: 93  GLVNDGNTCFMNSVIQSLASSAELMKFLXXXXXXXXXXXXXXLLQDEEKPTSVEPDTIER 152
           GLVNDGNTCFMNSV+QSLASS  L++FL               L+D+E     E +  E 
Sbjct: 87  GLVNDGNTCFMNSVLQSLASSRTLVEFLDEEIVNSQ-------LKDDETEGENEKEVGEE 139

Query: 153 XXXXXXX-----XXXXXHANRKLANGVSDEEKT-----PDVTFSLALREMLNKLNTKYYK 202
                                +      D EKT      DV FS+AL+E+L+KLN KYY+
Sbjct: 140 VQVKVQKLNKNKNGGKRKKKLQKQKDQEDLEKTEESTEKDVAFSIALKELLDKLNFKYYR 199

Query: 203 ERPCFKTNKLLKSMTKSPNKNIILGYDQEDAQEFFQTILSELEKNVKSLEGKPSEATPIP 262
           ++P FKT+ LLK+M+K+PNKNII+GYDQEDAQEFFQ+ILSELEKNVKS+     +  P+P
Sbjct: 200 DKPYFKTHSLLKTMSKAPNKNIIMGYDQEDAQEFFQSILSELEKNVKSISPIEKDVKPVP 259

Query: 263 NAELPKNAVIGQAHLDKVGDVYLPSDQIDPNLVLTN-EGKQLYTPFRLVTPLDGITAERI 321
            +ELP  A+IGQ  L  VG V++P++QIDPN +L N +  + YTPFR++TPLDGITAERI
Sbjct: 260 ESELPDGALIGQNDLGSVGTVFIPTEQIDPNSILENKDSSKYYTPFRMITPLDGITAERI 319

Query: 322 GCLQCGENGGIRYSVTSSMSLNLPSEDIGS-TLKLSDLLNQWIKPEIIEGVSCNRCALEA 380
           GCL CGENGGIRYS++SS+SLNLP+E+I S  LKLS+L+ +WIKPEIIEGV CNRCAL A
Sbjct: 320 GCLTCGENGGIRYSISSSLSLNLPNENINSQALKLSNLMQEWIKPEIIEGVECNRCALNA 379

Query: 381 VRDHLLEQLKQYENKG-DSIPEKLLQAFKARVEELNVSLSKPMVSDEDYKRLHTENMTRK 439
           V +HL +QLKQ + K   SIPEKL+ A + R+  L+ +LSKP++ DEDYK+ HTENM RK
Sbjct: 380 VLEHLQDQLKQLQEKSTGSIPEKLISAVEERISILSKTLSKPVIDDEDYKKYHTENMVRK 439

Query: 440 CSKSKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVLFKSRLNLSPWCCDVDEINLD 499
           CSKSKQIL  RPPPLLSIHINRSVFDP TY IRKNNSRVLFKSR NL PWCCD+DEINLD
Sbjct: 440 CSKSKQILISRPPPLLSIHINRSVFDPNTYTIRKNNSRVLFKSRFNLEPWCCDIDEINLD 499

Query: 500 ARLPMSKKQEQVQESSEDENLGGEYYAKLHQTYXXXXXXXXXXXXXXGD--RYVNRDVSE 557
           ARLPMSKK    QESSEDEN+GGEYYAKLH  +                  +   RDVS 
Sbjct: 500 ARLPMSKKNNLPQESSEDENIGGEYYAKLHHKFEQEFEDSDEESYENDSDMQLRGRDVSN 559

Query: 558 YDPLNGEIDSVSSYSDNEDAHHSSEEFLEEVDALGNTVTKKVAKLQSHFGDEDGVEV--- 614
           YDPL+GEI+   S  D         E++EE D LGNT+ ++V + Q     E+ + +   
Sbjct: 560 YDPLHGEIEEDESVDD-------GAEYIEETDGLGNTIRRRVIE-QEQIQKENDIAMESD 611

Query: 615 -------------------EIKXXXXXXXXXXXXXXXXXXXIMPPPVNTAPIPSTVPAGP 655
                              + +                     PP   T+   STVPA P
Sbjct: 612 EDDEDYTEDQEKDDIFDNNDPEGEHIVDTESSDVESDRVSLPAPPRQYTSLSSSTVPASP 671

Query: 656 LTYVLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVEEAEVLSTSGVFMLFYEYD 715
           LTY LRSVIVHYGTHNYGHYIAFR+YRGCWWRISDE+VY+VEEAEVLST GVFMLFYEYD
Sbjct: 672 LTYSLRSVIVHYGTHNYGHYIAFRRYRGCWWRISDESVYIVEEAEVLSTPGVFMLFYEYD 731

Query: 716 YDEATGKMREDLESDLEDENQE-EDEKLDGE 745
           YD  T KM +D+E D E E +  +DEK D +
Sbjct: 732 YDVETKKMFDDIEFDKEIEIEGFDDEKPDNQ 762

>KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa]
           {ON} Anc_2.307 YDL122W
          Length = 678

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/700 (54%), Positives = 454/700 (64%), Gaps = 81/700 (11%)

Query: 62  RNFNPTNGFRRWMPRGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFLX 121
           R +N  N F R M      D+  + +GGY+AGLVNDGNTCFMNSV+QSLASS EL  FL 
Sbjct: 28  RMYNNNNFFSRKMYNNAINDKKFIKRGGYIAGLVNDGNTCFMNSVLQSLASSKELAAFL- 86

Query: 122 XXXXXXXXXXXXXLLQDEEKPTSVEPDTIERXXXXXXXXXXXXHANRKLANGVSDEEKTP 181
                                                        +  + NG    E   
Sbjct: 87  ---------------------------------------------DNVIENG---SENNG 98

Query: 182 DVTFSLALREMLNKLNTKYYKERPCFKTNKLLKSMTKSPNKNIILGYDQEDAQEFFQTIL 241
           D+ F+  LRE+L  LN KYYKE+P FKTNKLLK+M+  PNKNIILGYDQEDAQEFFQ IL
Sbjct: 99  DIKFTETLRELLLILNKKYYKEKPYFKTNKLLKTMSNGPNKNIILGYDQEDAQEFFQQIL 158

Query: 242 SELEKNVKSLEG-KPSEATPIPNAELPKNAVIGQAHLDKVGDVYLPSDQIDPNLVLTNEG 300
           S+LEKN+K     K  E   I  ++LP +A++GQ  L+ VG VY+P++QI+PN VL N  
Sbjct: 159 SDLEKNIKKPSTEKKEERNNIKESDLPDDALLGQDDLNNVGTVYIPTEQIEPNSVLENPD 218

Query: 301 KQLYTPFRLVTPLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIG-STLKLSDLL 359
           ++LY+PF+L+TPLDGITAERIGCL CGENGGIRYSV S +SLNLPSE +  STLKLS+LL
Sbjct: 219 QKLYSPFKLITPLDGITAERIGCLTCGENGGIRYSVFSGLSLNLPSESLNQSTLKLSELL 278

Query: 360 NQWIKPEIIEGVSCNRCALEAVRDHLLEQLKQYENKGDSIPEKLLQAFKARVEELNVSLS 419
           N+W+KPEIIEGV CNRC+L AVR HL +Q++      D+IPEKL  A   R+  L   LS
Sbjct: 279 NEWVKPEIIEGVECNRCSLNAVRSHLQDQIQ-----NDTIPEKLKIAINQRLNLLTEILS 333

Query: 420 KPMVSDEDYKRLHTENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVL 479
           KP++ ++DYK+ HTENM RKCSKSKQIL  RPPP LSIHINRSVFDPRTYMIRKNN+RVL
Sbjct: 334 KPVIEEDDYKKYHTENMVRKCSKSKQILISRPPPFLSIHINRSVFDPRTYMIRKNNARVL 393

Query: 480 FKSRLNLSPWCCDVDEINLDARLPMSKKQEQVQ--ESSEDENLGGEYYAKLHQTYXXXXX 537
           FK+RLNL  W C+VDEINLDARLPMSK +  VQ  ESSEDEN+GG+YYAKLH  +     
Sbjct: 394 FKTRLNLQKWACNVDEINLDARLPMSKNEHIVQNEESSEDENIGGDYYAKLHHRFEQEYE 453

Query: 538 XXXXXXXXXGDRYVNRDVSEYDPLNGEIDSVSSYSDNEDAHHSSEEFLEEVDALGNTVTK 597
                     D   +RDV  YDPLNGE  ++SS      +    E+  EEVDALGNT+  
Sbjct: 454 DSEDEENEI-DSDDDRDVRNYDPLNGEEMNLSSEF----SSSEDEQEEEEVDALGNTIRN 508

Query: 598 KVAKLQSHF----------GDEDGVEVEIKXXXXXXXXXXXXXXXXXXXIMPPPVN-TAP 646
              +L +             +ED    E                     I  PP N +  
Sbjct: 509 MPVRLANEVEQPVPMSNSSSEEDQ---EPAQDSESESELNEDVEQKNDEISIPPTNGSMT 565

Query: 647 IPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVEEAEVLSTSG 706
             S+VPAGPL Y LRSVIVHYGTHNYGHYIAFRKYRG WWRISDETVY+V+E EVLST G
Sbjct: 566 YSSSVPAGPLIYSLRSVIVHYGTHNYGHYIAFRKYRGYWWRISDETVYIVDETEVLSTPG 625

Query: 707 VFMLFYEYDYDEATGKMREDLES-DLEDENQEE---DEKL 742
           VFMLFYEYDYD  TG+M++DLES D EDE++ E   DEK+
Sbjct: 626 VFMLFYEYDYDSVTGRMKDDLESLDQEDESEIEIVQDEKV 665

>AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL122W
           (UBP1)
          Length = 775

 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/720 (51%), Positives = 462/720 (64%), Gaps = 51/720 (7%)

Query: 45  KYKSFIMNNLSHIGDMTRNFNPTNGFR-----RWMPRGGQVDQHTLDKGGYVAGLVNDGN 99
           K +  + N +  IG +  NF  T  FR     RW P+  ++++     GG V GLVNDGN
Sbjct: 38  KQRKQVGNIMDGIGQVAGNF--TRDFRHRMLGRWAPQSAELEKQAHQHGGNVGGLVNDGN 95

Query: 100 TCFMNSVIQSLASSAELMKFLXXXXXXXXXXXXXXLLQDEEKPTSVEPDTIERXXXXXXX 159
           TCF+NSVIQSLASS EL++FL                 D +     E  +  +       
Sbjct: 96  TCFINSVIQSLASSRELLRFLDEEIIDASQPGTDESADDVQNGDEDEGSSSAKKKAYGKR 155

Query: 160 XXXXXHANRKLANGVSDEEKTPDVTFSLALREMLNKLNTKYYKERPCFKTNKLLKSMTKS 219
                 A   +A   +D    P   FS ALRE+++ LN K+Y+ +P F+T+ LLK+M+K+
Sbjct: 156 KKKQARAADAVALAKAD---GPRTDFSAALRELIDNLNGKHYRNKPYFRTSGLLKTMSKA 212

Query: 220 PNKNIILGYDQEDAQEFFQTILSELEKNVKSLEGKPSE-ATPIPNAELPKNAVIGQAHLD 278
           PNKNIILGYDQEDAQEFFQTILSELEK+V+S++GKP + A P+P  ELP +A+IG  H+ 
Sbjct: 213 PNKNIILGYDQEDAQEFFQTILSELEKDVQSIQGKPEKNAKPVPKEELPGDAIIGSEHIG 272

Query: 279 KVGDVYLPSDQIDPNLVLTNEGKQLYTPFRLVTPLDGITAERIGCLQCGENGGIRYSVTS 338
           ++G VY+P++QI PN VL N+ ++ YTPF+L+TP DGITAER+GCLQCGENGGIRY + S
Sbjct: 273 RIGTVYIPTEQIAPNSVL-NDPERYYTPFKLLTPFDGITAERVGCLQCGENGGIRYCLFS 331

Query: 339 SMSLNLPSEDIGSTLKLSDLLNQWIKPEIIEGVSCNRCALEAVRDHLLEQLKQYENKGD- 397
           S+SLNLP+++  STLKLS+LL +W+KPEIIEGV CNRCAL+AV  HL  ++K+ +   D 
Sbjct: 332 SLSLNLPNDNTSSTLKLSELLREWVKPEIIEGVECNRCALQAVHAHLAAKVKELQAAEDE 391

Query: 398 -SIPEKLLQAFKARVEELNVSLSKPMVSDEDYKRLHTENMTRKCSKSKQILFLRPPPLLS 456
            ++  KL+   KAR+E+L   L+KP + DEDYK+LHT+NM RKCSKSKQ L  RPPPLLS
Sbjct: 392 KAMSAKLISLMKARLEQLEGILAKPAIDDEDYKKLHTDNMVRKCSKSKQTLITRPPPLLS 451

Query: 457 IHINRSVFDPRTYMIRKNNSRVLFKSRLNLSPWCCDVDEINLDARLPMSKKQE-QVQESS 515
           IHINRSVFDPRT+MIRKNNS+VLFKSRLNL+PWCC VDE+NLDARLPMSKK   +++ESS
Sbjct: 452 IHINRSVFDPRTFMIRKNNSKVLFKSRLNLAPWCCGVDEVNLDARLPMSKKDAAELEESS 511

Query: 516 EDENLGGEYYAKLH---QTYXXXXXXXXXXXXXXGDRYVNR---DVSEYDPLNGEIDSVS 569
           EDE  G EYY KLH   Q                G     R   DV  YDPL GE  S S
Sbjct: 512 EDEPQGTEYYNKLHLRFQAEYEDEDDLDKGPNPSGPHSSYRAVADVPNYDPLAGEYSSSS 571

Query: 570 SYSDNEDAHHSSEEFLEEVDALGNTVTKK-VAKLQSHFGDEDGVE------VEIKXXXXX 622
                       E    E+DALGNT+ K   A L+    DED         +E       
Sbjct: 572 E--------EEHERESIELDALGNTIPKNGPASLEELSSDEDLATKPRAEILEKPDNDED 623

Query: 623 XXXXXXXXXXXXXXIMPPPVNTA------PIPST---------VPAGPLTYVLRSVIVHY 667
                           P P ++       P P+T         V A PLTY LRSVIVHY
Sbjct: 624 EEPSDDEDADDYDSDSPRPGDSGSELRDPPAPATFATELHGSSVLASPLTYSLRSVIVHY 683

Query: 668 GTHNYGHYIAFRKYRGCWWRISDETVYVVEEAEVLSTSGVFMLFYEYDYDEATGKMREDL 727
           GTHNYGHYIAFRK+RG WWRISDET Y+V+EAEVLST GVFMLFYEYDYDEATG++R+DL
Sbjct: 684 GTHNYGHYIAFRKFRGVWWRISDETAYIVDEAEVLSTPGVFMLFYEYDYDEATGQLRDDL 743

>KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.307
           YDL122W
          Length = 764

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/760 (47%), Positives = 460/760 (60%), Gaps = 122/760 (16%)

Query: 34  IILVSTAFFFI--------KYKSFIMNNLSHIGDMTRNFNPTNGFRRWMPRGGQVDQHTL 85
           I+ +S   FF         K   F++  ++    MT  ++  +           +D   L
Sbjct: 11  ILFLSVVLFFFLLHTPTSSKITRFVLKMVNQAKRMTSYYSAPS-----------MDDVIL 59

Query: 86  DKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFLXXXXXXXXXXXXXXLLQDEEKPTSV 145
            +GG+VAGLVNDGNTCFMNSV+QSLASS EL  FL                         
Sbjct: 60  KRGGFVAGLVNDGNTCFMNSVLQSLASSRELAHFLD------------------------ 95

Query: 146 EPDTIERXXXXXXXXXXXXHANRKLANGVSDEEKTPDVTFSLALREMLNKLNTKYYKERP 205
             D IE                         E    ++ FS+A + +L+KLN KY + R 
Sbjct: 96  --DIIEES-----------------------EPNKNELNFSVAFKTLLDKLNAKYGRNRK 130

Query: 206 CFKTNKLLKSMTKSPNKNIILGYDQEDAQEFFQTILSELEKNVKSLEG----------KP 255
            ++ N LLK+M   PNKNI+LGYDQEDAQEFFQ I+S+LEK++K  +           +P
Sbjct: 131 YYRPNALLKTMESGPNKNILLGYDQEDAQEFFQQIISQLEKDLKKEDTDGDFKKEESVQP 190

Query: 256 S---EATPIPNAELPKNAVIGQAHLDKVGDVYLPSDQIDPNLVL-TNEGKQLYTPFRLVT 311
           S   + TPI  ++LP +A++ Q +L+KVG VY+P++Q++PN  L   E +  YTP++L+T
Sbjct: 191 SSEDDKTPILESDLPADALLNQENLEKVGTVYIPTEQVEPNFALGKGEHESFYTPYKLLT 250

Query: 312 PLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLLNQWIKPEIIEGV 371
           PLDGI AERIGCL CGENGGIRYSV+S +SLNLP+E+IG+TLKLS+LL++W++PEIIEGV
Sbjct: 251 PLDGIIAERIGCLNCGENGGIRYSVSSGLSLNLPNENIGATLKLSELLDKWVEPEIIEGV 310

Query: 372 SCNRCALEAVRDHLLEQLKQYENKGDSIPEKLLQAFKARVEELNVSLSKPMVSDEDYKRL 431
            CNRCALEAVR HLLEQL+ +E    + P KL+ A K RV+ L  +L KP + DEDYK+L
Sbjct: 311 DCNRCALEAVRSHLLEQLEGFEKNEKAPPAKLIDAMKERVKVLEETLLKPAIDDEDYKKL 370

Query: 432 HTENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVLFKSRLNLSPWCC 491
           HT+NM RKCSKSKQ++  RPPPLLSIHINRSVFDPRTYMI KN SRVLFKS+LNL  WCC
Sbjct: 371 HTDNMVRKCSKSKQVVISRPPPLLSIHINRSVFDPRTYMICKNGSRVLFKSKLNLDQWCC 430

Query: 492 DVDEINLDARLPMSKKQEQVQESSEDENLGGEYYAKLHQTYXXXXXXXXXXXXXXGDRYV 551
              EINLDARLPMSKKQ++ ++SSE+E     Y++KLHQ +                   
Sbjct: 431 SPLEINLDARLPMSKKQKRSRDSSEEEEEELAYFSKLHQRFQREFEDSSEDEEPI---RT 487

Query: 552 NRDVSEYDPLNGEIDSVSSYSDNEDAHHSSEEFLEEVDALGNTVTKKVAKLQS------- 604
           +++V +YDPL G+       S +  +    EE++EE DALGN+V +KV + +        
Sbjct: 488 DKNVKDYDPLGGQY-DSDDSSSDFSSQKEDEEYIEETDALGNSVRRKVVREEDGDGENTV 546

Query: 605 --------------HFGDEDGVEVEIKXXXXXXXXXXXXXXXXXXXIMPPPVNT------ 644
                           G++D  E E                     + PPP+        
Sbjct: 547 SKNLLLDPGNGRGVSGGNKDFEEEEEDDEAGNEGEEEDEAEKEEEVVEPPPIRGYCRNCR 606

Query: 645 ---APIPS-TVPAGPLTYVLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVEEAE 700
               P+P  + PA PLTY LRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETV +V EAE
Sbjct: 607 NFFPPVPKVSKPATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVGIVTEAE 666

Query: 701 VLSTSGVFMLFYEYDYDEATGKMREDLESDLEDENQEEDE 740
           VLST GVFMLFYEYDYDEATGK+R+D+     D+ Q  DE
Sbjct: 667 VLSTPGVFMLFYEYDYDEATGKLRDDV-----DQEQMSDE 701

>KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} similar
           to uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
           Ubiquitin-specific protease that removes ubiquitin from
           ubiquitinated proteins cleaves at the C terminus of
           ubiquitin fusions irrespective of their size capable of
           cleaving polyubiquitin chains
          Length = 771

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/591 (52%), Positives = 404/591 (68%), Gaps = 19/591 (3%)

Query: 34  IILVSTAFFFIKYKSFI----MNNLSHIGDMTRNFNPTNGFRRWMPRGGQVDQHTLDKGG 89
           I L+++ +F  K +  I    ++ +S   ++T+         RW PR  + ++  + +GG
Sbjct: 22  IGLIASLYFLYKNEFDITRVAVSVVSTTKEITQAVRDKIMLGRWAPRNAEQEETIVRRGG 81

Query: 90  YVAGLVNDGNTCFMNSVIQSLASSAELMKFLXXXXXXXXXXXXXXLLQD-EEKPTSVEPD 148
           YV GLVNDGNTCFMNSV+Q LASS EL KF+              + ++ EE     E  
Sbjct: 82  YVGGLVNDGNTCFMNSVLQCLASSKELHKFMDTIILDSNDDSQNTIDENGEESDLPNEQS 141

Query: 149 TIERXXXXXXXXXXXXH---ANRKLANGVSDEEKTPDVTFSLALREMLNKLNTKYYKERP 205
           T+E+                A R+  N +      P++ F+LAL+++ +KLN K+Y+ RP
Sbjct: 142 TVEKKPKATKNKTYGKRKKIAVRQADNELLKNSTEPNMHFTLALQDLFSKLNAKHYRNRP 201

Query: 206 CFKTNKLLKSMTKSPNKNIILGYDQEDAQEFFQTILSELEKNVKSLEGKP-SEATPIPNA 264
            FKTNKLLK+M+K+PN+NIILGYDQEDAQEFFQTILSELEKNV+S+ GKP  +  P+P  
Sbjct: 202 WFKTNKLLKTMSKAPNRNIILGYDQEDAQEFFQTILSELEKNVESIYGKPEKDPKPVPQD 261

Query: 265 ELPKNAVIGQAHLDKVGDVYLPSDQIDPNLVLTNEGKQLYTPFRLVTPLDGITAERIGCL 324
           +LP++A++GQ HL ++GDVY+P++QIDPN VL + G++ Y+P+++VTPLDGITAERIGCL
Sbjct: 262 DLPEDAIVGQEHLGEIGDVYIPTEQIDPNSVLAS-GRKFYSPYKIVTPLDGITAERIGCL 320

Query: 325 QCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLLNQWIKPEIIEGVSCNRCALEAVRDH 384
           QCGENGGIRYSV S +SLNLPS++IGS +KLS LL++W KPEIIEGV CNRCAL AV +H
Sbjct: 321 QCGENGGIRYSVFSGLSLNLPSDNIGSPIKLSQLLDEWSKPEIIEGVDCNRCALNAVLEH 380

Query: 385 LLEQLKQYENKGDSIPEKLLQAFKARVEELNVSLSKPMVSDEDYKRLHTENMTRKCSKSK 444
           L+EQL   +++ D + +KL+   + R+ E+   LSK  + D+DYKR+HTENM RK SKSK
Sbjct: 381 LVEQLNTIQSQPD-VNQKLVTLMEDRINEVKSVLSKLAIDDDDYKRMHTENMVRKSSKSK 439

Query: 445 QILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVLFKSRLNLSPWCCDVDEINLDARLPM 504
           QIL  RPPPLLS+HINRSVFDPRTYMIRKNNSRV+FKS+LNLSPWCC+ D+INLDARLPM
Sbjct: 440 QILISRPPPLLSVHINRSVFDPRTYMIRKNNSRVIFKSKLNLSPWCCNYDKINLDARLPM 499

Query: 505 SKKQEQVQESSEDENLGGEYYAKLHQTY--XXXXXXXXXXXXXXGDRYVN---RDVSEYD 559
           SKKQE   ESSED+N G EYY KLH+ +                G    N   R V E+D
Sbjct: 500 SKKQENWHESSEDDNNGTEYYNKLHRRFEKEFEDSDEEEDGSDNGQGMFNGSSRMVEEHD 559

Query: 560 PLNGEIDSVSSYSDNEDAHHSSEEFLEEVDALGNTVTKKVAKLQSHFGDED 610
            LNGE+ S S  S  +D     E    E+DALGNT+ KK AK     G++D
Sbjct: 560 VLNGELSSASLSSSEDDIAEVEE---VELDALGNTIVKKTAKKPLLGGNQD 607

 Score =  160 bits (404), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 68/82 (82%), Positives = 76/82 (92%)

Query: 647 IPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVEEAEVLSTSG 706
           I S+VPAGPLTYVLRSVIVHYGTHNYGHYIAFR++RGCWWRISDE+VY+V+E EVLST G
Sbjct: 670 IVSSVPAGPLTYVLRSVIVHYGTHNYGHYIAFRRFRGCWWRISDESVYIVDEQEVLSTPG 729

Query: 707 VFMLFYEYDYDEATGKMREDLE 728
           VFMLFYEYDYD  TGKM++D E
Sbjct: 730 VFMLFYEYDYDTETGKMKDDTE 751

>TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON}
           Anc_2.307 YDL122W
          Length = 824

 Score =  563 bits (1450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/550 (52%), Positives = 374/550 (68%), Gaps = 25/550 (4%)

Query: 65  NPTNGFRRWMPRGG-QVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFLXXX 123
           N  +G+R+W+ +   Q+    + +GG+V GLVN+GNTCFMNSV+QSLASS E+++FL   
Sbjct: 7   NDPSGYRKWVTKNNLQIQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVRFLDEE 66

Query: 124 XXXXXXXXXXXLLQDEEKPTSVEPDTIERXXXXXXXXXXXXHANRKLANGVSDEEKTPDV 183
                       L++  K +    +                   +K     +D++ + DV
Sbjct: 67  IIKQFKQKQLQELEELHKKSDSAHNHHNHQQDDKKSKNKSYGKRKKKLTKTNDDDMSTDV 126

Query: 184 TFSLALREMLNKLNTKYYKERPCFKTNKLLKSMTKSPNKNIILGYDQEDAQEFFQTILSE 243
           +FS++L+++L+KLN KYY+ER  ++TN LLK+M+K+PNKNIILGY+QEDAQEFFQTIL E
Sbjct: 127 SFSISLKDLLDKLNDKYYRERKYYRTNNLLKTMSKAPNKNIILGYEQEDAQEFFQTILYE 186

Query: 244 LEKNVKSLEG--KPSEATPIPNAELPKNAVIGQAHLDKVGDVYLPSDQIDPNLVLTNE-G 300
           LEKN+K L+   +  +  PIP ++LP NA+IGQ +L  VG VY+P+  +DPN +L  +  
Sbjct: 187 LEKNIKFLDSDREKLDKKPIPESDLPSNALIGQNNLSHVGTVYIPTAHLDPNSLLDKDPS 246

Query: 301 KQLYTPFRLVTPLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLLN 360
              +TPFRLVTPLDGI AERIGCL CGE GGIRYSV+S +SLNLPSE+IG TLKLS LLN
Sbjct: 247 TNYFTPFRLVTPLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLPSENIGDTLKLSQLLN 306

Query: 361 QWIKPEIIEGVSCNRCALEAVRDHLLEQLKQYENK-GDSIPEKLLQAFKARVEELNVSLS 419
           +W KPEIIEGV+C RC+L AV +HL  QLK    K   SIP+KL+ A K R++ LN +LS
Sbjct: 307 EWCKPEIIEGVNCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRIKALNETLS 366

Query: 420 KPMVSDEDYKRLHTENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVL 479
           KP++ DE+YK++HT+NM RK SKSKQI+  RPPPLLSIHINRSVFD RT+MI+KNNSR+ 
Sbjct: 367 KPVIDDEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKKNNSRLA 426

Query: 480 FKSRLNLSPWCCDVDEINLDARLPMSKKQEQVQE---SSEDENLGGEYYAKLHQTYXXXX 536
           FK+RLNL PWCCDV++INLDARLPMSK Q+  ++   SSEDE +GGEYYAKLH  +    
Sbjct: 427 FKARLNLKPWCCDVNDINLDARLPMSKTQKSEEDGSISSEDETVGGEYYAKLHDKFQKEF 486

Query: 537 XXXXXXXXXXGDRY------VNRDVSEYDPLN-----GEIDSVSSYSDNEDAHHSSEEFL 585
                        Y       NRDV  YDPLN      EI    S +D+ED      E++
Sbjct: 487 EDSDEEQEDGMSDYSDYNMRSNRDVDNYDPLNEDTEHDEIRETVSTTDSED------EYI 540

Query: 586 EEVDALGNTV 595
           EE D LGNT+
Sbjct: 541 EETDKLGNTI 550

 Score =  150 bits (380), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 67/84 (79%), Positives = 74/84 (88%), Gaps = 1/84 (1%)

Query: 645 APIPST-VPAGPLTYVLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVEEAEVLS 703
           AP  ST VP GPLTY LRSVIVHYGTHNYGHYIAFRKYRG WWRISDETV++V+EAEVLS
Sbjct: 658 APTYSTKVPTGPLTYELRSVIVHYGTHNYGHYIAFRKYRGTWWRISDETVHMVDEAEVLS 717

Query: 704 TSGVFMLFYEYDYDEATGKMREDL 727
           T  VFMLFYEYD+DE +G M++DL
Sbjct: 718 TPSVFMLFYEYDFDEKSGMMKDDL 741

>TBLA0B07160 Chr2 complement(1696047..1697201) [1155 bp, 384 aa]
           {ON} Anc_2.307 YDL122W
          Length = 384

 Score =  313 bits (802), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 173/346 (50%), Positives = 231/346 (66%), Gaps = 46/346 (13%)

Query: 216 MTKSPNKNIILGYDQEDAQEFFQTILSELEKNVKSLEGKPSEAT----------PIPNAE 265
           M    N++++LGY Q+DAQEFFQ IL++LEKNVK +E  P +             IP  +
Sbjct: 1   MIDEKNQDVVLGYAQQDAQEFFQAILAKLEKNVKQIEHIPLKEKNKSNQNNILKSIPFEK 60

Query: 266 LPKNAVIGQAHLDKVGDVYLPSDQIDPNLVLTNEG------KQLYTPFRLVTPLDGITAE 319
           LP +A++G  HLDKVG V++P+DQI+PNL+  NE        QL+TPF+L+TPLDGI AE
Sbjct: 61  LPSDALLGHDHLDKVGTVFIPTDQINPNLIKNNESINSSNTNQLFTPFKLITPLDGIIAE 120

Query: 320 RIGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLLNQWIKPEIIEGVSCNRCALE 379
           RIGCL CGENGGIRYSV+SS+SLNLP+     ++ L +LL+ + +PEIIE V+CNRC L 
Sbjct: 121 RIGCLNCGENGGIRYSVSSSLSLNLPNY-TNDSISLYELLSNYTQPEIIEQVNCNRCTLA 179

Query: 380 AVRDHLLEQLKQYENKGDSIPE-------------------------KLLQAFKARVEEL 414
           ++ D +  +LK+  ++  +I +                         KL      R+  +
Sbjct: 180 SMYDSINSKLKELTSEDVNINQIDNNTQEDENSTIEKTSMAINDSNNKLKSVLTERLNTI 239

Query: 415 NVSLSKPMVSDEDYKRLHTENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTYMIRKN 474
           +  LSKP++ D+ +K L T NMT + SKSKQ+L  RPPPLLSIHINRSVFDP TY IRKN
Sbjct: 240 SNVLSKPVIDDDSFKTLSTSNMTCQTSKSKQLLISRPPPLLSIHINRSVFDPTTYQIRKN 299

Query: 475 NSRVLFKSRLNLSPWCCDVDEINLDARLPMSKK----QEQVQESSE 516
           NSRVLF+SRLNL+ +CC++DEINLDARLPM+K+     E++ ESSE
Sbjct: 300 NSRVLFESRLNLNGFCCNIDEINLDARLPMNKRDVTPDEKINESSE 345

>NCAS0G03680 Chr7 complement(682617..684065) [1449 bp, 482 aa] {ON}
           Anc_2.307 YDL122W
          Length = 482

 Score =  139 bits (350), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 132/405 (32%), Positives = 184/405 (45%), Gaps = 77/405 (19%)

Query: 86  DKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFLXXXXXXXXXXXXXXLLQDEEKPTSV 145
           + G  + GL+N+GN+CFMNSV+Q+LAS   L+KFL               L  E   T  
Sbjct: 21  EAGSTLGGLINNGNSCFMNSVLQALASLPSLLKFLE--------------LILETPATQE 66

Query: 146 EPDTIERXXXXXXXXXXXXHANRKLANG--VSDEEKTPDVTFSLALREMLNKLNTKYYKE 203
           EP  +E             +  RK      V  +E    +TF   L  +L KLN K    
Sbjct: 67  EPKHVE---ISKKAQKKSKYGRRKKGRKKQVEPQEDEHSLTFLKLLNGLLKKLNVKC--N 121

Query: 204 RPCFKTNKLLKSMTKSPNKNIILGYDQEDAQEFFQTILSELEKNVKSLEGKPSEATPIPN 263
              F  + LL++    P   + +  DQ+DAQEFFQ IL E++K   SL  K  EAT    
Sbjct: 122 SKSFDCDSLLRA--SGPQFKLDME-DQQDAQEFFQHILLEIDK--VSLPPKYDEAT---- 172

Query: 264 AELPKNAVIGQAHLDKVGDVYLPSDQIDPNLVLTNEGKQLYTPFRLVTPLDGITAERIGC 323
                +           G  Y P    D +  LT           + +P DGI    I C
Sbjct: 173 -----STFTNVLECVNYGVCYFP----DVSKELT-----------IRSPFDGIMKTTIRC 212

Query: 324 LQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLLNQWIKPEIIEGVSCNRCALEAVRD 383
           LQC E     YS+ S+++LNLP        KLS L+++WI+P I+E V+CN+C L     
Sbjct: 213 LQCNEISNAHYSILSNITLNLPHTK-SDCFKLSTLIHRWIEPCILEDVTCNKCTL----- 266

Query: 384 HLLEQLKQYENKGDSIPEKLLQAFKARVEELNVSLSKPMVSDEDYKRLH-TENMTRKCSK 442
                     N+    P+         VEEL   LS   + DED  +L       +K +K
Sbjct: 267 ---------LNRTSRTPD---------VEEL--LLSGKYIEDEDMIKLKIIPEEKKKGNK 306

Query: 443 SKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVLFKSRLNLS 487
            +    ++ P ++S HINRS F  +T+ IRK+N RVLFK +L +S
Sbjct: 307 LRNSYMVQLPHVMSFHINRSRFHKKTFKIRKDNRRVLFKLQLTIS 351

 Score = 94.7 bits (234), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 39/62 (62%), Positives = 50/62 (80%)

Query: 656 LTYVLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVEEAEVLSTSGVFMLFYEYD 715
           + Y L++VI+HYGTHNYGHYI++RK+   WWRISDE+V  V+E EVL++ GVFMLFYE  
Sbjct: 420 IIYDLKAVIIHYGTHNYGHYISYRKFMNQWWRISDESVIEVDEMEVLTSPGVFMLFYEIH 479

Query: 716 YD 717
            D
Sbjct: 480 TD 481

>NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON} 
          Length = 486

 Score =  131 bits (330), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 121/454 (26%), Positives = 201/454 (44%), Gaps = 98/454 (21%)

Query: 91  VAGLVND-GNTCFMNSVIQSLASSAELMKFLXXXXXXXXXXXXXXLLQ----DEEKPTSV 145
           + GL ND GN+CF+NS++QS AS   L++FL              + +     E+KP  +
Sbjct: 5   IGGLNNDDGNSCFINSILQSSASCNYLLQFLDNVIENKTTGTDANVAEFTTTIEKKPKCI 64

Query: 146 EPDTIERXXXXXXXXXXXXHANRKLANGVSDEEKTPDVTFSLALREMLNKLNTKY-YKER 204
               I +            +    LA   S         F + LR++L  +NT+Y +K+ 
Sbjct: 65  ----ISKSKYGKKKKNKKQNQKNPLAEKNSKYHNNE--KFFIELRKLLTNVNTRYTHKKG 118

Query: 205 PCFKTNKLLKSMTKSPNKNIILGYDQEDAQEFFQTILSELEKNVKSLEGKPSEATPIPNA 264
             F T+K + +++   ++ II   DQ+DAQEF Q + ++LEK                  
Sbjct: 119 LSFSTSKFISTLS---SQTIINATDQQDAQEFLQILFNDLEK------------------ 157

Query: 265 ELPKNAVIGQAHLDKVGDVYLPSDQIDPNLVLTNEGKQLYTPFRLVTPLDGITAERIGCL 324
                             ++  + +I  N  L           ++ TP +GI   R+ CL
Sbjct: 158 ----------------SQIFHTTVKITSNDAL-----------QIKTPFEGILMARMKCL 190

Query: 325 QCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLLNQ-WIKPEIIEGVSCNRCALEAVRD 383
            C E     + + S+++L+LP      T   +D+L+  W + + +E VSCNRC L     
Sbjct: 191 TCDEISNPNFKLFSNLTLSLPRYSKQETF--NDILSTFWNQLDYVENVSCNRCTL----- 243

Query: 384 HLLEQLKQYENKGDSIPEKLLQAFKARVEELNVSLSKPMVSDEDYKR-LHTENMTR-KCS 441
                               L+   +  E  N+ L K ++ D+D +  L  +N+   K +
Sbjct: 244 --------------------LKHANSNSEYQNL-LVKDVIKDDDMENILKRDNLEMVKSN 282

Query: 442 KSKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVLFKSRLNLSPWCCDVDEINL--- 498
           K KQI  L+PP +LS H NRS+FD + +  +KNN +VL   +LN+S +C    ++ +   
Sbjct: 283 KIKQIKILKPPKILSFHFNRSIFDRKQFKFKKNNCKVLLTPKLNISKFCIVDSDLAVDVA 342

Query: 499 DARLPMSKKQEQVQESSEDENLGGEYYAKLHQTY 532
           D   P    + +   S +D+    +YY KLHQ+Y
Sbjct: 343 DGYAPDFYYKNKNGNSEKDK----KYYEKLHQSY 372

 Score = 90.9 bits (224), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 49/65 (75%)

Query: 651 VPAGPLTYVLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVEEAEVLSTSGVFML 710
           +      Y L+S++VHYG+H+YGHYI++R++   WWRISDE+V  V+E EV S SG+F++
Sbjct: 421 IGNNKCVYSLKSIVVHYGSHDYGHYISYRRFEDQWWRISDESVLKVDEDEVFSASGIFIV 480

Query: 711 FYEYD 715
           FYE D
Sbjct: 481 FYEQD 485

>Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar to
           Ashbya gossypii AEL242W
          Length = 696

 Score = 57.8 bits (138), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 107/423 (25%), Positives = 161/423 (38%), Gaps = 94/423 (22%)

Query: 90  YVAGLVNDGNTCFMNSVIQSLASSAELMKFLXXXXXXXXXXXXXXLL---QDEEKPTSVE 146
           Y  GL N  N CF NS IQ+LAS   L ++L               L   +D+    S  
Sbjct: 82  YTTGLTNSRNDCFANSSIQALASLPALAEYLNGVTEVVRSTRQALGLLVPRDDAADFSDH 141

Query: 147 PDTIERXXXXXXXXXXXXHANRKLANG-------VSDEEKTPDVTFSLALREMLNKLN-- 197
                +             AN   ANG       V+ +   PD+    AL  M++ L   
Sbjct: 142 GGMPSKKSASPFTDPAAVSANCAAANGKEPEGNHVTPDLLLPDLRMHEALSIMIHNLQQP 201

Query: 198 TKYYKERPCFKTNKLLKSMTKSPNKNIILGYDQEDAQEFFQTILSELEKNVKSLEGKPSE 257
            K Y +        LL ++ +  N  I  G  Q DA EF Q +   LEK   +L      
Sbjct: 202 VKNYTQT---SLQPLLHTLEQIHNAKISSG--QNDAHEFSQILFETLEKERLAL------ 250

Query: 258 ATPIPNAELPKNAVIGQAHLDK--VGDVYLPSDQIDPNLVLTNEGKQLYTPFRLVTPLDG 315
                           +  L+K  + D+ +P                         P  G
Sbjct: 251 ----------------KTFLEKQQLSDIRIPE-----------------------FPFQG 271

Query: 316 ITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLL--NQWIKPEIIEGVSC 373
             A  + CL+C  +  +     +  SL +P     S+  L D++  NQ    E IEG SC
Sbjct: 272 SLATNLICLRCNNSSKVNVHRFTMHSLPVPQM---SSASLKDMMFDNQT---ETIEGYSC 325

Query: 374 NRCALEAVRDHLLEQLKQYENKGDSIPEKLLQAFKARVEELNVSLSKPMVSD------ED 427
             C L A+ ++  E+ + Y N        + Q  +A++++L   L +  ++D      E 
Sbjct: 326 ISCRLRAILNN--ERQRDYHN--------VSQEERAKLDDLAKLLPRICINDDLPEPLEL 375

Query: 428 Y-KRLHTENMTRKCSKS---KQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVLFKSR 483
           Y K  H +       KS   K+ + +  P +L +H++RSVFD  TY   KN+  VLF   
Sbjct: 376 YVKSYHKDGCHIPSLKSRILKRTVVVSSPKVLLLHLSRSVFDGVTYT--KNSCNVLFPED 433

Query: 484 LNL 486
           L L
Sbjct: 434 LIL 436

>TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {ON}
           Anc_8.540 YPL072W
          Length = 482

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 95/206 (46%), Gaps = 31/206 (15%)

Query: 295 VLTNEGKQLYTPFRLVT--------PLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPS 346
           VL NE ++L      +T        P +G     + CL+CG N  ++      ++LNLP+
Sbjct: 177 VLHNEYQELIRLMNFITNNLDIPTYPFEGKYCHELTCLKCGRNSEVKMFDFDILTLNLPA 236

Query: 347 EDIGSTLKLSDLLNQWIKPEIIEGVSCNRCALEAVRDHLLEQLKQYENKGDSIP--EKLL 404
           +    ++ L +L++     ++IEG SC  C + A+              G   P    L+
Sbjct: 237 Q---PSISLDELISGS-NSDVIEGFSCTVCKVSAILG----------GTGTHNPNTRSLI 282

Query: 405 QAFKARVEEL--NVSLSKPMVSDEDYKRLHTENMTR--KCSKSKQILFLRPPPLLSIHIN 460
           ++ K    EL  N  L +P+ S  D    H   +TR  K +  K+ +F+  P +L IH+ 
Sbjct: 283 KSLKEIFPELKINTELDEPLNSFVD-SYSHDGVITRNIKSTIVKKTVFVEVPDILLIHLT 341

Query: 461 RSVFDPRTYMIRKNNSRVLFKSRLNL 486
           RS+F+  +Y   +N  ++ +  +L L
Sbjct: 342 RSMFNGMSYT--RNACKIAYDEKLLL 365

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 24/51 (47%), Gaps = 2/51 (3%)

Query: 70  FRRWMPRGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           FR      G       DK  Y  GL+N GN CF+NS +Q LA S     +L
Sbjct: 49  FRVLFRSSGNKASLRYDK--YTTGLINKGNDCFINSSLQGLAGSQRFNHYL 97

>Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072W
           (REAL)
          Length = 503

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/183 (27%), Positives = 86/183 (46%), Gaps = 16/183 (8%)

Query: 312 PLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLLNQWIKPEIIEGV 371
           P +G T++ + C+QC     I +  T    L++P +   S+  L D+L+   + EIIE  
Sbjct: 212 PFEGETSKFLVCVQCNGLSKISHQKTFIRELSVPQK---SSENLLDILSN-DETEIIEDY 267

Query: 372 SCNRCALEAVRDHLLEQLKQYENKGDSIPEKLL--QAFKARVEELNVSLSKPMVSDEDYK 429
           SC  C   A+  H     +QY N  D  P++LL   A K    E +++   P+  D+   
Sbjct: 268 SCLICRARAILAH-----EQYRNFKDCAPDELLILDALKDYATEASINEDLPLEIDQYIN 322

Query: 430 RLHTENMTRKCSKSKQI---LFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVLFKSRLNL 486
               +       K K I   + ++ P +L IH++RS F+  TY   +N   V F+  + L
Sbjct: 323 HYTKDKFCISNVKGKVIKRDIAVKLPKVLVIHLSRSTFNGVTY--SRNPCNVKFQEEIKL 380

Query: 487 SPW 489
           + +
Sbjct: 381 TEY 383

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 19/25 (76%)

Query: 656 LTYVLRSVIVHYGTHNYGHYIAFRK 680
           + Y L+SV+ H G+H+ GHY+ +R+
Sbjct: 397 IVYNLKSVVKHTGSHSRGHYMCYRR 421

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 92  AGLVNDGNTCFMNSVIQSLASSAELMKFL 120
            GL+N GN CF+ S +Q+LA     +++L
Sbjct: 58  VGLINRGNDCFITSALQALAGIPRFVEYL 86

>Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072W
           (REAL)
          Length = 501

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 88/183 (48%), Gaps = 16/183 (8%)

Query: 312 PLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLLNQWIKPEIIEGV 371
           P +G T++ + CLQC       Y  T    L++P +   S   L+ L N   + EIIE  
Sbjct: 204 PFEGETSKFLVCLQCKGLSKPSYQQTFIRELSVPQQT--SEKLLTILAND--ETEIIEDY 259

Query: 372 SCNRCALEAVRDHLLEQLKQYENKGDSIPEKLL--QAFKARVEELNVSLSKPMVSDEDYK 429
           SC+ C + A+ +H     ++Y N  D  PE+LL  +A K    + +++   P   ++  K
Sbjct: 260 SCSICQIRAILNH-----ERYRNFKDCTPEELLMIEALKNYATKASINEDLPPELEQYIK 314

Query: 430 RLHTENMTRKCSKSKQI---LFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVLFKSRLNL 486
           R   + +     K K I   + ++ P +L +H++RS F+  TY   +N   V F  R+ L
Sbjct: 315 RYSKDKLHISKVKGKIIKKDVAVQLPDILVVHLSRSTFNGITYC--RNPCNVEFGERVKL 372

Query: 487 SPW 489
             +
Sbjct: 373 PEY 375

 Score = 34.7 bits (78), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 19/25 (76%)

Query: 656 LTYVLRSVIVHYGTHNYGHYIAFRK 680
           + Y L+SV+ H G+H+ GHYI +R+
Sbjct: 389 VKYNLKSVVKHTGSHSRGHYICYRR 413

>SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} similar
           to gnl|GLV|KLLA0E23463g Kluyveromyces lactis
           KLLA0E23463g and some similarites with YPL072W
           uniprot|Q02863 Saccharomyces cerevisiae YPL072W UBP16
           Putative ubiquitin-specific protease
          Length = 767

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 86/179 (48%), Gaps = 14/179 (7%)

Query: 312 PLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLLNQWIKPEIIEGV 371
           P+ G  A+ + CL C ++  +     S   L +P E   ST  L+D+++   + E IEG 
Sbjct: 317 PVRGSLADHLVCLNCRDSSKVNVHPFSMYPLPVPQE---STAVLADMISDN-QTETIEGY 372

Query: 372 SCNRCALEAVRDHLLEQLKQYENKGDSIPEK-LLQAFKARVEEL--NVSLSKPMVS-DED 427
           SC  C + A+    L   KQ    G S  E+ +LQ  +  + ++  N  LS  + +  ++
Sbjct: 373 SCLSCKIRAI----LSNEKQRNFAGTSESERNVLQTLEKILPDIFINDDLSAELTTYIDN 428

Query: 428 YKRLHTENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVLFKSRLNL 486
           Y +        K +  K+ + +  P LL IH++RSVF+   Y   +N+  V F+  L L
Sbjct: 429 YNKDGVNTSILKSTIVKKTVVVDSPELLIIHLSRSVFNGMNYT--RNSCNVAFEEDLGL 485

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 90  YVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           Y  GL+N+ N CF NS +Q+L+S  +L  +L
Sbjct: 73  YTTGLINNRNDCFANSSVQALSSLPKLTLYL 103

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
           weakly similar to uniprot|P36026 Saccharomyces
           cerevisiae YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 89/191 (46%), Gaps = 28/191 (14%)

Query: 310 VTPLD----GITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIG-----STLKLSDLLN 360
           ++P+D    G    ++ C  C E+    +S    +SLN+P E         T++L D +N
Sbjct: 360 LSPIDLLFRGDVESKLICKHCNESAST-FSSFYILSLNIPKEKSSLFFKSKTIRLEDCIN 418

Query: 361 QWIKPEIIEG---VSCNRCALEAVRDHLLEQLKQYENKGDSIPE-----KLLQAFKARVE 412
            + + EI+ G    +C  C  +A R ++++  K Y+ K  +I +     +     +A   
Sbjct: 419 LFTRKEILTGENSWACPSCETKA-RYNVIDNDKTYQQKHTNIGKHSKFPRFFSHIEAGKT 477

Query: 413 ELNVSLSKPMVSDEDYKRLHTENMTRKCSKSKQIL---FLRPPPLLSIHINRSVFDPRTY 469
           E N   +K   S   Y  L  E   R+  KS+ IL   F+  PP+L IH++R  +D    
Sbjct: 478 ERNSGANK--FSQLKYDNLENEQRHRQQKKSETILSVSFVSLPPILVIHLSRFCYD---- 531

Query: 470 MIRKNNSRVLF 480
           + +KN S + +
Sbjct: 532 ISKKNTSNISY 542

>Suva_16.240 Chr16 (429066..430637) [1572 bp, 523 aa] {ON} YPL072W
           (REAL)
          Length = 523

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 88/183 (48%), Gaps = 16/183 (8%)

Query: 312 PLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLLNQWIKPEIIEGV 371
           P  G T++ + CLQC       Y  +    L +P       +K+  L N   + EIIEG 
Sbjct: 224 PFQGQTSKFLSCLQCHRLSKPSYQESFIRELMVPQRSSEKLMKI--LAND--ETEIIEGY 279

Query: 372 SCNRCALEAVRDHLLEQLKQYENKGDSIPEKLLQAFKARVEELNVSLSKPMVSDEDYK-- 429
           SC  C + A+ +H  E+ + ++N       ++L A K    + +++   P+  ++  K  
Sbjct: 280 SCLICQVRAILNH--EKYRTFKNCSQD-ELRILDALKNYANDASINEDLPIKVEQYIKHY 336

Query: 430 ---RLHTENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVLFKSRLNL 486
              +L T N+  K +  K+ + ++ P +L IH++RS F+  TY   +N   V F+  + L
Sbjct: 337 AKDKLRTSNV--KSTVIKKDIAVQLPEVLVIHLSRSTFNGMTYT--RNPCNVEFEETIKL 392

Query: 487 SPW 489
           + +
Sbjct: 393 AEY 395

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%)

Query: 88  GGYV-AGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           G Y   GL+N+GN CF+ S +QSLA     +++L
Sbjct: 63  GKYTTVGLINNGNDCFITSSLQSLAGIPRFVEYL 96

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 6/37 (16%)

Query: 649 STVPAGP------LTYVLRSVIVHYGTHNYGHYIAFR 679
           +++  GP      + Y L+SV+ H G+H+ GHY+ +R
Sbjct: 396 TSIEKGPSAEYRQIEYHLKSVVKHTGSHSRGHYVCYR 432

>YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}
           UBP16Deubiquitinating enzyme anchored to the outer
           mitochondrial membrane, probably not important for
           general mitochondrial functioning, but may perform a
           more specialized function at mitochondria
          Length = 499

 Score = 51.2 bits (121), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 89/188 (47%), Gaps = 26/188 (13%)

Query: 312 PLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLLNQWIKPEIIEGV 371
           P +G T++ + CL+C       Y  T    L++P +   ++  LS++L    + EII+  
Sbjct: 204 PFEGETSKFLVCLKCKGLSEPSYKQTFIRELSVPQQ---TSENLSNILAHD-ETEIIDDY 259

Query: 372 SCNRCALEAVRDHLLEQLKQYENKGDSIPEKLLQ-------AFKARVEELNVSLSKPMVS 424
           SC  C + A+ +H     ++Y N  D  P+++L        A KA + E     + P   
Sbjct: 260 SCLICQIRAILNH-----EEYRNFKDCTPDEILMLDRLKNYATKAPINE-----NLPFEV 309

Query: 425 DEDYKRLHTENMTRKCSKSKQI---LFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVLFK 481
           ++  KR    N+     K K I   + ++ P +L +H++RS F+  TY   +N   V F 
Sbjct: 310 EQYVKRYSKGNLQVSNIKGKVIKKDVVVQLPDILIVHLSRSTFNGITY--SRNPCNVKFG 367

Query: 482 SRLNLSPW 489
            R+ LS +
Sbjct: 368 ERITLSEY 375

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 24/39 (61%)

Query: 656 LTYVLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVY 694
           + Y L+SV+ H G+H+ GHY+ +R+     +   DE+ +
Sbjct: 389 VKYNLKSVVKHTGSHSSGHYMCYRRKTEIRFGKEDESSF 427

>AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL072W (UBP16)
          Length = 613

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 97/436 (22%), Positives = 151/436 (34%), Gaps = 96/436 (22%)

Query: 73  WM-PRGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFLXXXXXXXXXXX 131
           W+ P    + Q +  K  +  GL N+ N CF NS IQ+ AS   +  +L           
Sbjct: 55  WLFPGSSAMFQSSTRKDKHTTGLANNRNDCFANSSIQAWASLPAVSVYLNEIMEIRKEVL 114

Query: 132 XXXLLQDEEKPTSVEPDTIERXXXXXXXXXXXXH---------ANRKLANGVSDEEKTPD 182
              +   +        D                H             L+NGV       D
Sbjct: 115 RRMVRSSDGAHDGAAADEWGEVKAPSPEHKSEAHDMHDSGDHVGQMNLSNGV-------D 167

Query: 183 VTFSLALREMLNKLNTKYYKE-----RPCFKTNKLLKSMTKSPNKNIILGYDQEDAQEFF 237
           V    AL ++L +L     K      +P   T +L+ S          L   Q DA EF 
Sbjct: 168 VRMHAALADILYQLQQPVAKSTFISLQPLLHTLELIYSAK--------LSRGQNDAHEFT 219

Query: 238 QTILSELEKNVKSLEGKPSEATPIPNAELPKNAVIGQAHLDKVGDVYLPSDQIDPNLVLT 297
           Q +L  LEK    L                         L   GD  L            
Sbjct: 220 QLLLETLEKEHTELS------------------------LMLKGDKRL------------ 243

Query: 298 NEGKQLYTPFRLVTPLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSD 357
            EG  L  P     P+ G  A+ + CL+CG +  +     S  +L +P+    ++  L D
Sbjct: 244 -EG--LAVP---AFPIRGSLADNLVCLRCGGSSKVNVHQFSMHTLPVPN---ATSADLRD 294

Query: 358 LL--NQWIKPEIIEGVSCNRCALEAVRDHLLEQLKQYENKG----DSIPEKLLQAFKARV 411
           +L  NQ    E I+  +C  C + A+       L   +N+G    DS    +++      
Sbjct: 295 MLFDNQ---TETIDDYTCVSCQIRAI-------LATEKNRGRQGVDSTELAIIEELARLA 344

Query: 412 EELNVSLSKP---MVSDEDYKRLHTENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRT 468
             ++++   P         Y + H      K +  K+ + +  P +L +H++RSVF+  +
Sbjct: 345 PSISINEDMPPHLAAYVSAYNKDHCITAALKSTIVKRTVSVDSPRVLILHLSRSVFNGVS 404

Query: 469 YMIRKNNSRVLFKSRL 484
           Y   KN   V F   L
Sbjct: 405 YA--KNTCNVTFPEEL 418

 Score = 32.0 bits (71), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 658 YVLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVEEAEVLSTSGV 707
           Y L ++I H GTH+ GHY  FR      +R    T  ++  ++V+S+  V
Sbjct: 438 YKLCAMIKHIGTHSQGHYACFRHKPD--FRKDPRTGEIIIRSDVISSDAV 485

>KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.540
           YPL072W
          Length = 498

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 85/184 (46%), Gaps = 23/184 (12%)

Query: 312 PLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLLNQWIKPEIIEGV 371
           P +G+++  + CLQC +     +S    + + +P      + KL+DL+    + EIIEG 
Sbjct: 200 PFEGVSSNYLMCLQCNKYSQTIHSPFLMLEVAVPG---NYSEKLTDLILH-SQDEIIEGY 255

Query: 372 SCNRCALEAV--RDHLLEQLKQYENKGDSIPEKLLQAFKARVEELNVSLSKPMVSDEDYK 429
           SC  C +  +   +  L QL +Y  +  SI   L      R + L + ++  + +D  + 
Sbjct: 256 SCLYCKVNMILKNEKYLNQLPEYSQEEQSILNFL------RNQILTLYINDDLPADVSFY 309

Query: 430 RLH-------TENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVLFKS 482
             H       T N      K   +  ++ P  L +H++RS+F+  T  I ++  RV ++ 
Sbjct: 310 VDHYSKNGCVTANFKSNIIKKNAV--IKEPASLIVHLSRSIFNGAT--ITRSACRVEYEQ 365

Query: 483 RLNL 486
            LNL
Sbjct: 366 SLNL 369

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 18/26 (69%)

Query: 655 PLTYVLRSVIVHYGTHNYGHYIAFRK 680
           P+ Y L+SV+ H G+H  GHY  +RK
Sbjct: 384 PIKYELKSVVKHTGSHVQGHYQCYRK 409

>AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR223W (UBP8)
          Length = 469

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 72/174 (41%), Gaps = 31/174 (17%)

Query: 87  KGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFLXXXXXXXXXXXXXXLLQDEEKPTSVE 146
           +G  + GLVN G+TCFM+SVIQ+      +++++               +QD     S  
Sbjct: 132 RGEGLLGLVNMGSTCFMSSVIQTFLHLPHVLQYMLERLHYATCD-----VQDSLSCISCA 186

Query: 147 PDTIERXXXXXXXXXXXXHANRKLANGVSDEEKTPDVTFSLALREMLNKLNTKYYKERPC 206
            D I                  + A+GV+    +       AL + L+K    +     C
Sbjct: 187 VDEI--------VANLYGQVKEEAASGVAGPGASTQ-----ALSQSLSKQQQGFINLLTC 233

Query: 207 -FKTNKLLKSMTKSPNKNIILGYDQEDAQEFFQTILSELEKNVKSLEGKPSEAT 259
            +K N+ L             GY Q+DA EF+Q +L++L  +   + G PS+ +
Sbjct: 234 SWKINRNLA------------GYSQQDAHEFWQFLLNQLHTDYIRIHGPPSKKS 275

 Score = 37.0 bits (84), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 2/68 (2%)

Query: 646 PIPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAFRKYRG-CWWRISDETVYVVEEAEVLST 704
           P+    P   LT+ L ++I H GT + GHY    +  G  W + +D  V ++ E ++L  
Sbjct: 400 PMDDQHPVPNLTFKLSAIIPHQGTVDKGHYTTICRINGDVWAKFNDSMVTLISEEDMLKE 459

Query: 705 SGVFMLFY 712
              ++L+Y
Sbjct: 460 QA-YLLYY 466

>KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa]
           {ON} some similarities with uniprot|Q02863 Saccharomyces
           cerevisiae YPL072W UBP16 Putative ubiquitin- specific
           protease
          Length = 752

 Score = 47.8 bits (112), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 86/180 (47%), Gaps = 18/180 (10%)

Query: 312 PLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLL--NQWIKPEIIE 369
           P+ G  A+ + CL C  +  +     +  SL +P E   S   LS ++  NQ    E I+
Sbjct: 309 PVKGSLADHLICLNCQGSSKVNMHPFTMYSLPVPQEPSAS---LSAMIADNQ---TETID 362

Query: 370 GVSCNRCALEAVRDHLLEQLKQYENKGDSIPEKLLQAFKARVEE---LNVSLSKPMVS-D 425
           G SC  C ++A+    L   +Q  +KG+S  E+ + A  +R+     +N  LS  + +  
Sbjct: 363 GYSCLSCKIKAI----LANEEQRGSKGNSDEEQNILATLSRIISEIFINDDLSDELTNYV 418

Query: 426 EDYKRLHTENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVLFKSRLN 485
            +YK+   E  + K    K+ +    P +L +H++RSVF+   Y   +N+  V F   L+
Sbjct: 419 NNYKKDGCETSSIKSRIVKKTVVTESPEILILHLSRSVFNGTNYT--RNSCYVNFDEELH 476

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 651 VPAGPLTYVLRSVIVHYGTHNYGHYIAFRK 680
           V   P+ Y L+S++ H GTH+ GHY  FR+
Sbjct: 488 VGVKPIKYKLKSMVKHQGTHSQGHYECFRR 517

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 20/31 (64%)

Query: 90  YVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           Y  GL+N+ N CF NS +Q+ +S  +L  ++
Sbjct: 69  YTTGLINNRNDCFANSSVQAFSSLPKLTMYM 99

>KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa]
           {ON} some similarities with uniprot|Q02863 Saccharomyces
           cerevisiae YPL072W UBP16 Putative ubiquitin-specific
           protease
          Length = 782

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/183 (27%), Positives = 84/183 (45%), Gaps = 26/183 (14%)

Query: 312 PLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLLNQWIKPEIIEGV 371
           P+ G  A+ + CL CGE+  +     +  SL +P + I + L      NQ    + I G 
Sbjct: 312 PVHGSLADSLFCLSCGESSKVNIHEFTMYSLPVP-QLINADLAQMISDNQ---TDQISGY 367

Query: 372 SCNRCALEAVRDHLLEQLKQYENKGDSIPEKLLQAFKARVEELNVSLSKPMVSDEDYKRL 431
           SC  C L A+  +  E+ + Y+N  D   + L +     +EEL   L K  ++D+  + L
Sbjct: 368 SCLCCKLNAIIAN--EKNRNYQNNSDEENQILKE-----LEEL---LPKAFINDDLARNL 417

Query: 432 HT----------ENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVLFK 481
            T          +    K +  K+ + +  P +L +H++RSVFD   Y  +KN   V F+
Sbjct: 418 STYINSYEKGGIKTSEIKSTIVKKTVVVDSPDVLILHLSRSVFDGMGY--QKNTCNVSFE 475

Query: 482 SRL 484
             L
Sbjct: 476 EEL 478

 Score = 35.8 bits (81), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (67%)

Query: 90  YVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           +  GL+N+ N CF NS IQ+L+S   L K+L
Sbjct: 71  FTTGLINNRNDCFANSSIQALSSLVYLTKYL 101

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%), Gaps = 1/30 (3%)

Query: 685 WWRISDETVYVVEEAEVLS-TSGVFMLFYE 713
           WWRISD  V   + +++LS T  V+ML+YE
Sbjct: 748 WWRISDTKVKEYKTSDILSETKFVYMLYYE 777

>Kwal_27.12030 s27 complement(1056215..1058464) [2250 bp, 749 aa]
           {ON} YPL072W (UBP16) - putative deubiquitinating enzyme
           [contig 24] FULL
          Length = 749

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 81/177 (45%), Gaps = 12/177 (6%)

Query: 312 PLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLLNQWIKPEIIEGV 371
           P+ G  A+ + CL C  +  +     +   L +P E   S L+     NQ    E IEG 
Sbjct: 311 PVKGCLADHLICLNCQGSSKVNLHPFTMYPLPVPQEHTAS-LEAMIAGNQ---TETIEGY 366

Query: 372 SCNRCALEAVRDHLLEQLKQYENKGDSIPEKLLQAFKARVEEL--NVSLSKPMVS-DEDY 428
            C  C ++A+     E+ ++YE   D     +L      V E+  N  LS  +++   +Y
Sbjct: 367 GCLSCKIKAIL--ATEEQRKYEGNPDE-ENNILATLSKIVSEIFINDDLSDDLMNYINNY 423

Query: 429 KRLHTENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVLFKSRLN 485
           K+   +  T K +  K+ +    P +L +H++RSVF+   Y   +N+  V F+  L+
Sbjct: 424 KKDGCDTSTLKSTIVKKTVVTESPDILILHLSRSVFNGMNYT--RNSCYVTFEEELH 478

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 21/31 (67%)

Query: 90  YVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           Y  GL+N+ N CF NS +Q+L++  +L  +L
Sbjct: 69  YTTGLINNRNDCFANSSVQALSALPKLTTYL 99

 Score = 33.1 bits (74), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 20/30 (66%)

Query: 651 VPAGPLTYVLRSVIVHYGTHNYGHYIAFRK 680
           V   P+ Y L++++ H GTH+ GHY  +++
Sbjct: 490 VGVKPIKYKLKAMVKHEGTHSQGHYECYKR 519

>NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa]
           {ON} Anc_8.188 YDR069C
          Length = 826

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 38/83 (45%), Gaps = 5/83 (6%)

Query: 638 MPPPVNTAPIPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVY 694
           +PP  N  P PS     P  Y L +V  H G    GHY A+     YRG W+R  D +  
Sbjct: 746 LPPNFNEPP-PSRGQTPPFKYKLNAVSCHSGNLGSGHYTAYVDKGLYRG-WFRFDDASYR 803

Query: 695 VVEEAEVLSTSGVFMLFYEYDYD 717
            V+      T   ++LFY+  Y+
Sbjct: 804 PVKFGTEFLTPDAYLLFYQRIYE 826

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 75/184 (40%), Gaps = 31/184 (16%)

Query: 230 QEDAQEFFQTILSELEKNVKSLEGKPSEATPIPNAELPKNAVIGQAHLDKVGDVYLPSDQ 289
           ++D QEF + +L  L +++    G P           PK     +A L +   + + S+ 
Sbjct: 556 EQDCQEFCEFLLDGLHEDLNQCSGNPR----------PKELSANEAELRESLSMRIASEI 605

Query: 290 IDPNLVLTNEGKQLYTPFRLVTPLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDI 349
              + + TN     ++P  ++    G  A R+ CL C ++    Y   S +S+ +PS   
Sbjct: 606 EWESFLTTN-----FSP--IINLFQGQYASRLQCLIC-QHTSTTYQPFSLLSIPVPSMVF 657

Query: 350 --GSTLKLSDLLNQWIKPEII---EGVSCNRCALEAVRDHLLEQLKQYENKGDSIPEKLL 404
             G T  + D   ++ K E +   E   C +C  + +    L        K   +P+ L+
Sbjct: 658 SNGQTCNILDCFKEFTKCERLDNDEKWFCPKCRRKQISTKQL--------KITRLPKNLI 709

Query: 405 QAFK 408
             FK
Sbjct: 710 IHFK 713

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
           UBP13Putative ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 747

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 50/99 (50%), Gaps = 15/99 (15%)

Query: 658 YVLRSVIVHYGTH-NYGHYIAFRKY-RGCWWRISDETVYVVEEAEVLSTSG-------VF 708
           Y L  ++VH G    +GHY++  K+ +  W    DETV  V+E  VL  +G        +
Sbjct: 602 YELAGIVVHMGGGPQHGHYVSLCKHEKFGWLLFDDETVEAVKEETVLEFTGESPNMATAY 661

Query: 709 MLFYEYDYDEATGKMREDLESDLEDENQEEDEKLDGEIE 747
           +LFY+  Y  A  K      +D E+  +E+D+ +D  I+
Sbjct: 662 VLFYKAMYSNAVEK------NDRENMAKEQDDNIDNLIK 694

>Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON}
           YDR069C (REAL)
          Length = 926

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 35/82 (42%), Gaps = 2/82 (2%)

Query: 637 IMPPPVNTAPIPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDETVY 694
           + PP VN   +P      P  Y L  V  H+GT   GHY A+ K   R  W    D    
Sbjct: 843 VFPPGVNDDELPVRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGLRKGWLYFDDTKFK 902

Query: 695 VVEEAEVLSTSGVFMLFYEYDY 716
            V+    ++ S  ++LFY   Y
Sbjct: 903 PVKNKTDVTNSNAYVLFYHRVY 924

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 19/31 (61%)

Query: 90  YVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           +  GL N GN+C+MN +IQ +  + EL +  
Sbjct: 560 FAVGLENLGNSCYMNCIIQCILGTHELTQIF 590

>KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.69
           YNL186W
          Length = 784

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 41/77 (53%), Gaps = 3/77 (3%)

Query: 655 PLTYVLRSVIVHYG-THNYGHYIAFRKY-RGCWWRISDETVYVVEEAEVLSTSGVFMLFY 712
           P+ Y L SV+VH G + + GHYIA  K   G W    DE +  + E +VL  S  + L Y
Sbjct: 642 PVKYQLISVVVHEGRSLSSGHYIAHCKQPDGSWSTYDDEYINKITERDVLRESNAYYLVY 701

Query: 713 EYDYDEATGKMREDLES 729
                +A  K+R+DL S
Sbjct: 702 TRLTSKAI-KLRDDLSS 717

>Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223W
           (REAL)
          Length = 471

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 656 LTYVLRSVIVHYGTHNYGHYIAFRKYRGC-WWRISDETVYVVEEAEVLSTSGVFMLFY 712
           + Y L  ++ H GT N GHYIAF K  G  W++ +D  V  + + EVL     ++LFY
Sbjct: 409 IIYELIGIVSHRGTVNEGHYIAFCKISGGQWFKFNDSVVTSIAQGEVLKEQA-YLLFY 465

>Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] {ON}
            YOR124C (REAL)
          Length = 1278

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 42/83 (50%), Gaps = 18/83 (21%)

Query: 658  YVLRSVIVHYGTHNYGHYIAF---RKYRGCWWRISDETVYVVEEAEVL-----STSGVFM 709
            Y L SV +H G  +YGHY  +   R Y G W + +DET+  V+E EV      +T+  + 
Sbjct: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETISEVQEEEVFNFNEGNTATPYF 1258

Query: 710  LFYEYDYDEATGKMREDLESDLE 732
            L Y          +++  ESD+E
Sbjct: 1259 LVY----------VKQGQESDIE 1271

 Score = 35.8 bits (81), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 27/43 (62%)

Query: 78  GQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           G +D ++L    +  G+ N GNTC++NS++Q   S A L +++
Sbjct: 722 GTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYI 764

>NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69
          Length = 875

 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 34/67 (50%), Gaps = 2/67 (2%)

Query: 648 PSTVPAGPLTYVLRSVIVHYG-THNYGHYIAF-RKYRGCWWRISDETVYVVEEAEVLSTS 705
           PS     P+ Y L SV+VH G + + GHYIA  R+  G W    DE +  + E  VL  +
Sbjct: 681 PSGTKQLPVKYELLSVVVHEGRSLSSGHYIAHCRQPDGSWATYDDEYINKISELNVLKEA 740

Query: 706 GVFMLFY 712
             + L Y
Sbjct: 741 NAYYLLY 747

>NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.540
           YPL072W
          Length = 494

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 69/165 (41%), Gaps = 11/165 (6%)

Query: 309 LVTPLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLLNQWIKPEII 368
           L  P  GI    + CLQCG    +         L LP +    ++KLSDL+N   + E I
Sbjct: 187 LTVPFKGIVGNHLVCLQCGRTSHVNEQPFYIYELTLPQQ---GSVKLSDLVNGE-QMETI 242

Query: 369 EGVSCNRCALEAVRDHLLEQLKQYENKGDSIPE-KLLQAFKARVEELNVSLSKPMVSDE- 426
           E  SC  C   A+   L  + ++  N   +  E  +L+  K ++  L ++   P      
Sbjct: 243 ENYSCMYCKTVAM---LTNEREEKSNVSRTDAELNILKFLKGKLSTLLINEELPEHITHY 299

Query: 427 --DYKRLHTENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTY 469
              Y + +      K    ++  F   P +  IH++RSVF+   Y
Sbjct: 300 INSYNKGYCNTSEIKSVIVRKSTFAEFPEIFLIHLSRSVFNGMNY 344

 Score = 35.4 bits (80), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 23/36 (63%), Gaps = 2/36 (5%)

Query: 85  LDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           LDK  +  GLVN GN CF+NS IQ+L    +L  +L
Sbjct: 71  LDK--FTTGLVNPGNDCFINSSIQALVPLDKLTTYL 104

>NDAI0E02820 Chr5 (598119..599606) [1488 bp, 495 aa] {ON} Anc_8.540
           YPL072W
          Length = 495

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 87/191 (45%), Gaps = 32/191 (16%)

Query: 311 TPLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLLNQWIKPEIIEG 370
            P+ G+    + C++CG    I+  + S   LN+P     S+ KL+D+++   + E IEG
Sbjct: 189 VPMKGVVGNHLICIRCGHISQIKEEMFSIYELNVPQ---CSSSKLTDIIHNN-QLEKIEG 244

Query: 371 VSCNRCALEAVRDHLLEQLKQYENK----GDSIPEKLLQAFKARVEELNVSLSKPMVSDE 426
            SC  C +  +  +     + Y N     GD   ++ L+  K       V L+  M++ E
Sbjct: 245 YSCLYCEINMILKN-----ENYRNSDGFTGDDEEKRKLRYLKE------VFLNNLMINQE 293

Query: 427 ----------DYKRLHTE-NMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTYMIRKNN 475
                      YKR + + +   K    ++   L+ P +L IH++RS+++   Y   +N 
Sbjct: 294 LPDDIMHYIKSYKRGYCDISKMEKSDIFRKRRLLQCPKVLLIHLSRSMYNGMAYT--RNP 351

Query: 476 SRVLFKSRLNL 486
             V F++ L L
Sbjct: 352 CNVEFENILEL 362

>KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.188
           YDR069C
          Length = 986

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 38/78 (48%), Gaps = 2/78 (2%)

Query: 641 PVNTAPIPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAF--RKYRGCWWRISDETVYVVEE 698
           P+N + +P+     P  Y L  V  H+G+   GHY A+  +  +  W+   D +   ++ 
Sbjct: 905 PLNVSELPTRGQKPPFNYKLYGVACHFGSLYGGHYTAYVDKGIKNGWYYFDDTSCRPIKN 964

Query: 699 AEVLSTSGVFMLFYEYDY 716
           +    TS  ++LFY+  Y
Sbjct: 965 SMEPITSSAYVLFYKRIY 982

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 21/31 (67%)

Query: 90  YVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           ++ GL N GN+C++N +IQ L  + EL+K  
Sbjct: 618 FMVGLENMGNSCYLNCIIQCLLGNNELIKIF 648

>YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}
           UBP8Ubiquitin-specific protease that is a component of
           the SAGA (Spt-Ada-Gcn5-Acetyltransferase) acetylation
           complex; required for SAGA-mediated deubiquitination of
           histone H2B
          Length = 471

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 656 LTYVLRSVIVHYGTHNYGHYIAFRKYRGC-WWRISDETVYVVEEAEVLSTSGVFMLFY 712
           + Y L  ++ H GT N GHYIAF K  G  W++ +D  V  + + EVL     ++LFY
Sbjct: 409 IIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQA-YLLFY 465

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 71/184 (38%), Gaps = 67/184 (36%)

Query: 91  VAGLVNDGNTCFMNSVIQSLASSAELMKFLXXXXXXXXXXXXXXLLQDEEKPTSVEPDTI 150
           ++GL+N G+TCFM+S++Q L  +   ++                                
Sbjct: 136 LSGLINMGSTCFMSSILQCLIHNPYFIR-------------------------------- 163

Query: 151 ERXXXXXXXXXXXXHANRKLANGVSDEEKTPDVTFSLAL----REMLNKLNTKYYKERPC 206
                         H+N       + + ++PD  FS AL     E+   LNTK       
Sbjct: 164 --------HSMSQIHSN-------NCKVRSPDKCFSCALDKIVHELYGALNTKQASSSS- 207

Query: 207 FKTNK-----LLKSMTKSPNKNIILGYDQEDAQEFFQTILSELEKNVKSLEGKPSEATPI 261
             TN+      L +     N+N+  GY Q+DA EF+Q I++++ +         S    +
Sbjct: 208 TSTNRQTGFIYLLTCAWKINQNLA-GYSQQDAHEFWQFIINQIHQ---------SYVLDL 257

Query: 262 PNAE 265
           PNA+
Sbjct: 258 PNAK 261

>Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223W
           (REAL)
          Length = 473

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 656 LTYVLRSVIVHYGTHNYGHYIAFRKYRGC-WWRISDETVYVVEEAEVLSTSGVFMLFY 712
           + Y L  ++ H GT N GHYIAF K  G  W++ +D  V  + + EVL     ++LFY
Sbjct: 411 IIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQA-YLLFY 467

>Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] {ON}
            YOR124C (REAL)
          Length = 1272

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 34/63 (53%), Gaps = 8/63 (12%)

Query: 658  YVLRSVIVHYGTHNYGHYIAF---RKYRGCWWRISDETVYVVEEAEVL-----STSGVFM 709
            Y L SV +H G  +YGHY  +   R + G W + +DETV  V+E EV      +T+  + 
Sbjct: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPYF 1252

Query: 710  LFY 712
            L Y
Sbjct: 1253 LVY 1255

 Score = 35.8 bits (81), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 27/43 (62%)

Query: 78  GQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           G +D ++L    +  G+ N GNTC++NS++Q   S A L +++
Sbjct: 721 GTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYI 763

>Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223W
           (REAL)
          Length = 471

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 656 LTYVLRSVIVHYGTHNYGHYIAFRKYRGC-WWRISDETVYVVEEAEVLSTSGVFMLFY 712
           + Y L  ++ H GT N GHYIAF K  G  W++ +D  V  + + EVL     ++LFY
Sbjct: 409 IIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQA-YLLFY 465

 Score = 38.5 bits (88), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 68/165 (41%), Gaps = 56/165 (33%)

Query: 91  VAGLVNDGNTCFMNSVIQSLASSAELMKFLXXXXXXXXXXXXXXLLQDEEKPTSVEPDTI 150
           ++GL+N G+TCFM+S++Q L  +   +K                                
Sbjct: 136 LSGLINMGSTCFMSSILQCLIHNPYFIK-------------------------------- 163

Query: 151 ERXXXXXXXXXXXXHANRKLANGVSDEEKTPDVTFSLALREMLNKLNTKYYKERP---CF 207
                         H N+        + ++PD  FS AL +++++L      ++P     
Sbjct: 164 --------HSMSQSHFNKC-------KVRSPDNCFSCALDKIVHELYGVLNTDQPPSSSS 208

Query: 208 KTNK-----LLKSMTKSPNKNIILGYDQEDAQEFFQTILSELEKN 247
            TN+      L +     N+N+  GY Q+DA EF+Q I++++ +N
Sbjct: 209 ATNRQAGFIYLLTCAWKINQNLA-GYSQQDAHEFWQFIINQIHQN 252

>YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}
           UBP10Ubiquitin-specific protease that deubiquitinates
           ubiquitin-protein moieties; may regulate silencing by
           acting on Sir4p; involved in posttranscriptionally
           regulating Gap1p and possibly other transporters;
           primarily located in the nucleus
          Length = 792

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 655 PLTYVLRSVIVHYG-THNYGHYIAF-RKYRGCWWRISDETVYVVEEAEVLSTSGVFMLFY 712
           P+ Y L SV+VH G + + GHYIA  ++  G W    DE + ++ E +VL     + L Y
Sbjct: 671 PVKYQLLSVVVHEGRSLSSGHYIAHCKQPDGSWATYDDEYINIISERDVLKEPNAYYLLY 730

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 465

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 656 LTYVLRSVIVHYGTHNYGHYIAFRKY-RGCWWRISDETVYVVEEAEVLSTSGVFMLFY 712
           + + L  +I H GT N GHYIAF K   G W++ +D  V  + E E+L     ++LFY
Sbjct: 403 IIFELIGIIAHRGTVNEGHYIAFTKVTTGHWFKFNDSMVSSITEEELLQEQA-YLLFY 459

 Score = 32.0 bits (71), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 20/29 (68%)

Query: 91  VAGLVNDGNTCFMNSVIQSLASSAELMKF 119
           + GL+N G+TCFM+S++Q L  +    +F
Sbjct: 136 LQGLLNMGSTCFMSSIVQCLIHNPYFFQF 164

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL156W
            (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 89/200 (44%), Gaps = 28/200 (14%)

Query: 310  VTPLDGITAERI----GCLQCGENGGIRYSVTSSMSLNLP---SEDIGST--LKLSDLLN 360
            ++P+D I   +I     C +C +     YS    +SL LP   S+  G    L+L D +N
Sbjct: 891  LSPIDSIFQGQIEHQLSCQRC-DFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCIN 949

Query: 361  QWIKPEIIEGVS---CNRCALEAVRDHLLEQLK-----------QYENKGDSIPEKLLQA 406
             +   E++ G +   C +C + +  D  +   K           +  N  +S  + L + 
Sbjct: 950  FFTCDEVLTGQNPWDCPKCGVNSSGDRQMNSEKSKRKNKFFMGSENANSANSNRDHLPRL 1009

Query: 407  FKARVEELNVSLSKPMVSDEDYKRLHTENMTRKCSKSKQILFLRPPPLLSIHINRSVFDP 466
            FK   +  + S S  +   +   + H +   +K +  K + F+  P +L IH++R V+D 
Sbjct: 1010 FKIGSKSRSRSSSPFISGPKSSGKTHEKRYNKKLATIKSLNFITLPRILIIHLSRFVYD- 1068

Query: 467  RTYMIRKNNSRVLFKSRLNL 486
               + +KNN+ V +   LN+
Sbjct: 1069 ---LTKKNNTVVTYPLILNI 1085

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
           YBL067C
          Length = 701

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 45/86 (52%), Gaps = 11/86 (12%)

Query: 658 YVLRSVIVHYGTH-NYGHYIAFRKYRGCWWRI-SDETVYVVEEAEVLSTSG-----VFML 710
           Y L S ++H G    YGHYI+  K     W +  DETV  V+E  VLS +G      ++L
Sbjct: 559 YELASAVIHLGDGPQYGHYISLCKTETFGWLLFDDETVEAVDEQTVLSFTGENSDTAYVL 618

Query: 711 FY----EYDYDEATGKMREDLESDLE 732
           FY    EYD  +++ +  E+  + ++
Sbjct: 619 FYNEVSEYDEVKSSTQAYEEYNTHID 644

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
           Anc_8.742
          Length = 493

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 656 LTYVLRSVIVHYGTHNYGHYIAFRKYR-GCWWRISDETVYVVEEAEVLSTSGVFMLFY 712
           + Y L S+I H GT N GHYI   K   G W++ +D  V  + E E L     ++LFY
Sbjct: 431 MIYELTSIISHKGTVNEGHYIVVVKVNDGQWFKFNDSMVSAITEEEALKQQA-YLLFY 487

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 3/63 (4%)

Query: 49  FIMNNLSHIGDMTR-NFNPTNGFRRWMPRGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVI 107
           F    + +IGD+ + N++  N F   + +   +       G +  GLVN G+TCFM+S++
Sbjct: 95  FCFKCVDYIGDVEQINYSMLNKFWDDISKKTHITSQERKDGLF--GLVNMGSTCFMSSIL 152

Query: 108 QSL 110
           Q+L
Sbjct: 153 QTL 155

>YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}
           DOA4Ubiquitin isopeptidase, required for recycling
           ubiquitin from proteasome-bound ubiquitinated
           intermediates, acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 926

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 637 IMPPPVNTAPIPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAFRKYRGC--WWRISDETVY 694
           + PP VN   +P      P  Y L  V  H+GT   GHY A+ K +G    W   D+T Y
Sbjct: 843 VFPPGVNDDELPIRGQIPPFKYELYGVACHFGTLYGGHYTAYVK-KGLKKGWLYFDDTKY 901

Query: 695 --VVEEAEVLSTSGVFMLFYEYDY 716
             V  +A+ ++ S  ++LFY   Y
Sbjct: 902 KPVKNKADAIN-SNAYVLFYHRVY 924

>YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}
            UBP2Ubiquitin-specific protease that removes ubiquitin
            from ubiquitinated proteins; interacts with Rsp5p and is
            required for MVB sorting of membrane proteins; can cleave
            polyubiquitin and has isopeptidase activity
          Length = 1272

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 34/63 (53%), Gaps = 8/63 (12%)

Query: 658  YVLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETVYVVEEAEVL-----STSGVFM 709
            Y L SV +H G  +YGHY  + K R   G W + +DET+  V+E EV      +T+  + 
Sbjct: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETISEVQEEEVFNFNEGNTATPYF 1252

Query: 710  LFY 712
            L Y
Sbjct: 1253 LVY 1255

 Score = 35.4 bits (80), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 27/43 (62%)

Query: 78  GQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           G +D ++L    +  G+ N GNTC++NS++Q   S A L +++
Sbjct: 722 GTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYV 764

>CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {ON}
           similar to uniprot|P32571 Saccharomyces cerevisiae
           YDR069c DOA4 ubiquitin-specific protease
          Length = 947

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 638 MPPPVNTAPIPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVY 694
           +PP V+   +P+     P  Y L +V  H+G+   GHY ++      RG W+   D+   
Sbjct: 865 LPPGVSIDELPARGQIPPFKYSLYAVANHFGSLYGGHYTSYVNKGLSRG-WYYFDDQNYR 923

Query: 695 VVEEAEVLSTSGVFMLFY 712
           +V++   +  S  ++LFY
Sbjct: 924 LVKKTSEVVNSNAYVLFY 941

>Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa]
           {ON} YMR223W (UBP8) - putative deubiquitinating enzyme
           [contig 70] FULL
          Length = 454

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 639 PPPVNTAPIPSTVPAGP---LTYVLRSVIVHYGTHNYGHYIAFRKYRGC-WWRISDETVY 694
           P  +N AP      + P   + Y L +VI H G+ N GHY +  K  G  W+R +D  + 
Sbjct: 372 PTYLNMAPFCHQSESRPVPDMMYELVAVISHEGSVNQGHYTSMCKIPGGQWFRFNDSMIV 431

Query: 695 VVEEAEVLSTSGVFMLFY 712
            + E E L     ++LFY
Sbjct: 432 SISEEEALRQQA-YLLFY 448

 Score = 35.0 bits (79), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 22/28 (78%)

Query: 91  VAGLVNDGNTCFMNSVIQSLASSAELMK 118
           + GLVN G+TCFM+S+IQ+L  +  ++K
Sbjct: 135 LCGLVNMGSTCFMSSIIQTLVHNPYVLK 162

>TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.188
           YDR069C
          Length = 970

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 1/78 (1%)

Query: 640 PPVNTAPIPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDET-VYVVEE 698
           PP  T  +P+     P  Y L +V  H+G+   GHY ++       WR  D+T +  ++ 
Sbjct: 891 PPGVTEELPTRGQIPPFNYKLNAVAAHFGSLYGGHYTSYVDKGKFGWRYFDDTKIRPLKN 950

Query: 699 AEVLSTSGVFMLFYEYDY 716
           +    TS  ++LFY   Y
Sbjct: 951 SYECITSNAYVLFYHRVY 968

>KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 861

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 64/291 (21%), Positives = 104/291 (35%), Gaps = 64/291 (21%)

Query: 90  YVAGLVNDGNTCFMNSVIQSLASSAELMKFLXXXXXXXXXXXXXXLLQDEEKPTSVEPDT 149
           +  GL N GN+C+MN +IQ L  + EL +                 L D  K        
Sbjct: 493 FTVGLTNLGNSCYMNCIIQCLLGTHELTQI---------------FLDDSYKNHVNLNSK 537

Query: 150 IERXXXXXXXXXXXXHANRKLANGVSDEEKTPDVTFSLALREMLNKLNTKYYKERPCFKT 209
           +              H  ++ A   S ++ + D T   A++ +  K+         C   
Sbjct: 538 LGSKGVLAKYFSQLIHTMQQQAASASTKQNSGDKT---AVQPLHFKVA--------CGSI 586

Query: 210 NKLLKSMTKSPNKNIILGYDQEDAQEFFQTILSELEKNVKSLEGKPSEATPIPNAELPKN 269
           N L +S +            Q+D QEF Q +L  L +++    G P+       AE  + 
Sbjct: 587 NSLFRSSS------------QQDCQEFCQFLLDGLHEDLNQCGGNPALKELSEEAEGIRE 634

Query: 270 AVIGQAHLDKVGDVYLPSDQIDPNLVLTNEGKQLYTPFRLVTPL-DGITAERIGCLQCGE 328
            +  +       + YL +D                  F ++  L  G  A ++ C  CG 
Sbjct: 635 KLCMRIASSIEWERYLTTD------------------FSVIVDLFQGQYASQLTCKVCGR 676

Query: 329 NGGIRYSVTSSMSLNLPSEDIGSTLKLSDLLNQWIKPEIIEG---VSCNRC 376
                Y   S +S+ +PS   GS   + D   ++ K E +E     SC RC
Sbjct: 677 T-STTYQPFSVLSVPVPS---GSKCDIIDCFKEFTKVETLEKDEQWSCPRC 723

 Score = 39.3 bits (90), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 35/82 (42%), Gaps = 4/82 (4%)

Query: 638 MPPPVNTAPIPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAF--RKYRGCWWRISDETVYV 695
           +PP V   P    VP  P  Y L +V  H+GT   GHY ++  +  +  W    D +   
Sbjct: 780 LPPGVAELPTRGQVP--PFNYNLYAVACHFGTLYGGHYTSYVDKGDKAGWCYFDDTSWRK 837

Query: 696 VEEAEVLSTSGVFMLFYEYDYD 717
            +      T   ++LFY   Y+
Sbjct: 838 AKSQGECITLSAYVLFYHRKYN 859

>ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] {ON}
            similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124C UBP2 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions capable of cleaving
            polyubiquitin and possesses isopeptidase activity
          Length = 1305

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 3/53 (5%)

Query: 656  LTYVLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETVYVVEEAEVLSTS 705
            + Y L +V +H G  +YGHY  + K R   G W + +DET+  V E+EV + S
Sbjct: 1221 IGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFS 1273

 Score = 35.0 bits (79), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%)

Query: 78  GQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           G VD   L    +  GL N GNTC++NS++Q   S + L +++
Sbjct: 719 GTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYV 761

>CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa]
           {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
           YNL186w UBP10
          Length = 771

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 655 PLTYVLRSVIVHYG-THNYGHYIAF-RKYRGCWWRISDETVYVVEEAEVLSTSGVFMLFY 712
           P+ Y L SV+VH G + + GHYIA  ++  G W    DE +  + E EVL     + + Y
Sbjct: 659 PVKYELLSVVVHEGRSLSSGHYIAHCKQPDGSWATYDDEYINKITEREVLKERNAYYVLY 718

>SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]
           {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
           YNL186W UBP10 Ubiquitin-specific protease that
           deubiquitinates ubiquitin-protein moieties may regulate
           silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 739

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 655 PLTYVLRSVIVHYG-THNYGHYIAF-RKYRGCWWRISDETVYVVEEAEVLSTSGVFMLFY 712
           P+ Y L SV+VH G + + GHYIA  ++  G W    DE +  + E ++L   G + L Y
Sbjct: 624 PVKYQLISVVVHEGRSLSSGHYIAHCKQPDGSWATYDDEYINKITEKQMLKEPGAYYLIY 683

>Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186W
           (REAL)
          Length = 763

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 655 PLTYVLRSVIVHYG-THNYGHYIAF-RKYRGCWWRISDETVYVVEEAEVLSTSGVFMLFY 712
           P+ Y L SV+VH G + + GHYIA  ++  G W    DE +  + E +VL  +  + L Y
Sbjct: 641 PVKYQLLSVVVHEGRSLSSGHYIAHCKQPDGSWATYDDEYINKISERDVLKETNAYYLLY 700

>TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {ON}
           Anc_8.742 YMR223W
          Length = 463

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 39/79 (49%), Gaps = 6/79 (7%)

Query: 639 PPPVNTAPIPST----VPAGPLTYVLRSVIVHYGTHNYGHYIAFRKYRG-CWWRISDETV 693
           PP +N     S+    V    L Y L  V+ H GT N GHY+A  K  G  W++ +D  V
Sbjct: 380 PPYLNMRDYCSSGDSDVDVPDLIYELIGVVAHKGTVNEGHYVATTKVAGRQWFKFNDSMV 439

Query: 694 YVVEEAEVLSTSGVFMLFY 712
             V + E L+    ++LFY
Sbjct: 440 SSVTQEEALNEQA-YLLFY 457

>Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186W
           (UBP10) - predicted to encode a ubiquitin-processing
           protease [contig 103] PARTIAL
          Length = 511

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 650 TVPAGPLTYVLRSVIVHYG-THNYGHYIAFRKY-RGCWWRISDETVYVVEEAEVLSTSGV 707
           +  A P+ Y L SV+VH G + + GHYIA  K   G W    DE +  + E ++L   G 
Sbjct: 387 SATALPVKYQLISVVVHEGRSLSSGHYIAHCKQPDGSWSTYDDEYINKISEKQMLKEPGA 446

Query: 708 FMLFY 712
           + L Y
Sbjct: 447 YYLVY 451

>KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.742
           YMR223W
          Length = 440

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 654 GPLTYVLRSVIVHYGTHNYGHYIAFRKY-RGCWWRISDETVYVVEEAEVLSTSGVFMLFY 712
             + Y L  VI H GT N GHYIA  K     W++ +D  V  + E EVL     ++LFY
Sbjct: 376 SSIIYELNGVISHIGTVNEGHYIATLKLDSNNWFKFNDSMVTSISEEEVLKDQA-YLLFY 434

>Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {ON}
           YKR098C (REAL)
          Length = 712

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 91/419 (21%), Positives = 148/419 (35%), Gaps = 114/419 (27%)

Query: 91  VAGLVNDGNTCFMNSVIQSLASSAELMKFLXXXXXXXXXXXXXXLLQDEEKPTSVEPDTI 150
           + GL N  NTC++NS+IQ L  S                      L+ EE P  V+    
Sbjct: 291 ITGLQNPCNTCYINSIIQCLFGSTPFRDLFLTKKYRL-------FLKTEEYPKEVQ---- 339

Query: 151 ERXXXXXXXXXXXXHANRKLANGVSDEEKTPDVTFSLALREMLNKLNTKYYKERPCFKTN 210
                                              S ++  +  K+   Y         N
Sbjct: 340 ----------------------------------LSRSIYSLFKKM---YANGGSAIVPN 362

Query: 211 KLLKSMTKSPNKNIILGYDQEDAQEFFQTILSELEKNVKSLEGKPSEATPIPNAELPKNA 270
             LK M K    ++ +  DQ+D QEF   IL+ + + +                    N 
Sbjct: 363 GFLK-MCKKLRPDLNIPDDQQDTQEFLLIILARIHEELS-------------------NE 402

Query: 271 VIGQAHLDKVGDVYLPSDQIDPNLVLTNEGK--QLYTPFRL---VTPLDGITAER----I 321
            + + + D V          D N +  N  K  + Y    L   ++P+D I   +    +
Sbjct: 403 NVTKYYCDLVS--------YDTNALQVNPIKYQKWYEETILADGLSPIDHIFRGQMENIL 454

Query: 322 GCLQCGENGGIRYSVTSSMSLNLPSEDIGS------TLKLSDLLNQWIKPEIIEGVSCNR 375
            C +CG N    YS    +SL +P   + S       +KL D +N +   E + G +   
Sbjct: 455 KCQRCG-NSSFSYSTFYVLSLAIPKNSVHSFTSKSKKIKLEDCINLFTSDEELTGDNAWD 513

Query: 376 CALEAVRDHLLEQLKQYENKGDSIPEKLLQAFKARVEELNVSLSKPMVSDEDYKRLHTEN 435
           C    + D    +LK  EN        L  +F +R      S SK       Y    ++N
Sbjct: 514 CPECRIDD---SKLKTGENSSQKKRSPLF-SFHSR------SRSKSPHHHHHYHHHGSDN 563

Query: 436 MTRKCSK--------SKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVLFKSRLNL 486
            T+  +K         K + F+  PP+L IH++R  +D    + +KNN+ + +   LN+
Sbjct: 564 TTKNSNKWKSKRLTTIKSLDFIFLPPILVIHLSRFYYD----LTKKNNAVITYPLILNI 618

>TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa]
           {ON} Anc_2.69 YNL186W
          Length = 898

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 655 PLTYVLRSVIVHYG-THNYGHYIAFRKY-RGCWWRISDETVYVVEEAEVLSTSGVFMLFY 712
           P+ Y L SV+VH G + + GHYIA  K   G W    DE +  + E E+L     + L Y
Sbjct: 752 PVKYQLLSVVVHEGRSLSSGHYIAHCKQPDGSWATYDDEYINKISEREMLKEPNAYYLLY 811

>KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {ON}
           some similarities with uniprot|P53874 Saccharomyces
           cerevisiae YNL186W UBP10 Ubiquitin-specific protease
           that deubiquitinates ubiquitin-protein moieties may
           regulate silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 756

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 655 PLTYVLRSVIVHYG-THNYGHYIAF-RKYRGCWWRISDETVYVVEEAEVLSTSGVFMLFY 712
           P+ Y L SV+VH G +   GHYIA  ++  G W    DE +  + E ++L   G + L Y
Sbjct: 645 PVKYQLISVVVHEGRSLTSGHYIAHCKQPDGSWSTYDDEYINKISERQMLKEPGAYYLVY 704

>NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {ON}
           Anc_7.390 YBL067C
          Length = 827

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 35/70 (50%), Gaps = 9/70 (12%)

Query: 658 YVLRSVIVHYGTH-NYGHYIAFRKY-RGCWWRISDETVYVVEEAEVLSTSG-------VF 708
           Y L+ ++VH G+    GHY+A  K  +  W    DET   + E EVLS  G        +
Sbjct: 672 YKLQGIVVHMGSSPQQGHYVAICKTDKYGWLLFDDETASWINEEEVLSFIGDEKSQNTAY 731

Query: 709 MLFYEYDYDE 718
           +LFYE   DE
Sbjct: 732 VLFYEEVKDE 741

>Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON}
           YDR069C (REAL)
          Length = 929

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 33/82 (40%), Gaps = 2/82 (2%)

Query: 637 IMPPPVNTAPIPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDETVY 694
           + PP VN   +P      P  Y L  V  H+GT   GHY A+ K   +  W    D    
Sbjct: 846 VFPPGVNDDELPIRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGLKKGWLYFDDTKYK 905

Query: 695 VVEEAEVLSTSGVFMLFYEYDY 716
            V+       S  ++LFY   Y
Sbjct: 906 PVKNQTDAINSNAYVLFYHRVY 927

>Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {ON}
            YOR124C (REAL)
          Length = 1270

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 8/63 (12%)

Query: 658  YVLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETVYVVEEAEVL-----STSGVFM 709
            Y L SV +H G  +YGHY  + K R   G W + +DET+  V E EV      +T+  + 
Sbjct: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETISEVPEEEVFNFNEGNTATPYF 1250

Query: 710  LFY 712
            L Y
Sbjct: 1251 LVY 1253

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 26/43 (60%)

Query: 78  GQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           G +D ++L    +  G+ N GNTC++NS++Q   S A L  ++
Sbjct: 722 GTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYI 764

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
           Anc_8.742 YMR223W
          Length = 483

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 35/79 (44%), Gaps = 11/79 (13%)

Query: 644 TAPIPSTVPAG----------PLTYVLRSVIVHYGTHNYGHYIAFRKYR-GCWWRISDET 692
           TAP P T P             + Y L  ++ H GT N GHYI + K   G W++ +D  
Sbjct: 399 TAPTPDTDPTNLNEKTNKSTPDMIYELTGIVTHRGTVNEGHYITYTKTADGVWYQFNDSV 458

Query: 693 VYVVEEAEVLSTSGVFMLF 711
           V  V   ++L      +++
Sbjct: 459 VMKVPLEQMLKEQAYLLIY 477

>Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON}
            (51365..55165) [3801 nt, 1267 aa]
          Length = 1266

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 8/65 (12%)

Query: 656  LTYVLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVEEAEVL-----STSGV 707
            + Y L +V +H G  +YGHY  + K     G W + +DET+  V EAEV      +T+  
Sbjct: 1186 IGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATP 1245

Query: 708  FMLFY 712
            + L Y
Sbjct: 1246 YFLVY 1250

>Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186W
           (REAL)
          Length = 788

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 655 PLTYVLRSVIVHYG-THNYGHYIAF-RKYRGCWWRISDETVYVVEEAEVLSTSGVFMLFY 712
           P+ Y L SV+VH G + + GHYIA  ++  G W    DE +  + E +VL     + L Y
Sbjct: 666 PVKYQLLSVVVHEGRSLSSGHYIAHCKQPDGTWATYDDEYINKISERDVLKEPNAYYLLY 725

>Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON}
           (56564..58738) [2175 nt, 725 aa]
          Length = 724

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 655 PLTYVLRSVIVHYG-THNYGHYIAF-RKYRGCWWRISDETVYVVEEAEVLSTSGVFMLFY 712
           P+ Y L SV+VH G + + GHYIA  R+  G W    DE +  + E  VL     + L Y
Sbjct: 604 PVKYQLISVVVHEGRSLSSGHYIAHCRQPDGSWAIYDDEYINKISERNVLKEPNAYYLIY 663

>TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5.443
            YOR124C
          Length = 1272

 Score = 40.8 bits (94), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 8/65 (12%)

Query: 656  LTYVLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETVYVVEEAEVL-----STSGV 707
            + Y L +V +H G  +YGHY  + K R   G W + +DET+  V E EV      +T+  
Sbjct: 1189 IGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATP 1248

Query: 708  FMLFY 712
            + L Y
Sbjct: 1249 YFLVY 1253

 Score = 36.2 bits (82), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%)

Query: 78  GQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           G +D   L    +  GL N GNTC++NS++Q   S A L +++
Sbjct: 718 GTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYV 760

>CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223w UBP8
          Length = 461

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 39/76 (51%), Gaps = 4/76 (5%)

Query: 638 MPPPVNTAPIPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAFRKY-RGCWWRISDETVYVV 696
           M P +     P   P+  + Y L  +I H G+ N GHY+AF K   G W++ +D  V  +
Sbjct: 383 MKPYLKDNQNPDEDPS--ILYELIGIISHTGSVNEGHYVAFCKIENGEWFKFNDSMVTKI 440

Query: 697 EEAEVLSTSGVFMLFY 712
            E +VL     ++LFY
Sbjct: 441 LEKDVLKEQA-YLLFY 455

 Score = 36.2 bits (82), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 49  FIMNNLSHIGDMTRNFNPTNGFRRWMPRGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQ 108
           F    + ++GD    F       RW       +  T+D+   +AGLVN G+TC+M+S++Q
Sbjct: 95  FCFQCMDYVGDFDL-FRDAALANRWDYYEEYTNVPTVDQIDGMAGLVNMGSTCYMSSIMQ 153

Query: 109 SLASSAELMKFL 120
            +  +  ++++ 
Sbjct: 154 CIIHNPYMIRYF 165

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
            similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 40.8 bits (94), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 34/63 (53%), Gaps = 8/63 (12%)

Query: 658  YVLRSVIVHYGTHNYGHYIAF---RKYRGCWWRISDETVYVVEEAEVL-----STSGVFM 709
            Y L +V +H G  +YGHY  +   RK  G W + +DE+V  V E+EV      +T+  + 
Sbjct: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPYF 1227

Query: 710  LFY 712
            L Y
Sbjct: 1228 LVY 1230

 Score = 35.8 bits (81), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 26/43 (60%)

Query: 78  GQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           G +D + L  G +  GL N GNTC++NS++Q   + + L  ++
Sbjct: 682 GIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYI 724

>Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON}
           YDR069C (REAL)
          Length = 927

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 38/84 (45%), Gaps = 6/84 (7%)

Query: 637 IMPPPVNTAPIPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETV 693
           + PP VN   +P      P  Y L  V  H+GT   GHY ++ K    RG  W   D+T 
Sbjct: 844 VFPPGVNDDELPIRGQIPPFKYELYGVACHFGTLYGGHYTSYVKKGLSRG--WLYFDDTK 901

Query: 694 YVVEEAEVLS-TSGVFMLFYEYDY 716
           Y   + +  +  S  ++LFY   Y
Sbjct: 902 YRPAKNQTDAINSNAYVLFYHRVY 925

>Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C
           (DOA4) - ubiquitin isopeptidase [contig 424] PARTIAL
          Length = 424

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 65/291 (22%), Positives = 103/291 (35%), Gaps = 62/291 (21%)

Query: 93  GLVNDGNTCFMNSVIQSLASSAELMKFLXXXXXXXXXXXXXXLLQDEEKPTSVEPDTIER 152
           GLVN GN+C+MN +IQ L  + EL++                 L D  K        +  
Sbjct: 57  GLVNLGNSCYMNCIIQCLLGTRELVQI---------------FLDDSYKNHVNLNSRLGS 101

Query: 153 XXXXXXXXXXXXHANRKLANGVSDEEKTPDVTFSLALREMLNKLNTKYYKERPCFKTNKL 212
                       H  ++ A   S  + T     S   R  +  L+ K      C   N L
Sbjct: 102 KGVLAKYFSQLIHNMQQQAISASGRKST-----SGNERNAVQPLHFKV----ACGSINSL 152

Query: 213 LKSMTKSPNKNIILGYDQEDAQEFFQTILSELEKNVKSLEGKPSEATPIPNAELPKNAVI 272
            K+ +            Q+D QEF Q +L  L +++    G P+       AE  +  + 
Sbjct: 153 FKTTS------------QQDCQEFCQFLLDGLHEDLNQCGGNPALKELSEEAEAIREKLC 200

Query: 273 GQAHLDKVGDVYLPSDQIDPNLVLTNEGKQLYTPFRLVTPL-DGITAERIGCLQCGENGG 331
            +       + YL +D                  F ++  L  G  A ++ C  CG    
Sbjct: 201 MRIASSIEWERYLTTD------------------FSVIVDLFQGQYASQLMCKVCGRT-S 241

Query: 332 IRYSVTSSMSLNLPSEDIGSTLKLSDLLNQWIKPEIIEG---VSCNRCALE 379
             Y   S +S+ +P    G+   L D   ++ K E +E     SC RC ++
Sbjct: 242 TTYQPFSVLSVPVPR---GARCNLLDCFEEFTKIETLEKDEQWSCPRCKVK 289

 Score = 39.3 bits (90), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 37/79 (46%), Gaps = 4/79 (5%)

Query: 641 PVNTAPIPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAF-RKYRGCWWRISDETVY--VVE 697
           P   A +P+     P  Y L +V  H+GT   GHY A+  K     W   D+T +     
Sbjct: 344 PKGVAELPTRGQTPPFHYNLYAVACHFGTLYGGHYTAYVNKEDKNGWCYFDDTCWRKAKS 403

Query: 698 EAEVLSTSGVFMLFYEYDY 716
           E E ++TS  ++LFY   Y
Sbjct: 404 EDECITTSA-YVLFYHRKY 421

>NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {ON}
           Anc_2.69 YNL186W
          Length = 870

 Score = 40.4 bits (93), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 655 PLTYVLRSVIVHYG-THNYGHYIAF-RKYRGCWWRISDETVYVVEEAEVLSTSGVFMLFY 712
           P  Y L SV+VH G + + GHYIA  R+  G W    DE +  + E ++L+    + L Y
Sbjct: 758 PAKYQLLSVVVHEGRSLSSGHYIAHCRQPDGTWATYDDELINKISELKLLTEPNAYYLVY 817

>KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa]
           {ON} Anc_2.69 YNL186W
          Length = 802

 Score = 40.4 bits (93), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 655 PLTYVLRSVIVHYG-THNYGHYIAF-RKYRGCWWRISDETVYVVEEAEVLSTSGVFMLFY 712
           P+ Y L SV+VH G + + GHY+A  ++  G W    DE +  + + EVL  +  + L Y
Sbjct: 670 PVKYQLISVVVHEGRSLSSGHYVAHCKQPDGLWATYDDEYINKISDKEVLRETNAYYLVY 729

>Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar to
           Ashbya gossypii AFR551W
          Length = 466

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 2/68 (2%)

Query: 646 PIPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAFRKYRG-CWWRISDETVYVVEEAEVLST 704
           P+    P   + Y L ++I H+GT + GHY    +  G  W + +D  V V+ E ++L  
Sbjct: 397 PVDCLHPVPNMMYKLSAIISHHGTVHQGHYTTICRINGDIWAKFNDSMVTVISEEDMLKE 456

Query: 705 SGVFMLFY 712
              ++L+Y
Sbjct: 457 QA-YLLYY 463

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 64/164 (39%), Gaps = 31/164 (18%)

Query: 84  TLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFLXXXXXXXXXXXXXXLLQDEEKPT 143
           ++D    + GLVN G+TCFM+SVIQ+L     +++ +               +QD     
Sbjct: 128 SVDGKDGLLGLVNMGSTCFMSSVIQTLVHIPHVLQHVLKQTHQSTCD-----IQDSIACV 182

Query: 144 SVEPDTIERXXXXXXXXXXXXHANRKLANGVSDEEKTPDVTFSLALREMLNKLNTKYYKE 203
           S   D I               ++    + +S        TFS   +  ++ L   +   
Sbjct: 183 SCAVDEIVANLYGYPKPNAVTKSSVGQYSHISS-------TFSRQQKGFIDLLTCSW--- 232

Query: 204 RPCFKTNKLLKSMTKSPNKNIILGYDQEDAQEFFQTILSELEKN 247
               K NK L             GY Q+DA EF+Q +L++L  +
Sbjct: 233 ----KINKNLA------------GYTQQDAHEFWQFLLNQLHSD 260

>Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186W
           (REAL)
          Length = 776

 Score = 40.0 bits (92), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 655 PLTYVLRSVIVHYG-THNYGHYIAFRKY-RGCWWRISDETVYVVEEAEVLSTSGVFMLFY 712
           P+ Y L SV+VH G + + GHYIA  K   G W    DE +  + E +VL     + L Y
Sbjct: 654 PVKYQLLSVVVHEGRSLSSGHYIAHCKQPDGNWATYDDEYINKISERDVLKEPNAYYLLY 713

>NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON} 
          Length = 1116

 Score = 40.0 bits (92), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 33/79 (41%), Gaps = 2/79 (2%)

Query: 640  PPVNTAPIPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAF--RKYRGCWWRISDETVYVVE 697
            PP  T  +P      P  Y L    +H+G+   GHY AF  +  R  W+   D     ++
Sbjct: 1036 PPGVTDELPKRGQIPPFKYRLYGAALHFGSLYGGHYTAFVNKGIRNGWYYFDDTNYRPIK 1095

Query: 698  EAEVLSTSGVFMLFYEYDY 716
                  +S  ++LFY   Y
Sbjct: 1096 NEREPISSNAYVLFYHRIY 1114

 Score = 35.4 bits (80), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 90  YVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           ++ GL N GN+C++N +IQ L  + EL K  
Sbjct: 745 FIIGLQNMGNSCYLNCIIQCLLGTHELTKIF 775

>KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} similar
           to uniprot|P50102 Saccharomyces cerevisiae YMR223W UBP8
           Ubiquitin-specific protease that is a component of the
           SAGA (Spt-Ada-Gcn5- Acetyltransferase) acetylation
           complex required for SAGA- mediated deubiquitination of
           histone H2B
          Length = 453

 Score = 39.7 bits (91), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 59/157 (37%), Gaps = 46/157 (29%)

Query: 91  VAGLVNDGNTCFMNSVIQSLASSAELMKFLXXXXXXXXXXXXXXLLQDEEKPTSVEPDTI 150
           + GLVN G+TCFM+S+IQ+L  +  ++K                 +QD     S   D I
Sbjct: 135 LCGLVNMGSTCFMSSIIQTLVHNPYVLKQCMNQNHYSRCD-----IQDSSSCFSCALDQI 189

Query: 151 ERXXXXXXXXXXXXHANRKLANGVSDEEKTPDVTFSLALREMLNKLNTKYYKERPCFKTN 210
                                  ++    T D TF+   R  ++ L   +       KTN
Sbjct: 190 V----------------------MNFYGPTSDATFTSQQRGFVDLLLCSW-------KTN 220

Query: 211 KLLKSMTKSPNKNIILGYDQEDAQEFFQTILSELEKN 247
           K L             GY Q+DA EF Q  L++L  +
Sbjct: 221 KNLA------------GYSQQDAHEFLQFFLNQLHAD 245

 Score = 37.7 bits (86), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 38/80 (47%), Gaps = 9/80 (11%)

Query: 639 PPPVNTAPI-----PSTVPAGPLTYVLRSVIVHYGTHNYGHYIAFRKY-RGCWWRISDET 692
           P  +N AP        +VP   + Y L +VI   G+ N GHY    K   G W+R +D  
Sbjct: 371 PAYLNMAPFCHHSEARSVP--DMVYELVAVISQEGSVNQGHYTCMCKVPGGQWFRFNDTM 428

Query: 693 VYVVEEAEVLSTSGVFMLFY 712
           +  + E +VL     ++LFY
Sbjct: 429 IVSITEEDVLRQQA-YLLFY 447

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_5.443
            YOR124C
          Length = 1320

 Score = 39.7 bits (91), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 656  LTYVLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVEEAEVLS 703
            L Y L +V +H G  +YGHY  + K     G W + +DE+V  V E EV +
Sbjct: 1235 LAYSLFAVFIHRGEASYGHYWVYIKDHSKNGIWRKYNDESVTEVPEQEVFN 1285

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%)

Query: 78  GQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           G VD   L    + AGL N GNTC++NS++Q   S   L  F+
Sbjct: 748 GIVDPTCLPVENWPAGLNNIGNTCYLNSLLQYYFSIKPLRDFI 790

>NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188
          Length = 922

 Score = 39.7 bits (91), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 37/83 (44%), Gaps = 5/83 (6%)

Query: 638 MPPPV-NTAPIPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAF--RKYRGCWWRISDETVY 694
           +PP V +  P    +P  P  Y L  V  H+G+   GHY A+  +  +  W+   D    
Sbjct: 841 LPPGVRDELPKRGQIP--PFKYKLYGVASHFGSLYGGHYTAYVDKGPKHGWYYFDDTNYR 898

Query: 695 VVEEAEVLSTSGVFMLFYEYDYD 717
            ++      TS  ++LFY   YD
Sbjct: 899 SIKNKNEPITSSAYLLFYHRIYD 921

 Score = 36.6 bits (83), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 3/41 (7%)

Query: 83  HTLDKG---GYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           HT DK     ++ GL N GN+C++N +IQ L  + EL K  
Sbjct: 547 HTNDKMLDLDFIVGLQNIGNSCYLNCIIQCLLGTHELTKIF 587

>Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {ON}
           YKR098C (REAL)
          Length = 721

 Score = 39.7 bits (91), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 64/269 (23%), Positives = 106/269 (39%), Gaps = 41/269 (15%)

Query: 229 DQEDAQEFFQTILSELEKNVKSLEGKPSEATPIPNAELPKNAVIGQAHLDKVGDVYLPSD 288
           DQ+D QEF   IL+ L + + +  G  +E  P     +  +A   Q +  K    Y  S 
Sbjct: 391 DQQDTQEFLLIILARLHEELSN--GTVTEYYP---DLVSYDANAFQVNPSKYQKWYEGS- 444

Query: 289 QIDPNLVLTNEGKQLYTPFRLVTPLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPSED 348
                 VLT+    +   FR      G     + C +CG N    YS    +SL +P   
Sbjct: 445 ------VLTDGLSPIDYIFR------GQMENILKCQRCG-NSSHSYSTFYVLSLAIPKIS 491

Query: 349 IGS------TLKLSDLLNQWIKPEIIEG---VSCNRCALEAVRDHLLEQLKQYENKGDSI 399
           + S       +KL D +N +   E + G     C  C    ++  + E   Q +      
Sbjct: 492 LYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTKINESTSQKK------ 545

Query: 400 PEKLLQAFKARVEELN-VSLSKPMVSDEDYKRLHTENM-TRKCSKSKQILFLRPPPLLSI 457
            +    +F +R    +            D    H++   +RK +  K   F+  PP+L I
Sbjct: 546 -KSTFFSFHSRSRSKSPHHHHHHHHHSHDNTEKHSKKWNSRKLTTVKSSDFIVLPPILVI 604

Query: 458 HINRSVFDPRTYMIRKNNSRVLFKSRLNL 486
           H++R  +D    + RKNN+ + +   LN+
Sbjct: 605 HLSRFYYD----LTRKNNTVITYPLILNV 629

>NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1269

 Score = 39.7 bits (91), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 656  LTYVLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETVYVVEEAEV 701
            + Y + +V +H G  +YGHY  + K R   G W + +DETV  V E EV
Sbjct: 1184 IGYSIFAVFIHRGEASYGHYWIYIKDRSQNGIWRKYNDETVSEVPEEEV 1232

 Score = 35.8 bits (81), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 28/45 (62%)

Query: 76  RGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           + G++D + L    + AG+ N GNTC++NS++Q   S A L  ++
Sbjct: 697 QTGKIDPNCLPIKDWPAGINNIGNTCYLNSLLQYYFSIAPLRNYV 741

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
           (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 39.7 bits (91), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 654 GPLTYVLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDETVYVVEEAEVL 702
           GP  Y L  V+VH G  + GHY A  K      W+R  DE V+ V++ +V 
Sbjct: 437 GPKNYKLHGVLVHTGDISTGHYYAMIKPTLEDQWYRFDDEKVWKVDKKQVF 487

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
           YBL067C (REAL)
          Length = 748

 Score = 39.3 bits (90), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 9/68 (13%)

Query: 658 YVLRSVIVHYGTH-NYGHYIAFRKYRGCWWRI-SDETVYVVEEAEVLSTSG-------VF 708
           Y L  ++VH G    +GHY++  K+    W +  DETV  V+E  VL  +G        +
Sbjct: 604 YELSGIVVHMGGGPQHGHYVSLCKHEIFGWLLFDDETVEAVKEEAVLEFTGESPNMATAY 663

Query: 709 MLFYEYDY 716
           +LFY+  Y
Sbjct: 664 VLFYKTKY 671

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
           YBL067C (REAL)
          Length = 745

 Score = 39.3 bits (90), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 9/65 (13%)

Query: 658 YVLRSVIVHYGTH-NYGHYIAFRKYRGCWWRI-SDETVYVVEEAEVLSTSG-------VF 708
           Y L  ++VH G    +GHY++  K++   W +  DETV  V+E  VL  +G        +
Sbjct: 602 YELAGIVVHMGGGPQHGHYVSLCKHQKFGWLLFDDETVEAVKEETVLEFTGESANMATAY 661

Query: 709 MLFYE 713
           +LFY+
Sbjct: 662 VLFYK 666

>KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {ON}
           some similarities with uniprot|P53874 Saccharomyces
           cerevisiae YNL186W UBP10 Ubiquitin-specific protease
           that deubiquitinates ubiquitin-protein moieties may
           regulate silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 750

 Score = 39.3 bits (90), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 650 TVPAGPLTYVLRSVIVHYG-THNYGHYIAF-RKYRGCWWRISDETVYVVEEAEVLSTSGV 707
           ++ + P+ Y L SV+VH G + + GHYIA  ++  G W    DE +  + E ++L     
Sbjct: 631 SISSLPVRYQLISVVVHEGRSLSSGHYIAHCKQPDGSWATYDDEYINKISEKQLLKEPNA 690

Query: 708 FMLFY 712
           + L Y
Sbjct: 691 YFLVY 695

>KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {ON}
           Anc_8.188 YDR069C
          Length = 978

 Score = 39.3 bits (90), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 4/80 (5%)

Query: 640 PPVNTAPIPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAF-RKYRGCWWRISDETVY--VV 696
           PP  +  +P+     P  Y L  V  H+G+   GHY A+  K  G  W   D+T Y  + 
Sbjct: 897 PPGVSNELPARGQIKPFNYRLYGVACHFGSLYGGHYTAYVDKGIGNGWYYFDDTTYRPLK 956

Query: 697 EEAEVLSTSGVFMLFYEYDY 716
            + E +S+S  ++LFY   Y
Sbjct: 957 NDKEPISSSA-YVLFYTRVY 975

 Score = 37.0 bits (84), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 76  RGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           R  QV    L K  ++ GL N GN+C+MN +IQ +  + +L+K  
Sbjct: 590 RSAQVYTDAL-KLDFIVGLENMGNSCYMNCIIQCILGTHDLIKIF 633

>NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742
          Length = 466

 Score = 38.9 bits (89), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 656 LTYVLRSVIVHYGTHNYGHYIAFRKYR-GCWWRISDETVYVVEEAEVLSTSGVFMLFY 712
           + Y L  ++ H G+ N GHY+   K   G W++ +D  + V++E E L     ++LFY
Sbjct: 404 IIYELTGILSHIGSINEGHYVVVLKINDGRWFKFNDSMISVIKEDEALKQQA-YLLFY 460

 Score = 32.0 bits (71), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 21/27 (77%)

Query: 93  GLVNDGNTCFMNSVIQSLASSAELMKF 119
           GLVN G+TCFM+S++Q+L  +  ++ +
Sbjct: 139 GLVNMGSTCFMSSILQALIHNPYIVNY 165

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
           YIL156W
          Length = 1025

 Score = 39.3 bits (90), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 65/277 (23%), Positives = 115/277 (41%), Gaps = 49/277 (17%)

Query: 229 DQEDAQEFFQTILSELEKNVKSLEGKPSEATPIPNAELPKNAVIGQAHLDKVGDVYLPSD 288
           DQ+D QEF    L  L   +       S    + N E P   +  +  +D  G  Y    
Sbjct: 695 DQQDTQEFLMVTLDRLHDEL-------SNQAAVAN-EYPDLLLYDEHQMDVNGKEY--KK 744

Query: 289 QIDPNLVLTNEGKQLYTPFRLVTPLDGITAERIG----CLQCGENGGIRYSVTSSMSLNL 344
             + +++    G  L        P+D I   +I     C +CG N    YS    +SL +
Sbjct: 745 WFEESVI----GNGL-------APIDHIFQGQIENILECQRCG-NSSFSYSTFYVLSLAI 792

Query: 345 PSEDIGS-----TLKLSDLLNQWIKPEIIEG---VSCNRCALEAVRD----HLLEQLKQY 392
           P     +      +KL D +N +   EI+ G     C +C   AV D    HL +  K+ 
Sbjct: 793 PKPSTSTFSRAKRVKLEDCINMFTNDEILSGENAWDCPKCG-SAVTDMGPNHLKKSKKKK 851

Query: 393 ENK-GDSIPEKLLQAFKARVEELNVSLSKP--MVSDEDYKRLHTENMTRKCSKSKQILFL 449
           +++ G+   E+  ++   R+   +     P  M+    +     +  +++ S  K + F+
Sbjct: 852 KSELGE---ERRSKSGFFRIHSKSKRSKSPFRMLGSTKFPLAMEDWKSKELSTKKTLNFI 908

Query: 450 RPPPLLSIHINRSVFDPRTYMIRKNNSRVLFKSRLNL 486
             PP+L IH++R  +D    + +KN++ V +   LN+
Sbjct: 909 FLPPVLIIHLSRFYYD----LTKKNDTIVTYPLVLNI 941

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
           YBL067C (REAL)
          Length = 750

 Score = 38.9 bits (89), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 9/87 (10%)

Query: 658 YVLRSVIVHYGTH-NYGHYIAFRKY-RGCWWRISDETVYVVEEAEVLSTSG-------VF 708
           Y L  ++VH G    +GHY++  K+ +  W    DETV  V+E  VL  +G        +
Sbjct: 605 YQLAGIVVHMGGGPQHGHYVSLCKHEKFGWLLFDDETVEAVKEETVLEFTGESPNMATAY 664

Query: 709 MLFYEYDYDEATGKMREDLESDLEDEN 735
           +LFY+  +  A  K   +  S+  +EN
Sbjct: 665 VLFYKAMHLNAFNKNGSENISNEHEEN 691

>KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.742
           YMR223W
          Length = 459

 Score = 38.9 bits (89), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 1/61 (1%)

Query: 652 PAGPLTYVLRSVIVHYGTHNYGHYIAFRKYR-GCWWRISDETVYVVEEAEVLSTSGVFML 710
           P   + Y L  V+ H GT N GHY A  +   G W++ +D  + VV   +VL      +L
Sbjct: 390 PTTSIVYRLSGVVSHSGTVNEGHYTAVLQLNSGEWFKFNDSMISVVSAEDVLREQAYLLL 449

Query: 711 F 711
           +
Sbjct: 450 Y 450

>KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5.443
            YOR124C
          Length = 1262

 Score = 38.9 bits (89), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query: 658  YVLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVEEAEVLS 703
            Y L +V +H G  +YGHY  + K     G W + +DETV  V E EV +
Sbjct: 1179 YSLFAVFIHRGEASYGHYWVYVKDFKNSGIWRKYNDETVSEVPEEEVFN 1227

 Score = 31.6 bits (70), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 24/43 (55%)

Query: 78  GQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           G +D   L    +  GL N GNTC++NS++Q   + A L  ++
Sbjct: 711 GLIDPSCLPVENWPIGLNNIGNTCYLNSLLQYYFAIAPLRNYI 753

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] {ON}
            similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124C UBP2 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions capable of cleaving
            polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score = 38.9 bits (89), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 34/65 (52%), Gaps = 8/65 (12%)

Query: 656  LTYVLRSVIVHYGTHNYGHYIAF---RKYRGCWWRISDETVYVVEEAEVL-----STSGV 707
            + Y L +  +H G  +YGHY  +   RK  G W + +DE+V  V ++EV      +T+  
Sbjct: 1155 IGYSLFAAFIHRGEASYGHYWIYIKDRKKNGIWRKYNDESVTEVPQSEVFNFTEGNTATP 1214

Query: 708  FMLFY 712
            + L Y
Sbjct: 1215 YFLVY 1219

 Score = 35.8 bits (81), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 25/43 (58%)

Query: 78  GQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           G VD   L  G +  GL N GNTC++NS++Q   S + L  ++
Sbjct: 687 GIVDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFSISPLRDYV 729

>ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some
           similarities with uniprot|P32571 Saccharomyces
           cerevisiae YDR069C DOA4 Ubiquitin hydrolase required for
           recycling ubiquitin from proteasome-bound ubiquitinated
           intermediates acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 877

 Score = 38.5 bits (88), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 32/79 (40%), Gaps = 2/79 (2%)

Query: 640 PPVNTAPIPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAF--RKYRGCWWRISDETVYVVE 697
           PP  T  +PS     P  Y L +V  H G+   GHY A+  +     W+   D     + 
Sbjct: 797 PPGVTDELPSRGQVAPFKYKLYAVASHSGSLYGGHYTAYVDKGLNKGWYYFDDTGYRPMR 856

Query: 698 EAEVLSTSGVFMLFYEYDY 716
                 TS  ++LFY   Y
Sbjct: 857 TPTECITSNAYVLFYHRVY 875

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 3/38 (7%)

Query: 79  QVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAEL 116
           Q  Q+ LD   +  GL N GN+C++N +IQ L  + EL
Sbjct: 505 QTKQYDLD---FTVGLENMGNSCYINCIIQCLLGTHEL 539

>SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 893

 Score = 38.5 bits (88), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 33/82 (40%), Gaps = 6/82 (7%)

Query: 638 MPPPVNTAPIPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAF---RKYRGCWWRISDETVY 694
           +PP V   P    VP  P +Y L +V  H GT   GHY A+      RG W    D    
Sbjct: 813 LPPGVTELPTRGQVP--PFSYKLYAVASHTGTLYGGHYTAYVHKGSQRG-WCYFDDTNWR 869

Query: 695 VVEEAEVLSTSGVFMLFYEYDY 716
                    TS  ++LFY   Y
Sbjct: 870 RSRSDNECITSNAYVLFYHRVY 891

 Score = 36.6 bits (83), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 5/46 (10%)

Query: 75  PRGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           PR     Q+ LD   +  GLVN GN+C+MN +IQ L  + EL +  
Sbjct: 511 PRASA--QYDLD---FSVGLVNLGNSCYMNCIIQCLLGTHELSQMF 551

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
           (REAL)
          Length = 1255

 Score = 38.5 bits (88), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 29/66 (43%), Gaps = 2/66 (3%)

Query: 55  SHIGDMTRNFNPTNGFRRWMPRGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSA 114
           S+  D+     P  G   W         + L+ G    GLVN GNTC+MNS +Q L    
Sbjct: 329 SNPSDLVIEVKPIKGNCHWA--SNYFAYNKLEPGSGTTGLVNLGNTCYMNSALQCLVHIP 386

Query: 115 ELMKFL 120
           +L  + 
Sbjct: 387 QLRDYF 392

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
           YJL197W UBP12 Ubiquitin-specific protease present in the
           nucleus and cytoplasm that cleaves ubiquitin from
           ubiquitinated proteins
          Length = 1204

 Score = 38.5 bits (88), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 27/63 (42%), Gaps = 2/63 (3%)

Query: 58  GDMTRNFNPTNGFRRWMPRGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELM 117
           GD        N    W+      +Q T   G  + GL N GNTC+MNS +Q L    EL 
Sbjct: 261 GDFVVELRQYNKNYHWLSNYFMYNQLTPSSG--ITGLYNLGNTCYMNSALQCLVHIPELR 318

Query: 118 KFL 120
            + 
Sbjct: 319 DYF 321

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 38.5 bits (88), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 28/66 (42%), Gaps = 2/66 (3%)

Query: 55  SHIGDMTRNFNPTNGFRRWMPRGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSA 114
           S+  D+     P  G   W         + L+      GLVN GNTC+MNS +Q L    
Sbjct: 329 SNPSDLVIEIKPIEGHHHWA--SNYFAYNKLEPASGTTGLVNLGNTCYMNSALQCLVHIP 386

Query: 115 ELMKFL 120
           +L  + 
Sbjct: 387 QLRDYF 392

>ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL186W (UBP10)
          Length = 749

 Score = 38.1 bits (87), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 2/60 (3%)

Query: 655 PLTYVLRSVIVHYG-THNYGHYIAFRKY-RGCWWRISDETVYVVEEAEVLSTSGVFMLFY 712
           P+ Y L SV+VH G + + GHYIA  K   G W    DE +  + E  VL     + L Y
Sbjct: 635 PVKYQLISVVVHEGRSLSSGHYIAHCKQPDGTWATYDDEYINKITERNVLKEVNAYYLVY 694

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
           YBL067C
          Length = 727

 Score = 38.1 bits (87), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 46/89 (51%), Gaps = 13/89 (14%)

Query: 658 YVLRSVIVHYG-THNYGHYIAFRKYRGCWWRI-SDETVYVVEE---AEVLS----TSGVF 708
           Y L S++VH G +   GHY+   K++   W I  DETV  V +   + +L+    ++  +
Sbjct: 587 YELNSIVVHIGESPQLGHYVTLCKHKSYGWLIYDDETVQAVSDELVSRILNNEQRSATAY 646

Query: 709 MLFYEYDYDEATGKMREDLESDLEDENQE 737
           +LFYE    E   K+ +  + DL  +N E
Sbjct: 647 LLFYE----EVDSKITQIYDIDLYAKNIE 671

>Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR296C
          Length = 1517

 Score = 38.1 bits (87), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 89/418 (21%), Positives = 148/418 (35%), Gaps = 111/418 (26%)

Query: 91   VAGLVNDGNTCFMNSVIQSLASSAELMKFLXXXXXXXXXXXXXXLLQDEEKPTSVEPDTI 150
            + GL N  NTC++NS++Q L S++                             S E DT+
Sbjct: 1104 ITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLK-------------SPEMDTM 1150

Query: 151  ERXXXXXXXXXXXXHANRKLANGVSDEEKTPDVTFSLALREMLNKLNTKYYKERPCFKTN 210
             R                               +F +  R+M        Y    C    
Sbjct: 1151 SR-------------------------------SFYMLFRKM--------YMNGGCSVVP 1171

Query: 211  KLLKSMTKSPNKNIILGYDQEDAQEFFQTILSELEKNVKSLEGKPSEATPIPNAELPKNA 270
                 M  +   ++ + Y Q+D QEF   +L +L   + S+E   ++             
Sbjct: 1172 SGFLKMCNTLKPDLRIPYGQQDTQEFLLFLLDKLHDELSSIESVSND------------- 1218

Query: 271  VIGQAHLDKVGDVYLPSDQIDPNLVLTNEGKQLYTPFRLVTPLD----GITAERIGCLQC 326
                +HL    +V L  D    N        Q       ++P+D    G    ++ C +C
Sbjct: 1219 ---YSHLLLHDNVRLYVDDAQYNKWFDQNIDQ-----NGLSPIDDLFQGQMENQLSCQRC 1270

Query: 327  GENGGIRYSVTSSMSLNLP---SEDIGST--LKLSDLLNQWIKPEIIE---GVSCNRCAL 378
            G      YS    +SL LP   ++  G T  L+L D +N +   E++       C RC  
Sbjct: 1271 GY-SSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDCPRCC- 1328

Query: 379  EAVRDHLLEQLK-------QYE--NKGDSIPEKLLQ-AFKARVEELNVSLSKPMVSDEDY 428
             +  D++    K        +E  N G+S   KL +  +K R          P  S    
Sbjct: 1329 -SPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRS-----EAPKFS---- 1378

Query: 429  KRLHTENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVLFKSRLNL 486
             +L  +    K +  K + F+  P +L IH++R ++D    + +KNN  V +   LN+
Sbjct: 1379 SKLSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYD----LTKKNNIVVSYPLILNI 1432

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
            YOR124C
          Length = 1295

 Score = 38.1 bits (87), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 8/63 (12%)

Query: 658  YVLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVEEAEVL-----STSGVFM 709
            Y L +V +H G  +YGHY  + K     G W + +DETV  V + EV      +T+  + 
Sbjct: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATPYF 1273

Query: 710  LFY 712
            L Y
Sbjct: 1274 LVY 1276

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 49/113 (43%), Gaps = 22/113 (19%)

Query: 17  IEPLNRNTNSEVPITTAIILVSTAFF---------FIKYKSFIMNNLSHIGDMTRNFNPT 67
           I  +N N N EV +        T +F         F+ YK  +M     +G + RN    
Sbjct: 681 ILQVNENANDEVILKN----FQTKWFNEQIHEADQFLNYKCALM----KLG-LERNSKLI 731

Query: 68  NGFRRWMPRGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           N F       G +D   L    +  G+ N GNTC++NS++Q   S + L +++
Sbjct: 732 NNFLM----NGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYV 780

>Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa]
           {ON} complement(213762..214973) [1212 nt, 404 aa]
          Length = 403

 Score = 37.7 bits (86), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 89/194 (45%), Gaps = 26/194 (13%)

Query: 310 VTPLDGITAERI-GCLQCGENGGIRYSVTS--SMSLNLPSEDIGS-----TLKLSDLLNQ 361
           ++P+D I   +I   L C   G + Y+ ++   +SL +P    G+      +KL D +N 
Sbjct: 134 LSPIDHIFQGQIENTLTCQRCGFVSYNYSTFYVLSLAIPKPSSGTFSRSKRVKLEDCINM 193

Query: 362 WIKPEIIEGVS---CNRCALEAVRDHLLEQLKQYENKGDSIPEKLLQAFKARV---EELN 415
           +   E++ G +   C+ C   +V  H +EQ K   +K     E+  ++ K+R+     +N
Sbjct: 194 FTNDEVLSGENAWDCSNCGSSSV--HNVEQRK---DKTTGNGEEKKRSRKSRLFLLPNIN 248

Query: 416 VSLSK---PMVSDEDYKRLHTENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTYMIR 472
              S+   P       +  H +   +K    K + F+  PP L IH++R  +D    + +
Sbjct: 249 GRSSRSISPFRKSASPRPPHEKLKHKKLVTIKSMNFISLPPTLVIHLSRFYYD----LSK 304

Query: 473 KNNSRVLFKSRLNL 486
           KN + V +   LN+
Sbjct: 305 KNETIVTYPLILNI 318

>Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON}
           (88495..89895) [1401 nt, 467 aa]
          Length = 466

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 656 LTYVLRSVIVHYGTHNYGHYIAFRKY-RGCWWRISDETVYVVEEAEVLSTSGVFMLF 711
           L Y L  +I H GT N GHY A  K   G W + +D  V ++ E  +L      +++
Sbjct: 404 LIYELIGIICHTGTVNEGHYTAICKIPEGQWIKFNDSMVTIISEETMLKEQAYLLIY 460

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 40/87 (45%), Gaps = 8/87 (9%)

Query: 221 NKNIILGYDQEDAQEFFQTILSELEKNVKSLEGKPSEATPIPNAELPKNAVIGQAHLDKV 280
           N+N+  GY Q+DA EF+Q +L+ L    KS  G P++  P+       N  +      KV
Sbjct: 223 NQNLA-GYSQQDAHEFWQFLLNRLHSEYKSNIG-PTDTAPLKEG----NHELCNCIYHKV 276

Query: 281 GDVYLPSDQIDPNLVLTNEGKQLYTPF 307
              +L S  + P     ++ K    PF
Sbjct: 277 FQGFLKSSIVCPE--CNSDAKTTIEPF 301

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
           YJL197W (REAL)
          Length = 1256

 Score = 38.1 bits (87), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 29/66 (43%), Gaps = 2/66 (3%)

Query: 55  SHIGDMTRNFNPTNGFRRWMPRGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSA 114
           S+  D+     P  G   W+        + L+      GLVN GNTC+MNS +Q L    
Sbjct: 326 SNPSDLVIEVKPVEGNHHWV--SNHFVYNKLEPASGTTGLVNLGNTCYMNSALQCLVHLP 383

Query: 115 ELMKFL 120
           +L  + 
Sbjct: 384 QLRDYF 389

>TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {ON}
            Anc_7.390 YBL067C
          Length = 1171

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 9/65 (13%)

Query: 658  YVLRSVIVHYGTH-NYGHYIAFRKY-RGCWWRISDETVYVVEEAEVLSTSG-------VF 708
            Y L  ++VH G    +GHY+A  K  +  W  + DETV  + E  VL   G        +
Sbjct: 1006 YELNGIVVHMGGGPQHGHYVAICKNDKFGWLLMDDETVETISEETVLRCKGDSKDLTTAY 1065

Query: 709  MLFYE 713
            +LFY+
Sbjct: 1066 VLFYK 1070

>SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 454

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 655 PLTYVLRSVIVHYGTHNYGHYIAFRKY-RGCWWRISDETVYVVEEAEVLSTSGVFMLFY 712
            + Y L  +I H G+ N GHY +  K   G W++ +D  V  V E +VL     ++LFY
Sbjct: 391 AIVYELIGLISHQGSVNQGHYTSICKIPGGQWFKFNDSMVTAVAEIDVLKEQA-YLLFY 448

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 66/162 (40%), Gaps = 46/162 (28%)

Query: 84  TLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFLXXXXXXXXXXXXXXLLQDEEKPT 143
           +++K   +AGLVN G+TCFM+S+IQ+L  +  ++K                 LQ+     
Sbjct: 128 SVEKRNGLAGLVNMGSTCFMSSIIQTLIHNPYILKHSMDQLHSTTCD-----LQNSSSCM 182

Query: 144 SVEPDTIERXXXXXXXXXXXXHANRKLANGVSDEEKTPDVTFSLALREMLNKLNTKYYKE 203
           S   D I                       +SD        F  A +   ++ N + +  
Sbjct: 183 SCAVDQI-----------------------ISD--------FYGASKSETSETNQQGF-- 209

Query: 204 RPCFKTNKLLKSMTKSPNKNIILGYDQEDAQEFFQTILSELE 245
                 N L  S  K+ N   + GY Q+DA EF+Q +L++L 
Sbjct: 210 -----VNLLSCSWRKNKN---LAGYSQQDAHEFWQFLLNQLH 243

>CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} similar
           to uniprot|Q01477 Saccharomyces cerevisiae YER151c UBP3
           ubiquitin-specific proteinase
          Length = 816

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 657 TYVLRSVIVHYG-THNYGHYIA--FRKYRGCWWRISDETVYVVEEAEVL 702
           TY L  VI H+G + + GHY A  F K    W+RI D  +  +E+ +VL
Sbjct: 746 TYELSGVIYHHGMSPDGGHYTADVFHKQTKTWYRIDDVNITKLEDDDVL 794

>ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR124C
            (UBP2)
          Length = 1389

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 658  YVLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVEEAEVLSTS 705
            Y L +V +H G  +YGHY  + K     G W + +DE+V  V E+EV   S
Sbjct: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFS 1360

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 27/43 (62%)

Query: 78  GQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           G VD + L  G +  G+ N GNTC++NS++Q   + + L +++
Sbjct: 663 GLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYI 705

>Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR124C
            (UBP2) - Ubiquitin-specific protease [contig 130] FULL
          Length = 1233

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 3/51 (5%)

Query: 656  LTYVLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVEEAEVLS 703
            L Y L +V +H G  +YGHY  + K     G W + +DETV    E EV +
Sbjct: 1148 LGYSLFAVFIHRGEASYGHYWLYIKDHNRNGIWRKYNDETVTEAPENEVFN 1198

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 24/43 (55%)

Query: 78  GQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           G +D   L    +  GL N GNTC++NS++Q     + L +F+
Sbjct: 689 GTIDVRCLPARNWPTGLNNIGNTCYLNSLLQYYFCISPLRQFI 731

>ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {ON}
           some similarities with uniprot|P53874 Saccharomyces
           cerevisiae YNL186W UBP10 Ubiquitin-specific protease
           that deubiquitinates ubiquitin-protein moieties may
           regulate silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 702

 Score = 37.7 bits (86), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 655 PLTYVLRSVIVHYG-THNYGHYIAF-RKYRGCWWRISDETVYVVEEAEVLSTSGVFMLFY 712
           PL Y L +V+VH G + + GHYI   ++  G W    DE +  + E +VL     + L Y
Sbjct: 584 PLKYQLITVVVHEGRSLSSGHYIVHCKQPEGHWATYDDEYINNINEKDVLREPNAYYLVY 643

>CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069c DOA4
           ubiquitin-specific protease
          Length = 887

 Score = 37.7 bits (86), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 36/76 (47%), Gaps = 4/76 (5%)

Query: 640 PPVNTAPIPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAF-RKYRGCWWRISDETVY--VV 696
           PP  T  IP+     P  Y L     H+GT   GHY ++  K     W   D+TVY  V 
Sbjct: 808 PPGITDEIPARGQVPPFNYRLYGAACHFGTLYGGHYTSYVDKGPEKGWIYFDDTVYRPVR 867

Query: 697 EEAEVLSTSGVFMLFY 712
            + E +S S  ++LFY
Sbjct: 868 FQNEFISPSA-YVLFY 882

 Score = 35.0 bits (79), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 66  PTNGFRRWMPRGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           P+   R+  P         +D   +  GL N GN+C++N +IQ + ++ EL+K  
Sbjct: 500 PSTLIRKNSPEKTLSCNQMMDTS-FTVGLENMGNSCYINCIIQCIFATTELIKIF 553

>NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188
          Length = 795

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 4/68 (5%)

Query: 653 AGPLTYVLRSVIVHYGTHNYGHYIAFRKYRG---CWWRISDETVYVVEEAEVLSTSGVFM 709
            GP  Y L +V  H GT   GHY A+   +G    W+   D +  +V+ A        ++
Sbjct: 729 VGPFKYQLNAVACHMGTLGSGHYTAYVN-KGPDVGWYYFDDSSHRIVKIATEYMNPDAYL 787

Query: 710 LFYEYDYD 717
           LFY   Y+
Sbjct: 788 LFYHRVYN 795

>KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 446

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 656 LTYVLRSVIVHYGTHNYGHYIAFRKYR-GCWWRISDETVYVVEEAEVLSTSGVFMLFY 712
           + Y L +V+ H GT + GHY    K   G W++ +D  V  V E +VL     ++LFY
Sbjct: 387 IAYDLLNVVSHQGTVDQGHYTTVSKTEDGQWFKFNDSVVTSVTEEQVLEQQA-YLLFY 443

>Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {ON}
           complement(57514..60162) [2649 nt, 883 aa]
          Length = 882

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 8/82 (9%)

Query: 640 PPVNTAPIPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAFRKY---RGCWWRISDETVY-- 694
           PP  T  +P+     P  Y L +V  H G+   GHY A+      RG  W   D+T Y  
Sbjct: 802 PPGVTDELPTRGQVPPFRYKLNAVASHVGSLYGGHYTAYVNKGINRG--WHYFDDTSYRP 859

Query: 695 VVEEAEVLSTSGVFMLFYEYDY 716
           +  E E + T   ++LFY   Y
Sbjct: 860 IKNETECI-TPNAYVLFYHRVY 880

 Score = 35.4 bits (80), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 90  YVAGLVNDGNTCFMNSVIQSLASSAEL 116
           +  GL N GN+C+MN +IQ L S+ EL
Sbjct: 517 FTVGLENMGNSCYMNCIIQCLLSTHEL 543

>TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.540
           YPL072W
          Length = 734

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 81/172 (47%), Gaps = 12/172 (6%)

Query: 312 PLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLLNQWIKPEIIEGV 371
           P  G  A+ + C++C  +  +         L +P      + KLSD+++   + + IEG 
Sbjct: 297 PFGGQLADHLVCMKCTNSSKVNIHPFIIYPLTVPQ---AMSAKLSDMVSDN-QTDTIEGY 352

Query: 372 SCNRCALEAVRDHLLEQLKQYENKGDSIPEKLLQAFKARVEELNVS--LSKPMVS-DEDY 428
           SC  C +  + ++  E+ + Y  K     +++L+  +  + ++ ++  LS  + S    Y
Sbjct: 353 SCLTCKVSTIVNY--EKGRGYA-KCTQEEKRILKTLEDALPDMAINDELSDELTSYINSY 409

Query: 429 KRLHTENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVLF 480
            +        K +  K+ + +  P  L +H++RS+FD  +Y  ++N+  V F
Sbjct: 410 NKDGIVGADLKSTIVKKTVVVESPKTLVMHLSRSMFDGISY--QRNSCGVAF 459

 Score = 35.0 bits (79), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 20/29 (68%)

Query: 651 VPAGPLTYVLRSVIVHYGTHNYGHYIAFR 679
           V   P++Y L++++ H G+H+ GHY  +R
Sbjct: 476 VGINPISYKLKAIVAHSGSHSQGHYECYR 504

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 90  YVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           Y  GL+N+ N CF N  +Q+LAS   L  +L
Sbjct: 71  YTTGLINNRNDCFANCSVQALASLPGLTSYL 101

>TPHA0O01640 Chr15 complement(325844..328084) [2241 bp, 746 aa] {ON}
           Anc_2.69 YNL186W
          Length = 746

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 29/59 (49%), Gaps = 2/59 (3%)

Query: 656 LTYVLRSVIVHYG-THNYGHYIAFRKY-RGCWWRISDETVYVVEEAEVLSTSGVFMLFY 712
           + Y L SV+VH G + + GHYIA  K   G W    DE   ++ E  VL     + L Y
Sbjct: 614 VMYQLISVVVHEGRSLSSGHYIAHCKQPDGTWATYDDEYTNIISERNVLKEPNAYYLVY 672

>KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} similar
            to uniprot|Q01476 Saccharomyces cerevisiae YOR124C UBP2
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions capable of cleaving polyubiquitin and
            possesses isopeptidase activity
          Length = 1241

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 658  YVLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVEEAEVLSTS 705
            Y L +V +H G  +YGHY  + K     G W + +DE+V    E+EV + S
Sbjct: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFS 1208

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 78  GQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQ 108
           G +D   L  G +  GL N GNTC++NS++Q
Sbjct: 689 GIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQ 719

>TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.69
           YNL186W
          Length = 661

 Score = 37.4 bits (85), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 655 PLTYVLRSVIVHYG-THNYGHYIAF-RKYRGCWWRISDETVYVVEEAEVLSTSGVFMLFY 712
           P+ Y L +V+VH G + + GHYI   ++  G W    DE +  + E +VL     + L Y
Sbjct: 546 PVKYQLTTVVVHEGRSLSSGHYIVHCKQPDGTWATYDDEYINKITERDVLKEPNAYYLLY 605

>CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {ON}
           weakly similar to uniprot|Q02863 Saccharomyces
           cerevisiae YPL072w UBP16
          Length = 483

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 18/23 (78%)

Query: 90  YVAGLVNDGNTCFMNSVIQSLAS 112
           Y  GLVN GN C+ NSVIQ+L+S
Sbjct: 70  YTTGLVNKGNYCYANSVIQALSS 92

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
           YMR304W
          Length = 1197

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 31/71 (43%), Gaps = 6/71 (8%)

Query: 638 MPPPVNTAPIPSTVPAG----PLTYVLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDE 691
            P   +T+P       G    P  Y L  V+VH G  + GHY A  K      W+R  DE
Sbjct: 414 FPESFDTSPYMEKKEDGSNNEPCIYNLHGVLVHTGDISTGHYYAMIKPDLEDQWYRFDDE 473

Query: 692 TVYVVEEAEVL 702
            V+ V + +V 
Sbjct: 474 KVWKVTKKQVF 484

>TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8.188
            YDR069C
          Length = 1144

 Score = 37.0 bits (84), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 38/79 (48%), Gaps = 5/79 (6%)

Query: 640  PPVNTAPIPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAF--RKYRGCWWRISDETVY--V 695
            PP  T  +P+     P  Y L  V +H G+   GHY A+  +  +  W+   D+TVY  +
Sbjct: 1021 PPGVTEELPARGQIPPFKYELSGVALHMGSLYGGHYTAYVNKGLKNGWYYF-DDTVYRSI 1079

Query: 696  VEEAEVLSTSGVFMLFYEY 714
               +E+++ +   +   EY
Sbjct: 1080 KYSSEMITQNAYVLFIIEY 1098

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 70/324 (21%), Positives = 114/324 (35%), Gaps = 84/324 (25%)

Query: 90  YVAGLVNDGNTCFMNSVIQSLASSAELMKFLXXXXXXXXXXXXXXLLQDEEKPTSVEPDT 149
           +  GL N GN+C++N +IQ L ++ EL K                L    EK  ++    
Sbjct: 733 FKVGLENMGNSCYLNCIIQCLLNNHELTKMF--------------LNNSYEKHININSKL 778

Query: 150 IER--XXXXXXXXXXXXHANRKLANGVSDEEKTPDV---TFSLALREMLNKLNTKYYKER 204
             +              + N  L+      +K P V   TF  A                
Sbjct: 779 GSKGILAKSFARLVHSMYQNGTLSIKNHSNKKNPPVQPITFKTA---------------- 822

Query: 205 PCFKTNKLLKSMTKSPNKNIILGYDQEDAQEFFQTILSELEKNVKSLEGKPSEATPIPNA 264
            C   N L K            G +Q+D QEF Q +L  L +++      P      P  
Sbjct: 823 -CGSINSLFK------------GSNQQDCQEFCQFLLDGLHEDLNQCGANP------PLK 863

Query: 265 ELPKNAVIGQAHLDKVGDVYLPSDQIDPNLVLTNEGKQLYTPFRLVTPL-DGITAERIGC 323
           EL   A   +   +K+      S + +         + L T F ++  L  G  A ++ C
Sbjct: 864 ELSTEA---ERMREKLSLRIASSIEWE---------RFLTTDFSVIIDLYQGQYASQLKC 911

Query: 324 LQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLLNQWIKPEII---EGVSCNRC---- 376
             CG      Y   S +S+ +P      ++ L D  N++ K E +   E  SC  C    
Sbjct: 912 QVCGT-TSTTYQTFSVLSVPVPK---NKSIHLLDCFNEFTKTEFLGKDELWSCTECKKKQ 967

Query: 377 ------ALEAVRDHLLEQLKQYEN 394
                  +  +  +L+  LK+++N
Sbjct: 968 PSTKTLTITRLPKNLIIHLKRFDN 991

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1247

 Score = 37.0 bits (84), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 654 GPLTYVLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDETVYVVEEAEVL 702
           GP  Y L  V+VH G  + GHY A  K      W+R  DE V+ V + +V 
Sbjct: 492 GPNNYNLHGVLVHTGDISTGHYYAMIKPTTDDKWYRFDDEKVWRVTKKQVF 542

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}
           UBP12Ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1254

 Score = 37.0 bits (84), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 28/66 (42%), Gaps = 2/66 (3%)

Query: 55  SHIGDMTRNFNPTNGFRRWMPRGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSA 114
           S+  D+     P  G   W         + L+      GLVN GNTC+MNS +Q L    
Sbjct: 329 SNPSDLVIEIKPIEGNHHW--PSNYFAYNKLEPASGTTGLVNLGNTCYMNSALQCLVHIP 386

Query: 115 ELMKFL 120
           +L  + 
Sbjct: 387 QLRDYF 392

>KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {ON}
           Anc_1.369 YFR010W
          Length = 499

 Score = 36.6 bits (83), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 35/73 (47%), Gaps = 10/73 (13%)

Query: 638 MPPPVNTAPIPSTVPAGPLTYVLRSVIVHYGTH-NYGHYIAFRKYRG---CWWRISDETV 693
            PP +     PS V      Y L  VI H G + + GHY AF +       W++ +D+ V
Sbjct: 416 FPPDLQAGENPSCV------YNLVGVITHQGANSDSGHYQAFIRDENDENVWYKFNDDKV 469

Query: 694 YVVEEAEVLSTSG 706
            +VE+  V + +G
Sbjct: 470 SIVEKERVEALAG 482

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
           (REAL)
          Length = 1230

 Score = 36.6 bits (83), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 6/71 (8%)

Query: 638 MPPPVNTAPIPSTVPAG----PLTYVLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDE 691
           + P V+   +  T+ +G    P  Y L  V+VH G  + GHY    K      W+R  DE
Sbjct: 424 LSPFVDKDVLKKTLDSGDNGNPYIYNLHGVLVHSGDISTGHYYTLIKPGVEDQWYRFDDE 483

Query: 692 TVYVVEEAEVL 702
            V+ V + +V 
Sbjct: 484 RVWRVTKKQVF 494

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER098W (UBP9) and
           YBL067C (UBP13)
          Length = 740

 Score = 36.6 bits (83), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 45/94 (47%), Gaps = 15/94 (15%)

Query: 658 YVLRSVIVHYGTH-NYGHYIAFRKYRGCWWRI-SDETVYVVEEAEVLSTSG-------VF 708
           Y L  +++H G    +GHY+A  K+    W +  DETV  V E  VL   G        +
Sbjct: 592 YELNGIVIHMGGGPQHGHYVAICKHELFGWLLYDDETVESVGEDAVLRFIGDVNDMTTAY 651

Query: 709 MLFYEYDYDEATGKMREDLESDLEDENQEEDEKL 742
           +LFY+   ++      +D  ++L+D N   D+ L
Sbjct: 652 VLFYKSKRED------DDTPAELQDYNANIDQLL 679

 Score = 33.1 bits (74), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 25/51 (49%), Gaps = 8/51 (15%)

Query: 66  PTNGFRRWMPRGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAEL 116
           P    RR +P G        D    V GL N GNTC+ NSV+Q L +  EL
Sbjct: 81  PAGKDRRLLPFG--------DGTPKVFGLENYGNTCYCNSVLQCLYNLKEL 123

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
           YMR304W
          Length = 1213

 Score = 36.6 bits (83), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 655 PLTYVLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDETVYVVEEAEVL 702
           P  Y L  V+VH G  + GHY A  K      W+R  DE V+ V + +V 
Sbjct: 428 PCIYKLHGVLVHAGDISTGHYYAMIKPSTEDQWYRFDDEKVWKVTKTQVF 477

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa]
           {ON} similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304W UBP15 Ubiquitin-specific protease that may play
           a role in ubiquitin precursor processing
          Length = 1193

 Score = 36.6 bits (83), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 654 GPLTYVLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDETVYVVEEAEVL 702
           GP  Y L  V+VH G  + GHY A  K      W+R  DE V+ V + +  
Sbjct: 436 GPRWYGLHGVLVHTGDISTGHYYALIKPGLEDQWYRFDDERVWKVSKKQAF 486

>TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.188
           YDR069C
          Length = 825

 Score = 36.6 bits (83), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 33/79 (41%), Gaps = 2/79 (2%)

Query: 640 PPVNTAPIPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAF--RKYRGCWWRISDETVYVVE 697
           PP  T  +P+   + P  Y L  +  H G+   GHY ++  +  +  W    D +   V 
Sbjct: 745 PPGVTEELPTRGQSPPFNYKLYGIASHVGSLYGGHYTSYVDKGPKRGWCYFDDTSFRPVR 804

Query: 698 EAEVLSTSGVFMLFYEYDY 716
            A    T   ++LFY   Y
Sbjct: 805 NATECITPNAYVLFYHRVY 823

 Score = 35.0 bits (79), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 3/46 (6%)

Query: 71  RRWMPRGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAEL 116
           R   P  G  +++ LD   +  GL N GN+C++N ++Q L  + EL
Sbjct: 445 RESSPALGSANKYDLD---FAVGLENMGNSCYINCIVQCLLGTHEL 487

>YBR058C Chr2 complement(353672..356017) [2346 bp, 781 aa] {ON}
           UBP14Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains; involved in
           fructose-1,6-bisphosphatase (Fbp1p) degradation; similar
           to human isopeptidase T
          Length = 781

 Score = 36.2 bits (82), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 70  FRRWMPRGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSA 114
           FR     G + ++ +  K  Y  GL+N GN+C++NSVIQSL +  
Sbjct: 302 FRMVDSSGKEFEKLSASKN-YGCGLINLGNSCYLNSVIQSLVNGG 345

>Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL197W
           (UBP12) - ubiquitin carboxyl-terminal hydrolase [contig
           114] FULL
          Length = 1160

 Score = 36.2 bits (82), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 9/54 (16%)

Query: 76  RGGQVDQHTLDKGGY---------VAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           +G + DQH L    Y         + GL N GN+C+MNS +Q L    EL  + 
Sbjct: 273 KGVEKDQHWLSNYYYYNKLSPPSGIVGLSNLGNSCYMNSALQCLVHIPELRDYF 326

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 36.2 bits (82), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 33/72 (45%), Gaps = 7/72 (9%)

Query: 638 MPPPVNTAPIPSTVPAG-----PLTYVLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISD 690
           + P V+   +  T+ +G     P  Y L  V+VH G  + GHY    K      W+R  D
Sbjct: 424 LSPFVDKDVLRKTLDSGDKDKNPYIYNLHGVLVHSGDISTGHYYTLIKPGVEDQWYRFDD 483

Query: 691 ETVYVVEEAEVL 702
           E V+ V + +V 
Sbjct: 484 ERVWRVTKKQVF 495

>Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W
           (REAL)
          Length = 499

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 36/73 (49%), Gaps = 10/73 (13%)

Query: 638 MPPPVNTAPIPSTVPAGPLTYVLRSVIVHYGTHN-YGHYIAFRKYR---GCWWRISDETV 693
            PP +     PS V      Y L  VI H G ++  GHY AF +       W++ +D+ V
Sbjct: 416 FPPNLEKGENPSCV------YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKV 469

Query: 694 YVVEEAEVLSTSG 706
            VVE+ ++ S +G
Sbjct: 470 SVVEKEKIESLAG 482

>YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}
           UBP6Ubiquitin-specific protease situated in the base
           subcomplex of the 26S proteasome, releases free
           ubiquitin from branched polyubiquitin chains; works in
           opposition to Hul5p polyubiquitin elongation activity;
           mutant has aneuploidy tolerance
          Length = 499

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 36/73 (49%), Gaps = 10/73 (13%)

Query: 638 MPPPVNTAPIPSTVPAGPLTYVLRSVIVHYGTHN-YGHYIAFRKYR---GCWWRISDETV 693
            PP +     PS V      Y L  VI H G ++  GHY AF +       W++ +D+ V
Sbjct: 416 FPPNLEKGENPSCV------YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKV 469

Query: 694 YVVEEAEVLSTSG 706
            VVE+ ++ S +G
Sbjct: 470 SVVEKEKIESLAG 482

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]
           {ON} Anc_1.137 YJL197W
          Length = 1178

 Score = 36.2 bits (82), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 21/38 (55%)

Query: 83  HTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           +TL     + GL N GNTC+MNS +Q L    EL  + 
Sbjct: 293 NTLQPSQGITGLTNLGNTCYMNSALQCLVHIPELRDYF 330

 Score = 31.6 bits (70), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 2/61 (3%)

Query: 652  PAGPLTYVLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVEEAEVLSTSGVFMLF 711
            P G + Y L +V  H+G    GHY A+ K    W+   D  V   +    ++ S  ++LF
Sbjct: 954  PRGSI-YDLIAVDNHFGGLGGGHYTAYVKTNDKWFYFDDSRVTETKPESSIAGSA-YLLF 1011

Query: 712  Y 712
            Y
Sbjct: 1012 Y 1012

>ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly
           similar to uniprot|Q02863 Saccharomyces cerevisiae
           YPL072W UBP16 Putative ubiquitin-specific protease
          Length = 821

 Score = 36.2 bits (82), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 82/197 (41%), Gaps = 14/197 (7%)

Query: 312 PLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLLNQWIKPEIIEGV 371
           P  G  A+ + C  C  +  +R +  + + L +P      T KL+++++   + E IEG 
Sbjct: 334 PFRGKVADHLVCTACRNSSKVRVTQFNMLPLAVPQ---AITAKLAEMVSDN-QVESIEGY 389

Query: 372 SCNRCAL-EAVRDHLLEQLKQYENKGDSIPEKLLQAFKARVEELNVSLSKPMVSDEDYKR 430
           SC  C + + + +        YE    +    L +AF       +VS  + M     Y R
Sbjct: 390 SCLTCKVGKILENEKGRDTSSYETTEQNTLASLARAFPNLTINDDVS-EELMNYINGYNR 448

Query: 431 LHTENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVLFKSRLNLSPW- 489
                   K +  K+ + +  P +L IH++RS+F+   Y   +N   V F   L L    
Sbjct: 449 DGLVTSQLKSTIVKKNVVVDAPQVLLIHLSRSMFNGTNYT--RNPCAVNFDEILQLQEQV 506

Query: 490 -----CCDVDEINLDAR 501
                C  ++ +N + +
Sbjct: 507 IQNDRCVGINSVNYELK 523

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa]
           {ON} uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
           carboxyl-terminal hydrolase 2
          Length = 1220

 Score = 36.2 bits (82), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 33/67 (49%), Gaps = 5/67 (7%)

Query: 54  LSHIGDMTRNFNPTNGFRRWMPRGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASS 113
           L +IG  TRN    N F       G VD   L    + AG+ N GNTC++NS++Q   + 
Sbjct: 665 LQNIG-FTRNSKLINHFLD----TGIVDVSCLPVATWPAGINNVGNTCYLNSLLQFFFTI 719

Query: 114 AELMKFL 120
             L  F+
Sbjct: 720 KPLRDFI 726

 Score = 35.8 bits (81), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 656  LTYVLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVEEAEVLS 703
            + Y L +V +H G  +YGHY  + K     G W + +D++V  V ++EV +
Sbjct: 1135 IGYSLFAVFIHRGEASYGHYWVYIKDHTKNGIWRKYNDDSVTEVPQSEVFN 1185

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
            YOR124C
          Length = 1283

 Score = 36.2 bits (82), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 656  LTYVLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVEEAEVLS 703
            + Y L +V +H G  +YGHY  + K       W + +DET+  V ++EV +
Sbjct: 1199 IKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFN 1249

>NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.369
           YFR010W
          Length = 493

 Score = 35.8 bits (81), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 10/73 (13%)

Query: 638 MPPPVNTAPIPSTVPAGPLTYVLRSVIVHYGTHN-YGHYIAFRKYR---GCWWRISDETV 693
            PP +     PS+V      Y L  +I H G ++  GHY AF +       W++ +D+ V
Sbjct: 410 FPPDLQPGENPSSV------YNLVGIITHQGANSESGHYQAFIRDETDENKWYKFNDDKV 463

Query: 694 YVVEEAEVLSTSG 706
            VVE+ ++ + +G
Sbjct: 464 SVVEKEKIEALAG 476

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 36.2 bits (82), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 2/60 (3%)

Query: 658 YVLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDETVYVVEEAEVLSTSGVFMLFYEYD 715
           Y L  V+VH G  + GHY A  K      W+R  D+ V+ V + +V   +  F    EYD
Sbjct: 427 YNLHGVLVHTGDISTGHYYAMIKPGLEDAWYRFDDDKVWRVTKKQVFEQNFGFDKLSEYD 486

>Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON}
           (118060..119550) [1491 nt, 497 aa]
          Length = 496

 Score = 35.8 bits (81), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 88/200 (44%), Gaps = 24/200 (12%)

Query: 312 PLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLL--NQWIKPEIIE 369
           P +G  A  + CL CG+      S  + + +  P E    + +L +++  NQ    + I 
Sbjct: 208 PFEGKLASYLSCLNCGQTSIPNISTFNILPIQTPQE---YSAELEEIIYGNQI---DQIT 261

Query: 370 GVSCNRCALEAVRDHLLEQLKQYENKGDSIPEKLLQAFKARV-------EELNVSLSKPM 422
             SC  C   A+    L+  K   +KG++  E  +  +   V       EEL+   SK +
Sbjct: 262 DYSCLVCQTNAI----LKNEKTNGHKGNTTDEHEIVKYLEDVLPVLRINEELD---SKTL 314

Query: 423 VSDEDYKRLHTENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVLFKS 482
              + Y +   ++   K +  K+   +  P +L IH++RS+++    +  +N+ RV F+ 
Sbjct: 315 NYIKYYNKYGMKSGNIKSTIIKKNSIIETPKILMIHLSRSIYNGMVAV--RNSCRVRFEE 372

Query: 483 RLNLSPWCCDVDEINLDARL 502
           ++++     D    NL   L
Sbjct: 373 KMSIERQTTDEKNENLKIEL 392

 Score = 34.7 bits (78), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 17/23 (73%)

Query: 658 YVLRSVIVHYGTHNYGHYIAFRK 680
           Y L+S+I H GTHN GHY  +R+
Sbjct: 395 YQLQSIIKHTGTHNSGHYQCYRR 417

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
           bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 35.8 bits (81), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 655 PLTYVLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDETVYVVEEAEVL 702
           P  Y+L  V+VH G  + GHY A  +    G W+R  D+ V    + +V 
Sbjct: 428 PADYILHGVLVHSGDISTGHYYAMIQPDAHGSWYRFDDDRVIKATDKQVF 477

>KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500
           bp, 499 aa] {ON} Anc_1.369 YFR010W
          Length = 499

 Score = 35.4 bits (80), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 37/73 (50%), Gaps = 10/73 (13%)

Query: 638 MPPPVNTAPIPSTVPAGPLTYVLRSVIVHYGTHN-YGHYIAFRKYRG---CWWRISDETV 693
            P  + T   PS+V      Y L  +I H G ++  GHY AF +       W++ +D+ V
Sbjct: 416 FPENLQTGENPSSV------YDLVGIITHQGANSESGHYQAFIRDENDENIWYKFNDDKV 469

Query: 694 YVVEEAEVLSTSG 706
            ++E+ ++ S +G
Sbjct: 470 SIIEKEKIESLAG 482

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
           Anc_5.18
          Length = 1211

 Score = 35.8 bits (81), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 658 YVLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDETVYVVEEAEVL 702
           Y L  V+VH G  + GHY A  K   +  W+R  DE V+ V + +V 
Sbjct: 444 YTLHGVLVHTGDISTGHYYAMIKPDLQDQWYRFDDEKVWKVTKKQVF 490

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
           complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 35.8 bits (81), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 9/65 (13%)

Query: 658 YVLRSVIVHYGTH-NYGHYIAFRKYRGCWWRI-SDETVYVVEEAEVLSTSG-------VF 708
           Y L  ++VH G    +GHYI+  K     W +  DETV  + E  VLS  G        +
Sbjct: 574 YELGGLVVHIGIGPQHGHYISVCKTSDYGWLLFDDETVECISEDTVLSFVGDSNSAGTAY 633

Query: 709 MLFYE 713
           +LFY+
Sbjct: 634 VLFYK 638

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
           Anc_7.390 YBL067C
          Length = 776

 Score = 35.8 bits (81), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 52/107 (48%), Gaps = 21/107 (19%)

Query: 657 TYVLRSVIVHYGTH-NYGHYIAFRKYRGC------WWRISDETVYVVEEAEVL------- 702
           +Y L+ V+VH G   ++GHY++      C      W    DETV  V+E+ VL       
Sbjct: 610 SYRLQGVVVHMGNGPHHGHYVSL-----CHTELFGWLLFDDETVESVDESYVLDFVGSHE 664

Query: 703 STSGVFMLFY-EYDYDE-ATGKMREDLESDLEDENQEEDEKLDGEIE 747
           S +  ++LFY E D  E A  ++    E DL +   ++   LD E++
Sbjct: 665 SPTTAYVLFYSEIDGSERAVQEIPAVYERDLFEATIKKLISLDNEVK 711

>Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 35.4 bits (80), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%)

Query: 72  RWMPRGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSL 110
           R +   G+  +  L    Y  GL+N GN+C++NSV+QSL
Sbjct: 303 RMVDSSGKEFKRLLPNKDYGCGLINLGNSCYLNSVLQSL 341

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 35.4 bits (80), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 7/72 (9%)

Query: 638 MPPPVNTAPIPSTVPAG-----PLTYVLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISD 690
           + P V+   +  ++ +G     P  Y L  V+VH G  + GHY    K      W+R  D
Sbjct: 424 LSPFVDKEVLKKSLDSGDKSRNPYVYNLHGVLVHSGDISTGHYYTLIKPGVEDQWYRFDD 483

Query: 691 ETVYVVEEAEVL 702
           E V+ V + +V 
Sbjct: 484 ERVWRVTKKQVF 495

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score = 35.4 bits (80), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 86/203 (42%), Gaps = 39/203 (19%)

Query: 310 VTPLDGITAERI----GCLQCGENGGIRYSVTSSMSLNLPSEDI-----GSTLKLSDLLN 360
           ++P+D I   +I     C +CG +    YS    +SL +P            +KL D +N
Sbjct: 756 LSPIDEIFQGQIENGLQCQRCG-HSSFNYSTFYVLSLAIPKPSPTGFSRSKRVKLEDCIN 814

Query: 361 QWIKPEIIEG------VSCNRCALEAVR---DHLLEQLKQYENKGD--------SIPEKL 403
            +   E++ G       +C   A + VR   D  +++ +Q E            + P + 
Sbjct: 815 MFTNDEMLSGENAWDCPNCGSNAQDRVRVNTDQSVKKKRQGEEHRHKSRFFGLPTRPHRS 874

Query: 404 LQAFKARVEELNVSLSKPMVSDEDYKRLHTENMTRKCSKSKQILFLRPPPLLSIHINRSV 463
           L  F+        S SK +  ++ +K       T+K    K + F+  PP+L IH++R  
Sbjct: 875 LSPFRKSGSSSTNSTSK-IKHEQQWK-------TKKLITIKTLNFIMLPPVLVIHLSRFF 926

Query: 464 FDPRTYMIRKNNSRVLFKSRLNL 486
           +D    + +KN + + +   LN+
Sbjct: 927 YD----LTKKNKTVITYPLILNI 945

>Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON}
           YER144C (REAL)
          Length = 805

 Score = 35.0 bits (79), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 20/31 (64%)

Query: 90  YVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           ++ GL N GN C+MN ++Q L  + +L++  
Sbjct: 444 FIVGLENTGNCCYMNCILQCLVGTHDLVRMF 474

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa]
           {ON} similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304W UBP15 Ubiquitin-specific protease that may play
           a role in ubiquitin precursor processing
          Length = 1189

 Score = 35.0 bits (79), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 654 GPLTYVLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDETVYVVEEAEVL 702
           GP  Y L  V+VH G  + GHY A  K      W+R  D+ V+ V + +  
Sbjct: 435 GPCVYNLHGVLVHSGEISVGHYYAMIKPDVGDQWFRFDDDKVWRVTKEQAF 485

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
           UBP15Ubiquitin-specific protease involved in protein
           deubiquitination; catalytic activity regulated by an
           N-terminal TRAF-like domain and and C-terminal
           sequences; physically interacts with anaphase-promoting
           complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 35.0 bits (79), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 655 PLTYVLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDETVYVVEEAEVL 702
           P  Y L  V+VH G  + GHY    K      W+R  DE V+ V + +V 
Sbjct: 446 PYVYNLHGVLVHSGDISTGHYYTLIKPGVEDQWYRFDDERVWRVTKKQVF 495

>KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1227

 Score = 35.0 bits (79), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 26/43 (60%)

Query: 78  GQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           G +D + L    +  GL N GNTC++NS++Q   S A L +++
Sbjct: 696 GVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYI 738

>Kwal_27.11945 s27 (1012266..1014017) [1752 bp, 583 aa] {ON} YBR163W
           (DEM1) - Weak similarity to Pta1p (pre-tRNA processing
           protein) [contig 26] FULL
          Length = 583

 Score = 34.7 bits (78), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 65/144 (45%), Gaps = 12/144 (8%)

Query: 385 LLEQLKQYENKGDSIPEKLLQAFKARVEELNVSLSKPMVSDEDYKRLHTENMTRKCSKSK 444
           ++++L  ++N+     + L +A +A +E   + +   +  DE+  R  T N+  K     
Sbjct: 71  IIDKLPYFQNEPKPSTQGLTKAKRAYLER-KLPIVHELFKDENSSRYLTYNLPAKL---- 125

Query: 445 QILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVLFKSRLNLSPWCCDVDEINLDARLPM 504
                 P P L  H  R + DP T  ++   +  L  +++    WC   +  ++ +R+P+
Sbjct: 126 ------PNPYLDAHA-RPITDPVTGNVKYGGTPRLSVTKMLTKRWCELREAYDIYSRVPI 178

Query: 505 SKKQEQVQESSEDENLGGEYYAKL 528
            + ++  Q   E + L  E +A L
Sbjct: 179 FQHRQVTQGRREHQRLEDEIHAPL 202

>Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar to
           Ashbya gossypii AFR007W
          Length = 851

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 60  MTRNFNPTNGFRRWMPRGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAEL 116
           + RN N   GF      G +    T     +  GLVN GN+C+M+ +IQ L  + EL
Sbjct: 455 LKRNENSV-GFSSMKSPGQEWAMLTAFNLNFSVGLVNCGNSCYMSCIIQCLLGTQEL 510

 Score = 32.3 bits (72), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 30/73 (41%), Gaps = 2/73 (2%)

Query: 643 NTAPIPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAF-RKYRGCWWRISDETVY-VVEEAE 700
           N   +PS     P  Y L  V  H GT   GHY A+  K     W   D+T +  +  + 
Sbjct: 774 NNVELPSRGQVPPFNYQLYGVACHTGTLYGGHYTAYVNKGATLGWCYYDDTNWRQIRSSN 833

Query: 701 VLSTSGVFMLFYE 713
              +   ++LFY 
Sbjct: 834 EYISQNAYVLFYH 846

>Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON}
           YER144C (REAL)
          Length = 788

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 4/70 (5%)

Query: 647 IPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAFRKYRGCW--WRISDETVY-VVEEAEVLS 703
           IP+     P  Y L  V  H G+   GHY ++  Y+G    W   D+T+Y ++       
Sbjct: 717 IPTRGQIPPFRYRLYGVACHSGSLYGGHYTSY-VYKGPQKGWYFFDDTIYRLIRFNNEFI 775

Query: 704 TSGVFMLFYE 713
           T   ++LFYE
Sbjct: 776 TPNAYVLFYE 785

>YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON}
           UBP11Ubiquitin-specific protease that cleaves ubiquitin
           from ubiquitinated proteins
          Length = 717

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 83/189 (43%), Gaps = 22/189 (11%)

Query: 310 VTPLDGITAERI----GCLQCGENGGIRYSVTSSMSLNLPSEDIGS------TLKLSDLL 359
           ++P+D I   ++     C +CG N    YS    +SL +P   + S       +KL D +
Sbjct: 445 LSPIDHIYRGQLENILKCQRCG-NSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCI 503

Query: 360 NQWIKPEIIEGVSCNRCALEAVRDHLLEQLKQYENKGDSIPEKLLQAF--KARVEELNVS 417
           N +   E + G +   C    + D   ++ +    K  S     +  F  ++R +  +  
Sbjct: 504 NLFTGDEELSGDNAWDCPNCRITDSKSKKEEITSQKKKST----IFGFHSRSRSKSPHHH 559

Query: 418 LSKPMVSDEDYKRLHTENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSR 477
                 SD+  K     N ++K +  K + F+  PP+L IH++R  +D    + +KN++ 
Sbjct: 560 HHHHHSSDDSTKNAKKRN-SKKLTTIKSLDFIVLPPILVIHLSRFYYD----LTKKNSTV 614

Query: 478 VLFKSRLNL 486
           + +   LN+
Sbjct: 615 ITYPLILNI 623

>KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {ON}
           Anc_8.188 YDR069C
          Length = 671

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 27/58 (46%), Gaps = 3/58 (5%)

Query: 658 YVLRSVIVHYGTHNYGHYIA--FRKYRGCWWRISDETVYVVEEAEVLSTSGVFMLFYE 713
           Y L +V  H GT   GHY A  F+     W+   D     V   E +S S  ++LFY+
Sbjct: 612 YKLVAVACHTGTLFSGHYTAYCFKNSENGWYHFDDTQCKPVSNGECISQSA-YLLFYQ 668

>Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON}
           YER144C (REAL)
          Length = 823

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 4/70 (5%)

Query: 647 IPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAFRKYRGCW--WRISDETVYV-VEEAEVLS 703
           IP+     P  Y L  V  H G+   GHY ++  Y+G    W   D++VY  +   +   
Sbjct: 752 IPTRGQIPPFRYRLYGVACHSGSLYGGHYTSY-VYKGPQKGWYFFDDSVYCPIRFNDEFI 810

Query: 704 TSGVFMLFYE 713
           T   ++LFYE
Sbjct: 811 TPNAYVLFYE 820

>Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 18/21 (85%)

Query: 90  YVAGLVNDGNTCFMNSVIQSL 110
           Y  GL+N GN+C++NSV+QSL
Sbjct: 321 YGCGLINLGNSCYLNSVMQSL 341

>KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} similar
           to uniprot|P39944 Saccharomyces cerevisiae YER144C UBP5
           Putative ubiquitin-specific protease that does not
           associate with the proteasome
          Length = 796

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 30/74 (40%), Gaps = 1/74 (1%)

Query: 640 PPVNTAPIPSTVPAGPLTYVLRSVIVHYGTHNYGHYIAF-RKYRGCWWRISDETVYVVEE 698
           P  N   +P      P  Y L +V  H GT   GHY +F  K R  W    D +   +  
Sbjct: 718 PKDNGVSLPLRGQKPPFNYRLFAVASHSGTLYGGHYTSFVDKGRVGWCSFDDVSWRKIRR 777

Query: 699 AEVLSTSGVFMLFY 712
            +   T   ++LFY
Sbjct: 778 KDEYITPNAYVLFY 791

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (66%)

Query: 90  YVAGLVNDGNTCFMNSVIQSLASSAEL 116
           +  GLVN GN+C++N +IQ L    EL
Sbjct: 430 FAIGLVNLGNSCYLNCIIQCLLGCHEL 456

>AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR069C (DOA4) and
           YER144C (UBP5)
          Length = 848

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 19/27 (70%)

Query: 90  YVAGLVNDGNTCFMNSVIQSLASSAEL 116
           +  GLVN GN+C+M+ +IQ L  + EL
Sbjct: 486 FSVGLVNCGNSCYMSCIIQCLLGTQEL 512

>KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1198

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 49/110 (44%), Gaps = 20/110 (18%)

Query: 15  FIIEPLNRNTNSEVPITTAIILVSTAFFFIKYKSFIMNNLSHIGDMTR-NFNPTNGF--- 70
           ++++PL   T +E+PI T +            K  +++ +  + D+T  +  P+N F   
Sbjct: 269 YVLDPL---TFAEMPIKTRLQSKMFGCLIKNLKLPVIDLVVELKDVTTGDHWPSNHFYYN 325

Query: 71  RRWMPRGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           +   PRG               GL N GN+C+MNS +Q L    EL  + 
Sbjct: 326 KLLPPRG-------------TTGLSNLGNSCYMNSALQCLVHIPELKDYF 362

>Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 18/21 (85%)

Query: 90  YVAGLVNDGNTCFMNSVIQSL 110
           Y  GL+N GN+C++NSV+QSL
Sbjct: 321 YGCGLINLGNSCYLNSVMQSL 341

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 19/23 (82%)

Query: 88  GGYVAGLVNDGNTCFMNSVIQSL 110
           G +  GL+N GN+C++NS++Q+L
Sbjct: 315 GNFGCGLINLGNSCYLNSILQAL 337

>CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {ON}
           similar to uniprot|P38237 Saccharomyces cerevisiae
           YBR058c UBP14 ubiquitin specific protease
          Length = 778

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 324 LQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLLNQWIKPEIIEGVSCNRC 376
           LQC E  G++YS  +S  + LP ++      L + +N +   E+IE   C  C
Sbjct: 458 LQCQECHGVKYSTETSNVIQLPLQESNDAQDLEERINAYFSGEVIE-FKCPNC 509

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
           YIL156W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 656

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 85/192 (44%), Gaps = 21/192 (10%)

Query: 311 TPLDGITAERI-GCLQCGENGGI--RYSVTSSMSLNLPS---EDIGSTLKLSDLLNQWIK 364
           +P+D I   +I  CLQC   G     YS+   +SL +P    E+  + +KL D +N +  
Sbjct: 379 SPIDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTS 438

Query: 365 PEIIEG---VSCNRCALEAVRDH-LLEQLKQYENKGDSIPEKLLQAFKARVEELNVSLSK 420
            EI+ G    +C +C    +  +   +     EN+  +     L  FK   + L+ S   
Sbjct: 439 DEILTGENAWNCPKCCPTTIETYDEADSPATVENRVKNKSINPLNFFKLH-KVLSPSSGN 497

Query: 421 PMVSDEDYKRLHTENMTRKCSKS------KQILFLRPPPLLSIHINRSVFDPRTYMIRKN 474
                  +    ++   +   K+      KQ+ F++ PP+L IH++R  ++      +KN
Sbjct: 498 HHRHHHHHHHHKSDGKNKNKYKNEKLITLKQLNFIKLPPILVIHLSRFYYNS----TKKN 553

Query: 475 NSRVLFKSRLNL 486
           N+ + +   LN+
Sbjct: 554 NAVITYPLILNI 565

>TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {ON}
           Anc_8.742 YMR223W
          Length = 463

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 1/57 (1%)

Query: 656 LTYVLRSVIVHYGTHNYGHYIAFRKYRGCWW-RISDETVYVVEEAEVLSTSGVFMLF 711
           + Y L  VI H GT N GHYI   K     W + +D  + +V+   VL      +++
Sbjct: 401 IIYELIGVICHTGTVNEGHYICSCKLANNQWVKFNDSMITIVDNETVLKEQAYLLIY 457

>KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.540
           YPL072W
          Length = 471

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 35/96 (36%), Gaps = 38/96 (39%)

Query: 656 LTYVLRSVIVHYGTHNYGHYIAFRK----------------------------------- 680
           +TY LRS+I H GTH  GHY  ++                                    
Sbjct: 373 ITYRLRSMIKHTGTHYSGHYQCYKHKPDLVKLMGTGVTVNRSPTVLARPPMIQERVKTPK 432

Query: 681 --YRGCWWRISDETVYVVEEAEVLSTSG-VFMLFYE 713
              R  +W ISD  V      ++L  S  V+MLFYE
Sbjct: 433 SVRRWPYWFISDAVVRESNAGKMLRESKYVYMLFYE 468

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 2/40 (5%)

Query: 81  DQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           D   +DK  Y  GL N  N CF+NS +Q+L+S   L  +L
Sbjct: 56  DNKRMDK--YTPGLSNPANECFINSSLQALSSLDYLTAYL 93

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156w UBP7
          Length = 1081

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 20/26 (76%)

Query: 91  VAGLVNDGNTCFMNSVIQSLASSAEL 116
           V GL N GNTC++N ++QSL ++ EL
Sbjct: 647 VTGLRNLGNTCYINCMLQSLFATNEL 672

>KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1252

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 91  VAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
           + GL N GNTC+MNS +Q L    EL ++ 
Sbjct: 338 IMGLSNLGNTCYMNSALQCLLHIPELNEYF 367

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1201

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 16/21 (76%)

Query: 91  VAGLVNDGNTCFMNSVIQSLA 111
           + GLVN GNTC+MNS +Q + 
Sbjct: 320 ITGLVNLGNTCYMNSALQCIT 340

>Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}
           YFR010W (REAL)
          Length = 499

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 4/54 (7%)

Query: 657 TYVLRSVIVHYGTHN-YGHYIAFRKYR---GCWWRISDETVYVVEEAEVLSTSG 706
            Y L  VI H G ++  GHY AF +       W++ +D+ V VVE+ ++ S +G
Sbjct: 429 VYNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKIESLAG 482

>KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {ON}
           Anc_3.270 YBR058C
          Length = 765

 Score = 33.5 bits (75), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 3/62 (4%)

Query: 652 PAGPLTYVLRSVIVHYG-THNYGHYIAFRKYR-GCWWRISDETVYVVEEAEVLSTSGVFM 709
           P G + Y L  ++ H G +   GHY+A+ + R G W   +DE +  VE  +    +G   
Sbjct: 702 PGGSI-YKLYGIVCHKGNSTQSGHYVAYIRQRDGQWTLYNDEKIVCVESLDEALRNGYIF 760

Query: 710 LF 711
           L+
Sbjct: 761 LY 762

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 974

 Score = 33.5 bits (75), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 60/268 (22%), Positives = 112/268 (41%), Gaps = 43/268 (16%)

Query: 228 YDQEDAQEFFQTILSELEKNVKSLEGKPSEATPIPNAELPKNAVIGQAHLDKVGDVYLPS 287
           +DQ+D QEF   +LS+L   +       SE+  + N + P   +    H DK  DV    
Sbjct: 642 HDQQDTQEFLLFLLSQLHDEL-------SESNRVAN-DYPGLLL----HDDKKLDV---- 685

Query: 288 DQIDPNLVLTNEGKQLYTPFRLVTPLDGITAER----IGCLQCGENGGIRYSVTSSMSLN 343
           DQ + +        +       ++P+D I   +    + C +CG +    YSV   +SL 
Sbjct: 686 DQKEYDTWFEKHISE-----NGISPIDNIFQGQMENGLFCQRCG-HSSFNYSVFYVLSLA 739

Query: 344 LPSEDIGST----LKLSDLLNQWIKPEII---EGVSCNRCALEAVRDHLLEQLKQYENKG 396
           +PS     +    ++L D +N +   E +       C +C   A      E+ K+   + 
Sbjct: 740 IPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKCGTSASGTGPEEEKKK--KRF 797

Query: 397 DSIPEKLLQAFKARVEELNVSLSKPMVSDEDYKRLHTENM----TRKCSKSKQILFLRPP 452
              P+      ++R  +L        VS    +    +N+    ++K +  K + F+  P
Sbjct: 798 LLNPDTRASGNRSRFFKLRSKSRSRSVSPFRKQSSQQQNLEKLKSKKLTTIKTLNFISLP 857

Query: 453 PLLSIHINRSVFDPRTYMIRKNNSRVLF 480
            +L+IH++R  +D    + +KNN  + +
Sbjct: 858 TVLTIHLSRFFYD----LTKKNNKVITY 881

>TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1186

 Score = 33.5 bits (75), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 654 GPLTYVLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDETVYVVEEAEVL 702
           GP  Y L  V+VH G  + GHY    K   +  W+R  D+ V+   + ++ 
Sbjct: 436 GPKIYKLHGVLVHTGDISTGHYYTLIKPSTKDEWYRFDDDRVWRATKKQIF 486

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 12/18 (66%), Positives = 16/18 (88%)

Query: 93  GLVNDGNTCFMNSVIQSL 110
           GL+N GNTC+MNS +Q+L
Sbjct: 110 GLLNMGNTCYMNSTLQAL 127

>TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {ON}
           Anc_8.202 YER151C
          Length = 854

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 93  GLVNDGNTCFMNSVIQSLASSAELMKFL 120
           G++N  N CFM+SV+Q L S A  +  L
Sbjct: 420 GIINSANICFMSSVLQVLLSCAPFINIL 447

>SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 767

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 49/88 (55%), Gaps = 19/88 (21%)

Query: 368 IEGVSCNRCALEAV-----------RDH-LLEQLKQYENKGDSIPEKLLQAFKARVEELN 415
           ++ +S  RCA + V           RDH +L+++  + + G+SIPE+LL ++++ V+ L 
Sbjct: 568 LQNISGTRCATDFVELPSILMEHFARDHRVLQRMASHYSTGESIPEQLLFSYQSEVKFLQ 627

Query: 416 ----VSLSKPMVSDEDYKRLHTENMTRK 439
                S +K  + D++   LH E++ ++
Sbjct: 628 HAEAFSQAKMAILDQE---LHGESIMKE 652

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
           similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 33.1 bits (74), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 37/84 (44%), Gaps = 6/84 (7%)

Query: 638 MPPPVNTAPI--PSTVPAGP--LTYVLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDE 691
            P  ++ +P   P      P  + Y L  V+VH G  + GHY A  K      W+R  D+
Sbjct: 412 FPESIDLSPYLDPEVRKIRPESMMYNLHGVLVHTGDISTGHYYAMIKPGLDDKWYRFDDD 471

Query: 692 TVYVVEEAEVLSTSGVFMLFYEYD 715
            V+ V + +V   +  F    EY+
Sbjct: 472 KVWQVTKKQVFEQNFGFDRLPEYE 495

>TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.270
           YBR058C
          Length = 780

 Score = 33.1 bits (74), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 78  GQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSL 110
           G+  +H      Y  GL+N GN+C++NSV+Q L
Sbjct: 308 GKELKHLSANKEYGCGLINLGNSCYINSVLQCL 340

>Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON}
           (248094..250361) [2268 nt, 756 aa]
          Length = 755

 Score = 33.1 bits (74), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 20/32 (62%)

Query: 85  LDKGGYVAGLVNDGNTCFMNSVIQSLASSAEL 116
           +D    V G  N GNTC+ NSV+Q L + +EL
Sbjct: 120 IDSSTKVFGFENFGNTCYCNSVLQCLYNFSEL 151

>TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa]
           {ON} Anc_5.443 YOR124C
          Length = 1225

 Score = 33.1 bits (74), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 27/54 (50%)

Query: 67  TNGFRRWMPRGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120
            +   R     G+V+   +D   +  G+ N GNTC++NS++Q   S     +F+
Sbjct: 733 ASALLRHFYEFGKVNPKMIDSELWPTGINNIGNTCYLNSLLQYYFSITLFREFI 786

>AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR058C
           (UBP14)
          Length = 780

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 17/21 (80%)

Query: 90  YVAGLVNDGNTCFMNSVIQSL 110
           Y  GL+N GN+C++NSV+Q L
Sbjct: 316 YGCGLINLGNSCYLNSVVQVL 336

>Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {ON}
           YKR098C (REAL)
          Length = 724

 Score = 32.7 bits (73), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 82/193 (42%), Gaps = 21/193 (10%)

Query: 310 VTPLDGITAER----IGCLQCGENGGIRYSVTSSMSLNLPSEDIGS------TLKLSDLL 359
           ++P+D I   +    + C +CG N    YS    +SL +P   + S       +KL D +
Sbjct: 443 LSPIDHIFQGQMENILKCQRCG-NSSYSYSTFYVLSLAIPKASLYSFTSKSKKIKLEDCI 501

Query: 360 NQWIKPEIIEGVSCNRCALEAVRDHLLEQLKQYENKGDSIPEKLLQAFKARVEELNVSLS 419
           N +   E +   +   C      ++ L++ +    K  SI   L    +++         
Sbjct: 502 NFFTSDEELSDDNAWDCPKCRTAEYKLKKDENLSQKKRSILFNLHSRPRSKSPRHRHHHH 561

Query: 420 KPMVSDEDYKR------LHTENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTYMIRK 473
                ++D K+         +  ++K +  K + F+  PP+L IH++R  +D    + +K
Sbjct: 562 HHRHKNDDAKKNDDATKNSKKWKSKKLTTIKSLDFIVLPPILVIHLSRFYYD----LTKK 617

Query: 474 NNSRVLFKSRLNL 486
           NN+ + +   LN+
Sbjct: 618 NNTVITYPLILNI 630

>TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1462

 Score = 32.7 bits (73), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 15/18 (83%)

Query: 93  GLVNDGNTCFMNSVIQSL 110
           GLVN GNTC+MNS +Q L
Sbjct: 415 GLVNLGNTCYMNSALQCL 432

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
           similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 32.7 bits (73), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%)

Query: 86  DKGGYVAGLVNDGNTCFMNSVIQSLASSAEL 116
           D    V GL N GNTC+ NSV+Q L + +EL
Sbjct: 127 DGSTKVFGLENFGNTCYCNSVLQCLFNLSEL 157

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
           YMR304W
          Length = 1193

 Score = 32.3 bits (72), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 658 YVLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDETVYVVEEAEVL 702
           Y L  V+VH G  + GHY    K      W+R  DE V+ V+  +V 
Sbjct: 448 YKLHGVLVHTGDISTGHYYTMIKPDLGDQWYRFDDERVWKVDRKQVF 494

>Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa]
           {ON} YDR135C (YCF1) - metal resistance protein, similar
           to multidrug resistance proteins and cystic fibrosis
           protein CFTR [contig 171] FULL
          Length = 1494

 Score = 32.3 bits (72), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 4/56 (7%)

Query: 1   MSFILETLQRKIISFIIEPLNRNTNSEVPITTAIILVSTAFFFIKYKSFIMNNLSH 56
           ++F    L R +I F+ E  ++N N EVPI     L S A FF+   S I  ++ H
Sbjct: 297 LAFTQPQLLRVLIKFVTEYTDKNANPEVPIVKGFTL-SIAMFFV---SVIQTSVLH 348

>NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON}
           Anc_7.390
          Length = 729

 Score = 32.3 bits (72), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 31/79 (39%), Gaps = 11/79 (13%)

Query: 64  FNPTNGFRRWMPRGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFLXXX 123
           F P N   + +P G        D    V G  N GNTC+ NSV+Q L +  EL   L   
Sbjct: 120 FTPMN---QLLPYG--------DGSNKVFGYENFGNTCYCNSVLQCLYNLTELRLNLLEY 168

Query: 124 XXXXXXXXXXXLLQDEEKP 142
                      L  D EKP
Sbjct: 169 PARDPKTRIRKLDMDGEKP 187

>TPHA0H02600 Chr8 (607962..609338) [1377 bp, 458 aa] {ON} Anc_7.93
           YOL041C
          Length = 458

 Score = 32.0 bits (71), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 20/26 (76%)

Query: 503 PMSKKQEQVQESSEDENLGGEYYAKL 528
           P+ KKQ++V  S +D++L  +YYAKL
Sbjct: 77  PLKKKQKKVANSEDDDDLESKYYAKL 102

>KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.712
           YIL156W
          Length = 846

 Score = 32.3 bits (72), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 33/72 (45%), Gaps = 16/72 (22%)

Query: 658 YVLRSVIVHYGTHNYGHYIA---------FRKYRGCWWRISDETV-----YVVEEAEV-- 701
           + L  V+ H+G  N GHY +             R  W+   DETV     Y   +  V  
Sbjct: 771 FKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNR 830

Query: 702 LSTSGVFMLFYE 713
           +S+S V++LFYE
Sbjct: 831 ISSSDVYVLFYE 842

>TPHA0L01670 Chr12 complement(351116..352690) [1575 bp, 524 aa] {ON}
           Anc_8.540 YPL072W
          Length = 524

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 20/34 (58%)

Query: 658 YVLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDE 691
           Y L++++ H GTH  GHY  +RK      RIS E
Sbjct: 407 YSLQAMVKHTGTHMEGHYQCYRKKPNLVKRISYE 440

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 78,695,427
Number of extensions: 3520115
Number of successful extensions: 16314
Number of sequences better than 10.0: 239
Number of HSP's gapped: 16519
Number of HSP's successfully gapped: 339
Length of query: 747
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 630
Effective length of database: 40,065,477
Effective search space: 25241250510
Effective search space used: 25241250510
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 70 (31.6 bits)