Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G023602.306ON40240216720.0
Suva_14.3302.306ON4572058491e-110
Smik_14.3132.306ON4511858451e-109
YNL016W (PUB1)2.306ON4531858441e-109
ZYRO0A02398g2.306ON4102058401e-109
Skud_14.3122.306ON4591858421e-109
SAKL0E07128g2.306ON4012107761e-99
TBLA0B071702.306ON4702047761e-98
KLTH0G10912g2.306ON4361957686e-98
AGR390C2.306ON3781817611e-97
CAGL0H10604g2.306ON4161987598e-97
NDAI0B034402.306ON4991867651e-96
NCAS0B061402.306ON4431997592e-96
KNAG0A054402.306ON4421917583e-96
TPHA0C035202.306ON4422087549e-96
Kpol_1043.342.306ON4421837503e-95
Kwal_27.114472.306ON4392147495e-95
Ecym_33442.306ON4211867284e-92
KAFR0J012602.306ON3651967131e-90
KLLA0E08779g2.306ON4751907022e-87
ADR307W5.382ON5661802371e-20
TPHA0B034208.229ON5792032291e-19
ZYRO0B11660g8.229ON5871862291e-19
Ecym_80105.382ON6021812291e-19
Kpol_1032.498.229ON5801912235e-19
KNAG0G018108.229ON5962052211e-18
TBLA0F037808.229ON5771862201e-18
TDEL0E024505.382ON4721812182e-18
CAGL0L11792g8.229ON5791682183e-18
NDAI0C061008.229ON5851812183e-18
TDEL0A013508.229ON5881672174e-18
Ecym_55628.229ON5802042156e-18
Kwal_55.201545.382ON5221792131e-17
SAKL0G08118g5.382ON5451732102e-17
KLLA0C17600g8.229ON5921622103e-17
NCAS0A036808.229ON5751612085e-17
CAGL0H02123g5.382ON5551912075e-17
KAFR0B025008.229ON5821862076e-17
SAKL0H17952g8.229ON5891682077e-17
KNAG0D032204.61ON3991782057e-17
Ecym_62014.61ON4481782058e-17
TBLA0C043604.61ON4031772049e-17
TPHA0H015205.382ON4941882051e-16
CAGL0E03245g4.61ON4251782022e-16
KAFR0D048305.382ON4061662012e-16
KLTH0E03520g5.382ON5161722014e-16
YER165W (PAB1)8.229ON5771671989e-16
Skud_5.3048.229ON5771671989e-16
KLLA0F14861g5.382ON5891761989e-16
AGR122C8.229ON5851971981e-15
Smik_5.3378.229ON5771671971e-15
KLTH0D03916g4.61ON5051781961e-15
AFR107W4.61ON3961781942e-15
NCAS0H018105.382ON4431711952e-15
Suva_5.2998.229ON5771671942e-15
KLLA0C11495g4.61ON4451771924e-15
TPHA0K019104.61ON4161791914e-15
Kwal_56.234868.229ON5871751934e-15
TDEL0F029104.61ON4361781915e-15
YGR159C (NSR1)4.61ON4141761906e-15
Smik_6.2644.61ON3951781896e-15
NCAS0A058904.61ON4151771897e-15
SAKL0H23562g4.61ON4211771897e-15
KAFR0F031204.61ON4121771881e-14
KNAG0B044405.382ON3971811881e-14
Smik_8.1645.382ON5241951872e-14
Suva_7.4504.61ON3911791852e-14
Skud_7.4834.61ON3931781852e-14
NDAI0C018205.382ON4981751836e-14
KLTH0G14344g8.229ON5871561836e-14
NDAI0D028404.61ON4261761818e-14
ZYRO0A07018g5.382ON5581931792e-13
TBLA0H017905.382ON6742141792e-13
Skud_8.1475.382ON5131891774e-13
Kpol_224.18.797ON2171841704e-13
TDEL0G036706.104ON6171451757e-13
Skud_2.3456.104ON6641441749e-13
Kpol_1026.214.61ON4371781739e-13
SAKL0A07370g6.104ON4902271731e-12
YBR212W (NGR1)6.104ON6721441731e-12
Kpol_530.466.104ON5871441731e-12
Smik_2.3556.104ON7361441731e-12
Suva_4.4706.104ON6631441722e-12
ZYRO0C05060g6.104ON7161451712e-12
ZYRO0G07326g4.61ON4681781702e-12
Ecym_30826.104ON5862281702e-12
NCAS0B072401.357ON610721703e-12
TBLA0A099206.104ON5941551694e-12
Kwal_14.18516.104ON5351651685e-12
Skud_6.1071.357ON611871685e-12
YHR086W (NAM8)5.382ON5231901641e-11
Kwal_26.7493singletonOFF2221361572e-11
AAR151W6.104ON4812201632e-11
Suva_6.951.357ON613871632e-11
CAGL0K06655g6.104ON8021431632e-11
KAFR0G023206.104ON6202421632e-11
Suva_15.2805.382ON5411931596e-11
KLLA0C05522g6.104ON5402191589e-11
KLTH0H06842g6.104ON5471171571e-10
CAGL0M03795g3.49ON5132091561e-10
ABL059W8.797ON2041741492e-10
ZYRO0C02574g3.49ON5431641552e-10
SAKL0D08558g1.408ON4641781533e-10
TBLA0A078103.49ON4721471524e-10
KLTH0E14036g8.797ON2091891447e-10
Kpol_1076.113.49ON5261411507e-10
NDAI0A061703.49ON5521421481e-09
KNAG0A013703.49ON5451431481e-09
NCAS0C048301.408ON3771691461e-09
TBLA0D049401.357ON665751482e-09
KAFR0C016803.49ON4791411472e-09
Kpol_1008.231.357ON660721463e-09
NDAI0B045701.357ON464751453e-09
TDEL0E006003.49ON5471411444e-09
TPHA0P013103.49ON5181411444e-09
NCAS0A100103.49ON5061431435e-09
Kwal_27.123378.797ON2091741368e-09
SAKL0C12672g3.49ON5511391411e-08
Ecym_74208.797ON2041681351e-08
KLLA0C14388g8.797ON2031711341e-08
Kwal_0.3701.357ON560891401e-08
Kwal_55.219603.49ON5971391392e-08
Ecym_20503.49ON5411411392e-08
KAFR0C044101.357ON589721392e-08
KLTH0F18766g3.49ON5881391382e-08
Kpol_487.61.408ON3761861373e-08
TBLA0B085903.49ON6231701383e-08
KAFR0B044205.76ON6251951373e-08
ZYRO0G00814g1.357ON654871373e-08
SAKL0B06270g8.797ON2091711314e-08
TDEL0B060601.408ON3451801344e-08
TDEL0B010108.797ON2101721315e-08
NCAS0C046003.49ON5811471365e-08
Kpol_1018.1221.357ON6341541355e-08
AEL016C1.357ON678721356e-08
KLLA0C12925g3.49ON5701511347e-08
Ecym_27461.357ON681721348e-08
CAGL0I09900g8.797ON2111791271e-07
ABL134C2.80ON3752281301e-07
YFR023W (PES4)1.357ON611871312e-07
Smik_7.3341.357ON611871312e-07
Smik_15.303.49ON5361431302e-07
TDEL0D022501.357ON6221561312e-07
TPHA0F028206.104ON6081441312e-07
Suva_15.373.49ON5511431302e-07
YOL123W (HRP1)3.49ON5341431302e-07
Skud_15.303.49ON5391431302e-07
TPHA0F023102.80ON4001371293e-07
NDAI0G039703.49ON6071471293e-07
TDEL0H032407.159ON1671091223e-07
Kpol_1041.42.80ON384751273e-07
SAKL0D09680g1.357ON672721284e-07
Kpol_1075.1a8.229ON264781254e-07
TBLA0B008102.80ON389751265e-07
AAL018W1.408ON3371731256e-07
CAGL0E01947g3.49ON4521391258e-07
KNAG0G032608.797ON2011401209e-07
NDAI0G001801.408ON4641921241e-06
ZYRO0E04928g1.408ON4091951241e-06
ADL160W3.49ON5261411241e-06
KLTH0H12958g1.357ON639731241e-06
CAGL0J11154g2.80ON3801681231e-06
CAGL0H03861g1.408ON4431831231e-06
TPHA0A022201.357ON713841241e-06
Suva_14.1662.80ON4032351212e-06
SAKL0F03982g7.165ON110961123e-06
NDAI0G041901.408ON3591741193e-06
NCAS0E038805.76ON7172021213e-06
Suva_8.3708.797ON2131821163e-06
KLLA0A08338g1.357ON766721213e-06
TBLA0B080105.76ON939751214e-06
KNAG0I015901.357ON590721204e-06
CAGL0I08943g1.357ON602721195e-06
NDAI0F033202.80ON399751185e-06
KLTH0B06886g2.80ON3961911186e-06
TPHA0D039603.432ON8722211196e-06
Skud_8.671.357ON652731186e-06
CAGL0B04807g1.408ON4191791168e-06
KLTH0C04268g8.822ON4501941161e-05
ZYRO0G07216g4.66ON271881141e-05
KAFR0H014508.491ON690771171e-05
TBLA0A033005.382ON362751151e-05
ADR017W7.159ON1731111111e-05
KAFR0B036808.822ON4411761161e-05
Skud_15.4878.797ON2131831121e-05
Skud_14.1592.80ON400751151e-05
NDAI0G059701.357ON611721161e-05
KLLA0D05016g1.408ON4431761142e-05
AGL250W8.491ON729771152e-05
YNL175C (NOP13)2.80ON403751142e-05
Kwal_27.118328.491ON686771152e-05
KAFR0A074902.80ON381751132e-05
KAFR0H031101.408ON441741132e-05
Smik_14.1552.80ON403751132e-05
Suva_3.81.408ON4331751132e-05
Kwal_33.144632.80ON393751122e-05
KLTH0H00792g5.76ON835751143e-05
YOR319W (HSH49)8.797ON2131851093e-05
YHR015W (MIP6)1.357ON659811133e-05
NDAI0F01720singletonON4741161123e-05
SAKL0H23298g4.66ON2571541103e-05
TDEL0F006802.80ON3882241114e-05
Kpol_150.17.159ON1381091054e-05
SAKL0E12738g2.80ON3961371114e-05
KAFR0C054305.536ON274911094e-05
KNAG0A022108.491ON682771115e-05
NCAS0C023808.491ON702941115e-05
NCAS0G019502.80ON404751105e-05
AEL217W5.76ON834751115e-05
Ecym_11211.102ON324751095e-05
Smik_15.5008.797ON2131861075e-05
NDAI0E030708.491ON701771116e-05
NCAS0G042801.408ON4351891106e-05
Suva_16.2718.491ON686771106e-05
KLLA0D13420g7.159ON1661091057e-05
YCL011C (GBP2)1.408ON4271751097e-05
Skud_9.1787.145ON250921068e-05
Smik_3.711.408ON4281751089e-05
KNAG0I020302.167ON229701069e-05
TDEL0F028504.66ON279801079e-05
Smik_16.1928.491ON690771099e-05
Kwal_55.209727.159ON1351091011e-04
Ecym_44463.432ON8551761081e-04
Smik_9.2047.159ON1491041021e-04
Skud_3.481.408ON4291751071e-04
KLLA0E11045g8.822ON4321771071e-04
Suva_9.2107.145ON250721051e-04
Skud_16.3993.432ON8792171081e-04
TDEL0A039905.536ON278941051e-04
NDAI0A047503.432ON8431771071e-04
Skud_16.2388.491ON680771071e-04
Skud_9.1827.159ON1491061012e-04
YIR001C (SGN1)7.145ON250721042e-04
CAGL0H04675g5.536ON274911052e-04
YPL043W (NOP4)8.491ON685771072e-04
NDAI0D048104.33ON6261081072e-04
Kpol_1023.955.536ON274941052e-04
KLTH0E11418g8.491ON693771072e-04
KLTH0F11968g3.432ON8791771072e-04
TPHA0B043001.102ON3341211052e-04
KLTH0F13442g7.159ON134109992e-04
KAFR0I022401.408ON4221781052e-04
Ecym_55745.76ON871751062e-04
KLLA0E19031g6.183ON6521701062e-04
TPHA0G010808.797ON2201841022e-04
Kpol_1002.696.183ON590791052e-04
ZYRO0G04862g2.80ON376751043e-04
KLLA0D11792g8.491ON685771053e-04
KAFR0A009801.357ON642871043e-04
SAKL0E10604g2.167ON221861013e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G02360
         (402 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G02360 Chr7 (454633..455841) [1209 bp, 402 aa] {ON} Anc_2.3...   648   0.0  
Suva_14.330 Chr14 (582310..583040,583082..583721) [1371 bp, 457 ...   331   e-110
Smik_14.313 Chr14 (561320..562675) [1356 bp, 451 aa] {ON} YNL016...   330   e-109
YNL016W Chr14 (602907..604268) [1362 bp, 453 aa] {ON}  PUB1Poly ...   329   e-109
ZYRO0A02398g Chr1 (188639..189871) [1233 bp, 410 aa] {ON} simila...   328   e-109
Skud_14.312 Chr14 (569627..571006) [1380 bp, 459 aa] {ON} YNL016...   328   e-109
SAKL0E07128g Chr5 complement(587416..588621) [1206 bp, 401 aa] {...   303   1e-99
TBLA0B07170 Chr2 complement(1698573..1699985) [1413 bp, 470 aa] ...   303   1e-98
KLTH0G10912g Chr7 (917604..918914) [1311 bp, 436 aa] {ON} some s...   300   6e-98
AGR390C Chr7 complement(1447328..1448464) [1137 bp, 378 aa] {ON}...   297   1e-97
CAGL0H10604g Chr8 complement(1033488..1034738) [1251 bp, 416 aa]...   296   8e-97
NDAI0B03440 Chr2 complement(872200..873699) [1500 bp, 499 aa] {O...   299   1e-96
NCAS0B06140 Chr2 complement(1162144..1163475) [1332 bp, 443 aa] ...   296   2e-96
KNAG0A05440 Chr1 (805095..806423) [1329 bp, 442 aa] {ON} Anc_2.3...   296   3e-96
TPHA0C03520 Chr3 (764414..765742) [1329 bp, 442 aa] {ON} Anc_2.3...   295   9e-96
Kpol_1043.34 s1043 complement(70168..71496) [1329 bp, 442 aa] {O...   293   3e-95
Kwal_27.11447 s27 complement(805408..806727) [1320 bp, 439 aa] {...   293   5e-95
Ecym_3344 Chr3 (653783..655048) [1266 bp, 421 aa] {ON} similar t...   285   4e-92
KAFR0J01260 Chr10 complement(234244..235341) [1098 bp, 365 aa] {...   279   1e-90
KLLA0E08779g Chr5 (782800..784227) [1428 bp, 475 aa] {ON} simila...   275   2e-87
ADR307W Chr4 (1238221..1239921) [1701 bp, 566 aa] {ON} Syntenic ...    96   1e-20
TPHA0B03420 Chr2 complement(794369..796108) [1740 bp, 579 aa] {O...    93   1e-19
ZYRO0B11660g Chr2 (918547..920310) [1764 bp, 587 aa] {ON} highly...    93   1e-19
Ecym_8010 Chr8 (22168..23976) [1809 bp, 602 aa] {ON} similar to ...    93   1e-19
Kpol_1032.49 s1032 (111076..112818) [1743 bp, 580 aa] {ON} (1110...    91   5e-19
KNAG0G01810 Chr7 (401679..403469) [1791 bp, 596 aa] {ON} Anc_8.2...    90   1e-18
TBLA0F03780 Chr6 (933778..935511) [1734 bp, 577 aa] {ON} Anc_8.2...    89   1e-18
TDEL0E02450 Chr5 complement(475232..476650) [1419 bp, 472 aa] {O...    89   2e-18
CAGL0L11792g Chr12 (1261571..1263310) [1740 bp, 579 aa] {ON} hig...    89   3e-18
NDAI0C06100 Chr3 (1406421..1408178) [1758 bp, 585 aa] {ON}             89   3e-18
TDEL0A01350 Chr1 complement(240288..242054) [1767 bp, 588 aa] {O...    88   4e-18
Ecym_5562 Chr5 (1143566..1145308) [1743 bp, 580 aa] {ON} similar...    87   6e-18
Kwal_55.20154 s55 complement(274557..276125) [1569 bp, 522 aa] {...    87   1e-17
SAKL0G08118g Chr7 complement(689908..691545) [1638 bp, 545 aa] {...    86   2e-17
KLLA0C17600g Chr3 (1553322..1555100) [1779 bp, 592 aa] {ON} simi...    86   3e-17
NCAS0A03680 Chr1 complement(738305..740032) [1728 bp, 575 aa] {O...    85   5e-17
CAGL0H02123g Chr8 complement(188454..190121) [1668 bp, 555 aa] {...    84   5e-17
KAFR0B02500 Chr2 (494025..495773) [1749 bp, 582 aa] {ON} Anc_8.2...    84   6e-17
SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]...    84   7e-17
KNAG0D03220 Chr4 (576080..577279) [1200 bp, 399 aa] {ON} Anc_4.6...    84   7e-17
Ecym_6201 Chr6 (375019..376365) [1347 bp, 448 aa] {ON} similar t...    84   8e-17
TBLA0C04360 Chr3 complement(1046454..1047665) [1212 bp, 403 aa] ...    83   9e-17
TPHA0H01520 Chr8 (343322..344806) [1485 bp, 494 aa] {ON} Anc_5.3...    84   1e-16
CAGL0E03245g Chr5 complement(299473..300750) [1278 bp, 425 aa] {...    82   2e-16
KAFR0D04830 Chr4 (947731..948951) [1221 bp, 406 aa] {ON} Anc_5.3...    82   2e-16
KLTH0E03520g Chr5 complement(317318..318868) [1551 bp, 516 aa] {...    82   4e-16
YER165W Chr5 (510373..512106) [1734 bp, 577 aa] {ON}  PAB1Poly(A...    81   9e-16
Skud_5.304 Chr5 (495460..497193) [1734 bp, 577 aa] {ON} YER165W ...    81   9e-16
KLLA0F14861g Chr6 (1375042..1376811) [1770 bp, 589 aa] {ON} some...    81   9e-16
AGR122C Chr7 complement(978628..980385) [1758 bp, 585 aa] {ON} S...    81   1e-15
Smik_5.337 Chr5 (509907..511640) [1734 bp, 577 aa] {ON} YER165W ...    80   1e-15
KLTH0D03916g Chr4 (378839..380356) [1518 bp, 505 aa] {ON} some s...    80   1e-15
AFR107W Chr6 (628898..630088) [1191 bp, 396 aa] {ON} Syntenic ho...    79   2e-15
NCAS0H01810 Chr8 (349311..350642) [1332 bp, 443 aa] {ON} Anc_5.382     80   2e-15
Suva_5.299 Chr5 (478113..479846) [1734 bp, 577 aa] {ON} YER165W ...    79   2e-15
KLLA0C11495g Chr3 complement(990832..992169) [1338 bp, 445 aa] {...    79   4e-15
TPHA0K01910 Chr11 complement(401616..402866) [1251 bp, 416 aa] {...    78   4e-15
Kwal_56.23486 s56 complement(561558..563321) [1764 bp, 587 aa] {...    79   4e-15
TDEL0F02910 Chr6 complement(525879..527189) [1311 bp, 436 aa] {O...    78   5e-15
YGR159C Chr7 complement(806412..807656) [1245 bp, 414 aa] {ON}  ...    78   6e-15
Smik_6.264 Chr6 complement(425625..426812) [1188 bp, 395 aa] {ON...    77   6e-15
NCAS0A05890 Chr1 (1156718..1157965) [1248 bp, 415 aa] {ON}             77   7e-15
SAKL0H23562g Chr8 complement(2037551..2038816) [1266 bp, 421 aa]...    77   7e-15
KAFR0F03120 Chr6 (620250..621488) [1239 bp, 412 aa] {ON} Anc_4.6...    77   1e-14
KNAG0B04440 Chr2 complement(849093..850286) [1194 bp, 397 aa] {O...    77   1e-14
Smik_8.164 Chr8 (254903..256477) [1575 bp, 524 aa] {ON} YHR086W ...    77   2e-14
Suva_7.450 Chr7 complement(775898..777073) [1176 bp, 391 aa] {ON...    76   2e-14
Skud_7.483 Chr7 complement(790010..791191) [1182 bp, 393 aa] {ON...    76   2e-14
NDAI0C01820 Chr3 complement(398027..399523) [1497 bp, 498 aa] {O...    75   6e-14
KLTH0G14344g Chr7 (1248269..1250032) [1764 bp, 587 aa] {ON} high...    75   6e-14
NDAI0D02840 Chr4 complement(656261..657541) [1281 bp, 426 aa] {O...    74   8e-14
ZYRO0A07018g Chr1 complement(573135..574811) [1677 bp, 558 aa] {...    74   2e-13
TBLA0H01790 Chr8 complement(415969..417993) [2025 bp, 674 aa] {O...    74   2e-13
Skud_8.147 Chr8 (252154..253695) [1542 bp, 513 aa] {ON} YHR086W ...    73   4e-13
Kpol_224.1 s224 complement(931..1584) [654 bp, 217 aa] {ON} comp...    70   4e-13
TDEL0G03670 Chr7 complement(675820..677673) [1854 bp, 617 aa] {O...    72   7e-13
Skud_2.345 Chr2 (616731..618725) [1995 bp, 664 aa] {ON} YBR212W ...    72   9e-13
Kpol_1026.21 s1026 complement(46606..47919) [1314 bp, 437 aa] {O...    71   9e-13
SAKL0A07370g Chr1 complement(652628..654100) [1473 bp, 490 aa] {...    71   1e-12
YBR212W Chr2 (647886..649904) [2019 bp, 672 aa] {ON}  NGR1RNA bi...    71   1e-12
Kpol_530.46 s530 complement(104488..106251) [1764 bp, 587 aa] {O...    71   1e-12
Smik_2.355 Chr2 (633903..636113) [2211 bp, 736 aa] {ON} YBR212W ...    71   1e-12
Suva_4.470 Chr4 (818188..820179) [1992 bp, 663 aa] {ON} YBR212W ...    71   2e-12
ZYRO0C05060g Chr3 complement(397083..399233) [2151 bp, 716 aa] {...    70   2e-12
ZYRO0G07326g Chr7 complement(577044..578450) [1407 bp, 468 aa] {...    70   2e-12
Ecym_3082 Chr3 complement(152514..154274) [1761 bp, 586 aa] {ON}...    70   2e-12
NCAS0B07240 Chr2 (1369481..1371313) [1833 bp, 610 aa] {ON} Anc_1...    70   3e-12
TBLA0A09920 Chr1 (2434186..2435970) [1785 bp, 594 aa] {ON} Anc_6...    70   4e-12
Kwal_14.1851 s14 complement(494548..496155) [1608 bp, 535 aa] {O...    69   5e-12
Skud_6.107 Chr6 (195514..197349) [1836 bp, 611 aa] {ON} YFR023W ...    69   5e-12
YHR086W Chr8 (278153..279724) [1572 bp, 523 aa] {ON}  NAM8RNA bi...    68   1e-11
Kwal_26.7493 s26 (387735..388400) [666 bp, 222 aa] {OFF} YGR159C...    65   2e-11
AAR151W Chr1 (617434..618879) [1446 bp, 481 aa] {ON} Syntenic ho...    67   2e-11
Suva_6.95 Chr6 (165163..167004) [1842 bp, 613 aa] {ON} YFR023W (...    67   2e-11
CAGL0K06655g Chr11 (648911..651319) [2409 bp, 802 aa] {ON} simil...    67   2e-11
KAFR0G02320 Chr7 complement(483040..484902) [1863 bp, 620 aa] {O...    67   2e-11
Suva_15.280 Chr15 (480600..482225) [1626 bp, 541 aa] {ON} YHR086...    66   6e-11
KLLA0C05522g Chr3 (494240..495862) [1623 bp, 540 aa] {ON} some s...    65   9e-11
KLTH0H06842g Chr8 complement(600623..602266) [1644 bp, 547 aa] {...    65   1e-10
CAGL0M03795g Chr13 complement(428607..430148) [1542 bp, 513 aa] ...    65   1e-10
ABL059W Chr2 (287618..288232) [615 bp, 204 aa] {ON} Syntenic hom...    62   2e-10
ZYRO0C02574g Chr3 complement(203808..205439) [1632 bp, 543 aa] {...    64   2e-10
SAKL0D08558g Chr4 (712000..713394) [1395 bp, 464 aa] {ON} simila...    64   3e-10
TBLA0A07810 Chr1 (1923979..1925397) [1419 bp, 472 aa] {ON} Anc_3...    63   4e-10
KLTH0E14036g Chr5 complement(1240971..1241600) [630 bp, 209 aa] ...    60   7e-10
Kpol_1076.11 s1076 complement(24646..26226) [1581 bp, 526 aa] {O...    62   7e-10
NDAI0A06170 Chr1 complement(1403026..1404684) [1659 bp, 552 aa] ...    62   1e-09
KNAG0A01370 Chr1 (41785..43422) [1638 bp, 545 aa] {ON} Anc_3.49 ...    62   1e-09
NCAS0C04830 Chr3 (984086..985219) [1134 bp, 377 aa] {ON} Anc_1.408     61   1e-09
TBLA0D04940 Chr4 (1214344..1216341) [1998 bp, 665 aa] {ON} Anc_1...    62   2e-09
KAFR0C01680 Chr3 complement(342688..344127) [1440 bp, 479 aa] {O...    61   2e-09
Kpol_1008.23 s1008 (47628..49610) [1983 bp, 660 aa] {ON} (47628....    61   3e-09
NDAI0B04570 Chr2 (1137147..1138541) [1395 bp, 464 aa] {ON} Anc_1...    60   3e-09
TDEL0E00600 Chr5 (129602..131245) [1644 bp, 547 aa] {ON} Anc_3.4...    60   4e-09
TPHA0P01310 Chr16 complement(265254..266810) [1557 bp, 518 aa] {...    60   4e-09
NCAS0A10010 Chr1 complement(2003039..2004559) [1521 bp, 506 aa] ...    60   5e-09
Kwal_27.12337 s27 complement(1185308..1185937) [630 bp, 209 aa] ...    57   8e-09
SAKL0C12672g Chr3 complement(1130702..1132357) [1656 bp, 551 aa]...    59   1e-08
Ecym_7420 Chr7 complement(859857..860471) [615 bp, 204 aa] {ON} ...    57   1e-08
KLLA0C14388g Chr3 complement(1251548..1252159) [612 bp, 203 aa] ...    56   1e-08
Kwal_0.370 s0 (177067..178749) [1683 bp, 560 aa] {ON} YFR023W (P...    59   1e-08
Kwal_55.21960 s55 complement(1055849..1057642) [1794 bp, 597 aa]...    58   2e-08
Ecym_2050 Chr2 (79607..81232) [1626 bp, 541 aa] {ON} similar to ...    58   2e-08
KAFR0C04410 Chr3 complement(870329..872098) [1770 bp, 589 aa] {O...    58   2e-08
KLTH0F18766g Chr6 complement(1521018..1522784) [1767 bp, 588 aa]...    58   2e-08
Kpol_487.6 s487 (35743..36873) [1131 bp, 376 aa] {ON} (35743..36...    57   3e-08
TBLA0B08590 Chr2 complement(2052809..2054680) [1872 bp, 623 aa] ...    58   3e-08
KAFR0B04420 Chr2 complement(918168..920045) [1878 bp, 625 aa] {O...    57   3e-08
ZYRO0G00814g Chr7 complement(63018..64982) [1965 bp, 654 aa] {ON...    57   3e-08
SAKL0B06270g Chr2 complement(532445..533074) [630 bp, 209 aa] {O...    55   4e-08
TDEL0B06060 Chr2 complement(1071469..1072506) [1038 bp, 345 aa] ...    56   4e-08
TDEL0B01010 Chr2 complement(189048..189680) [633 bp, 210 aa] {ON...    55   5e-08
NCAS0C04600 Chr3 (940040..941785) [1746 bp, 581 aa] {ON} Anc_3.49      57   5e-08
Kpol_1018.122 s1018 (325215..327119) [1905 bp, 634 aa] {ON} (325...    57   5e-08
AEL016C Chr5 complement(605004..607040) [2037 bp, 678 aa] {ON} S...    57   6e-08
KLLA0C12925g Chr3 (1094574..1096286) [1713 bp, 570 aa] {ON} weak...    56   7e-08
Ecym_2746 Chr2 (1447502..1449547) [2046 bp, 681 aa] {ON} similar...    56   8e-08
CAGL0I09900g Chr9 (946987..947622) [636 bp, 211 aa] {ON} similar...    54   1e-07
ABL134C Chr2 complement(140623..141750) [1128 bp, 375 aa] {ON} S...    55   1e-07
YFR023W Chr6 (199874..201709) [1836 bp, 611 aa] {ON}  PES4Poly(A...    55   2e-07
Smik_7.334 Chr7 (561338..563173) [1836 bp, 611 aa] {ON} YFR023W ...    55   2e-07
Smik_15.30 Chr15 (55895..57505) [1611 bp, 536 aa] {ON} YOL123W (...    55   2e-07
TDEL0D02250 Chr4 complement(432801..434669) [1869 bp, 622 aa] {O...    55   2e-07
TPHA0F02820 Chr6 (627799..629625) [1827 bp, 608 aa] {ON} Anc_6.1...    55   2e-07
Suva_15.37 Chr15 (65421..67076) [1656 bp, 551 aa] {ON} YOL123W (...    55   2e-07
YOL123W Chr15 (87844..89448) [1605 bp, 534 aa] {ON}  HRP1Subunit...    55   2e-07
Skud_15.30 Chr15 (52950..54569) [1620 bp, 539 aa] {ON} YOL123W (...    55   2e-07
TPHA0F02310 Chr6 (507306..508508) [1203 bp, 400 aa] {ON} Anc_2.8...    54   3e-07
NDAI0G03970 Chr7 (945738..947561) [1824 bp, 607 aa] {ON} Anc_3.4...    54   3e-07
TDEL0H03240 Chr8 complement(540934..541437) [504 bp, 167 aa] {ON...    52   3e-07
Kpol_1041.4 s1041 (12746..13900) [1155 bp, 384 aa] {ON} (12746.....    54   3e-07
SAKL0D09680g Chr4 (803363..805381) [2019 bp, 672 aa] {ON} simila...    54   4e-07
Kpol_1075.1a s1075 (1..795) [795 bp, 264 aa] {ON} (1..795) [795 ...    53   4e-07
TBLA0B00810 Chr2 complement(175882..177051) [1170 bp, 389 aa] {O...    53   5e-07
AAL018W Chr1 (309542..310555) [1014 bp, 337 aa] {ON} Syntenic ho...    53   6e-07
CAGL0E01947g Chr5 (193462..194820) [1359 bp, 452 aa] {ON} some s...    53   8e-07
KNAG0G03260 Chr7 (701431..702036) [606 bp, 201 aa] {ON} Anc_8.79...    51   9e-07
NDAI0G00180 Chr7 complement(23120..24514) [1395 bp, 464 aa] {ON}...    52   1e-06
ZYRO0E04928g Chr5 complement(374326..375537,375710..375727) [123...    52   1e-06
ADL160W Chr4 (408685..410265) [1581 bp, 526 aa] {ON} Syntenic ho...    52   1e-06
KLTH0H12958g Chr8 (1107939..1109858) [1920 bp, 639 aa] {ON} simi...    52   1e-06
CAGL0J11154g Chr10 (1085737..1086879) [1143 bp, 380 aa] {ON} sim...    52   1e-06
CAGL0H03861g Chr8 complement(361189..362520) [1332 bp, 443 aa] {...    52   1e-06
TPHA0A02220 Chr1 complement(457287..459428) [2142 bp, 713 aa] {O...    52   1e-06
Suva_14.166 Chr14 complement(303573..304784) [1212 bp, 403 aa] {...    51   2e-06
SAKL0F03982g Chr6 complement(319563..319895) [333 bp, 110 aa] {O...    48   3e-06
NDAI0G04190 Chr7 (1005539..1006618) [1080 bp, 359 aa] {ON} Anc_1...    50   3e-06
NCAS0E03880 Chr5 complement(761175..763328) [2154 bp, 717 aa] {O...    51   3e-06
Suva_8.370 Chr8 (653473..654114) [642 bp, 213 aa] {ON} YOR319W (...    49   3e-06
KLLA0A08338g Chr1 (736461..738761) [2301 bp, 766 aa] {ON} simila...    51   3e-06
TBLA0B08010 Chr2 (1910016..1912835) [2820 bp, 939 aa] {ON} Anc_5...    51   4e-06
KNAG0I01590 Chr9 complement(308547..310319) [1773 bp, 590 aa] {O...    51   4e-06
CAGL0I08943g Chr9 (867666..869474) [1809 bp, 602 aa] {ON} simila...    50   5e-06
NDAI0F03320 Chr6 (798225..799424) [1200 bp, 399 aa] {ON} Anc_2.80      50   5e-06
KLTH0B06886g Chr2 (557856..559046) [1191 bp, 396 aa] {ON} simila...    50   6e-06
TPHA0D03960 Chr4 complement(829035..831653) [2619 bp, 872 aa] {O...    50   6e-06
Skud_8.67 Chr8 (116061..118019) [1959 bp, 652 aa] {ON} YHR015W (...    50   6e-06
CAGL0B04807g Chr2 (460721..461980) [1260 bp, 419 aa] {ON} simila...    49   8e-06
KLTH0C04268g Chr3 (367879..369231) [1353 bp, 450 aa] {ON} simila...    49   1e-05
ZYRO0G07216g Chr7 (568877..569692) [816 bp, 271 aa] {ON} similar...    49   1e-05
KAFR0H01450 Chr8 (267293..269365) [2073 bp, 690 aa] {ON} Anc_8.4...    50   1e-05
TBLA0A03300 Chr1 (785613..786701) [1089 bp, 362 aa] {ON} Anc_5.3...    49   1e-05
ADR017W Chr4 (734484..735005) [522 bp, 173 aa] {ON} Syntenic hom...    47   1e-05
KAFR0B03680 Chr2 (767040..768365) [1326 bp, 441 aa] {ON} Anc_8.8...    49   1e-05
Skud_15.487 Chr15 (852519..853160) [642 bp, 213 aa] {ON} YOR319W...    48   1e-05
Skud_14.159 Chr14 complement(298222..299424) [1203 bp, 400 aa] {...    49   1e-05
NDAI0G05970 Chr7 complement(1475760..1477595) [1836 bp, 611 aa] ...    49   1e-05
KLLA0D05016g Chr4 complement(431592..432911,433342..433353) [133...    49   2e-05
AGL250W Chr7 (232080..234269) [2190 bp, 729 aa] {ON} Syntenic ho...    49   2e-05
YNL175C Chr14 complement(307401..308612) [1212 bp, 403 aa] {ON} ...    49   2e-05
Kwal_27.11832 s27 complement(966449..968509) [2061 bp, 686 aa] {...    49   2e-05
KAFR0A07490 Chr1 (1512089..1513234) [1146 bp, 381 aa] {ON} Anc_2...    48   2e-05
KAFR0H03110 Chr8 complement(593465..594760,595029..595058) [1326...    48   2e-05
Smik_14.155 Chr14 complement(286559..287770) [1212 bp, 403 aa] {...    48   2e-05
Suva_3.8 Chr3 complement(12157..13458) [1302 bp, 433 aa] {ON} YC...    48   2e-05
Kwal_33.14463 s33 complement(685488..686669) [1182 bp, 393 aa] {...    48   2e-05
KLTH0H00792g Chr8 (88079..90586) [2508 bp, 835 aa] {ON} some sim...    49   3e-05
YOR319W Chr15 (912822..913463) [642 bp, 213 aa] {ON}  HSH49U2-sn...    47   3e-05
YHR015W Chr8 (134554..136533) [1980 bp, 659 aa] {ON}  MIP6Putati...    48   3e-05
NDAI0F01720 Chr6 complement(418941..420365) [1425 bp, 474 aa] {O...    48   3e-05
SAKL0H23298g Chr8 complement(2021024..2021797) [774 bp, 257 aa] ...    47   3e-05
TDEL0F00680 Chr6 complement(114474..115640) [1167 bp, 388 aa] {O...    47   4e-05
Kpol_150.1 s150 (1938..2354) [417 bp, 138 aa] {ON} (1938..2354) ...    45   4e-05
SAKL0E12738g Chr5 (1052695..1053885) [1191 bp, 396 aa] {ON} simi...    47   4e-05
KAFR0C05430 Chr3 complement(1088709..1089533) [825 bp, 274 aa] {...    47   4e-05
KNAG0A02210 Chr1 (195984..198032) [2049 bp, 682 aa] {ON} Anc_8.4...    47   5e-05
NCAS0C02380 Chr3 (444347..446455) [2109 bp, 702 aa] {ON} Anc_8.4...    47   5e-05
NCAS0G01950 Chr7 complement(348633..349847) [1215 bp, 404 aa] {O...    47   5e-05
AEL217W Chr5 (225217..227721) [2505 bp, 834 aa] {ON} Syntenic ho...    47   5e-05
Ecym_1121 Chr1 (248858..249832) [975 bp, 324 aa] {ON} similar to...    47   5e-05
Smik_15.500 Chr15 (862344..862985) [642 bp, 213 aa] {ON} YOR319W...    46   5e-05
NDAI0E03070 Chr5 (651544..653649) [2106 bp, 701 aa] {ON} Anc_8.4...    47   6e-05
NCAS0G04280 Chr7 (796093..797400) [1308 bp, 435 aa] {ON} Anc_1.408     47   6e-05
Suva_16.271 Chr16 (472819..474879) [2061 bp, 686 aa] {ON} YPL043...    47   6e-05
KLLA0D13420g Chr4 complement(1157491..1157991) [501 bp, 166 aa] ...    45   7e-05
YCL011C Chr3 complement(102075..103358) [1284 bp, 427 aa] {ON}  ...    47   7e-05
Skud_9.178 Chr9 complement(326982..327734) [753 bp, 250 aa] {ON}...    45   8e-05
Smik_3.71 Chr3 complement(100547..101833) [1287 bp, 428 aa] {ON}...    46   9e-05
KNAG0I02030 Chr9 (396201..396890) [690 bp, 229 aa] {ON} Anc_2.16...    45   9e-05
TDEL0F02850 Chr6 (516483..517322) [840 bp, 279 aa] {ON} Anc_4.66...    46   9e-05
Smik_16.192 Chr16 (345251..347323) [2073 bp, 690 aa] {ON} YPL043...    47   9e-05
Kwal_55.20972 s55 (629521..629928) [408 bp, 135 aa] {ON} YIR005W...    44   1e-04
Ecym_4446 Chr4 (912645..915212) [2568 bp, 855 aa] {ON} similar t...    46   1e-04
Smik_9.204 Chr9 (340893..341342) [450 bp, 149 aa] {ON} YIR005W (...    44   1e-04
Skud_3.48 Chr3 complement(80985..82274) [1290 bp, 429 aa] {ON} Y...    46   1e-04
KLLA0E11045g Chr5 (968674..969972) [1299 bp, 432 aa] {ON} simila...    46   1e-04
Suva_9.210 Chr9 complement(343096..343848) [753 bp, 250 aa] {ON}...    45   1e-04
Skud_16.399 Chr16 complement(714087..716726) [2640 bp, 879 aa] {...    46   1e-04
TDEL0A03990 Chr1 complement(713693..714529) [837 bp, 278 aa] {ON...    45   1e-04
NDAI0A04750 Chr1 (1085815..1088346) [2532 bp, 843 aa] {ON} Anc_3...    46   1e-04
Skud_16.238 Chr16 (433890..435932) [2043 bp, 680 aa] {ON} YPL043...    46   1e-04
Skud_9.182 Chr9 (335662..336111) [450 bp, 149 aa] {ON} YIR005W (...    44   2e-04
YIR001C Chr9 complement(356143..356895) [753 bp, 250 aa] {ON}  S...    45   2e-04
CAGL0H04675g Chr8 complement(447256..448080) [825 bp, 274 aa] {O...    45   2e-04
YPL043W Chr16 (469939..471996) [2058 bp, 685 aa] {ON}  NOP4Nucle...    46   2e-04
NDAI0D04810 Chr4 complement(1135992..1137872) [1881 bp, 626 aa] ...    46   2e-04
Kpol_1023.95 s1023 (221318..222142) [825 bp, 274 aa] {ON} (22131...    45   2e-04
KLTH0E11418g Chr5 complement(1020231..1022312) [2082 bp, 693 aa]...    46   2e-04
KLTH0F11968g Chr6 (1008620..1011259) [2640 bp, 879 aa] {ON} simi...    46   2e-04
TPHA0B04300 Chr2 (1005558..1006562) [1005 bp, 334 aa] {ON} Anc_1...    45   2e-04
KLTH0F13442g Chr6 (1103806..1104210) [405 bp, 134 aa] {ON} simil...    43   2e-04
KAFR0I02240 Chr9 complement(459158..460426) [1269 bp, 422 aa] {O...    45   2e-04
Ecym_5574 Chr5 complement(1175694..1178309) [2616 bp, 871 aa] {O...    45   2e-04
KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} simi...    45   2e-04
TPHA0G01080 Chr7 complement(217639..218301) [663 bp, 220 aa] {ON...    44   2e-04
Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa] ...    45   2e-04
ZYRO0G04862g Chr7 complement(387238..388368) [1131 bp, 376 aa] {...    45   3e-04
KLLA0D11792g Chr4 (1005079..1007136) [2058 bp, 685 aa] {ON} simi...    45   3e-04
KAFR0A00980 Chr1 complement(182578..184506) [1929 bp, 642 aa] {O...    45   3e-04
SAKL0E10604g Chr5 (884025..884690) [666 bp, 221 aa] {ON} similar...    44   3e-04
Smik_8.80 Chr8 (114815..116827) [2013 bp, 670 aa] {ON} YHR015W (...    45   3e-04
KLLA0C08019g Chr3 complement(704199..705104) [906 bp, 301 aa] {O...    44   3e-04
Kwal_56.24709 s56 complement(1113983..1116469) [2487 bp, 828 aa]...    45   3e-04
TDEL0B01460 Chr2 (255177..257255) [2079 bp, 692 aa] {ON} Anc_8.4...    45   4e-04
KAFR0B04540 Chr2 (945164..945826) [663 bp, 220 aa] {ON} Anc_2.16...    44   4e-04
ADR035C Chr4 complement(768390..770906) [2517 bp, 838 aa] {ON} S...    45   4e-04
NDAI0D02800 Chr4 (649804..650751) [948 bp, 315 aa] {ON} Anc_4.66       44   4e-04
TDEL0F01220 Chr6 complement(216951..217589) [639 bp, 212 aa] {ON...    43   4e-04
Kwal_27.10364 s27 (303432..304763) [1332 bp, 443 aa] {ON} YMR268...    44   4e-04
Ecym_2541 Chr2 complement(1049892..1051919) [2028 bp, 675 aa] {O...    45   4e-04
SAKL0C03234g Chr3 complement(306710..307732) [1023 bp, 340 aa] {...    44   4e-04
KLTH0D04158g Chr4 (394755..395537) [783 bp, 260 aa] {ON} similar...    44   4e-04
SAKL0G12474g Chr7 complement(1060462..1061016) [555 bp, 184 aa] ...    43   4e-04
CAGL0D06182g Chr4 (581992..582834) [843 bp, 280 aa] {ON} similar...    44   4e-04
Kpol_1026.16 s1026 (34514..35347) [834 bp, 277 aa] {ON} (34514.....    44   5e-04
YGL044C Chr7 complement(416146..417036) [891 bp, 296 aa] {ON}  R...    44   5e-04
TPHA0D02400 Chr4 complement(496366..497247) [882 bp, 293 aa] {ON...    44   5e-04
SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {...    44   5e-04
KLLA0A05346g Chr1 (485886..488510) [2625 bp, 874 aa] {ON} some s...    44   5e-04
ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} simila...    44   5e-04
Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184...    44   5e-04
Suva_15.198 Chr15 (343049..345037) [1989 bp, 662 aa] {ON} YHR015...    44   6e-04
NCAS0I00520 Chr9 complement(83655..85001) [1347 bp, 448 aa] {ON}...    44   6e-04
KNAG0A07610 Chr1 complement(1194108..1196711) [2604 bp, 867 aa] ...    44   6e-04
Smik_7.239 Chr7 complement(407397..408296) [900 bp, 299 aa] {ON}...    43   6e-04
CAGL0J01914g Chr10 complement(191912..192421) [510 bp, 169 aa] {...    42   6e-04
ADR189W Chr4 (1034091..1034900) [810 bp, 269 aa] {ON} Syntenic h...    43   6e-04
YIR005W Chr9 (364889..365335) [447 bp, 148 aa] {ON}  IST3Compone...    42   6e-04
Skud_7.240 Chr7 complement(418142..419098) [957 bp, 318 aa] {ON}...    43   6e-04
KLLA0F23650g Chr6 (2210563..2211501) [939 bp, 312 aa] {ON} simil...    43   6e-04
NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183     44   7e-04
KNAG0J00360 Chr10 (56847..58169) [1323 bp, 440 aa] {ON} Anc_8.82...    44   7e-04
Suva_8.27 Chr8 (58726..60849) [2124 bp, 707 aa] {ON} YHL024W (REAL)    44   7e-04
KLTH0F02838g Chr6 complement(245748..246740) [993 bp, 330 aa] {O...    43   7e-04
Ecym_4467 Chr4 complement(951838..952359) [522 bp, 173 aa] {ON} ...    42   8e-04
NCAS0A02880 Chr1 complement(553819..555585) [1767 bp, 588 aa] {O...    44   8e-04
KNAG0C02030 Chr3 (396024..397121) [1098 bp, 365 aa] {ON} Anc_1.3...    43   8e-04
NCAS0B00950 Chr2 (150330..150989) [660 bp, 219 aa] {ON} Anc_8.797      42   8e-04
CAGL0L03806g Chr12 (440385..441152) [768 bp, 255 aa] {ON} simila...    43   8e-04
NCAS0C00510 Chr3 (83308..84645) [1338 bp, 445 aa] {ON} Anc_8.822...    43   8e-04
Smik_16.355 Chr16 complement(627408..630068) [2661 bp, 886 aa] {...    44   8e-04
CAGL0B04169g Chr2 complement(404713..407298) [2586 bp, 861 aa] {...    44   8e-04
TPHA0K01870 Chr11 (391768..392637) [870 bp, 289 aa] {ON} Anc_4.6...    43   9e-04
Suva_13.452 Chr13 complement(782217..783551) [1335 bp, 444 aa] {...    43   0.001
TDEL0F03140 Chr6 complement(574041..576608) [2568 bp, 855 aa] {O...    44   0.001
KLTH0D09262g Chr4 (769384..770055) [672 bp, 223 aa] {ON} similar...    42   0.001
KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON} Anc_6...    43   0.001
TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6....    43   0.001
TBLA0B03120 Chr2 complement(729579..730898) [1320 bp, 439 aa] {O...    43   0.001
TBLA0J01830 Chr10 complement(418200..418622) [423 bp, 140 aa] {O...    41   0.001
Kpol_365.5 s365 (9615..10148,10369..11028) [1194 bp, 397 aa] {ON...    43   0.001
TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa] ...    43   0.001
KNAG0F02200 Chr6 (422342..422980) [639 bp, 212 aa] {ON} Anc_6.17...    42   0.001
YPR112C Chr16 complement(749256..751919) [2664 bp, 887 aa] {ON} ...    43   0.001
KNAG0B03650 Chr2 (702368..703207) [840 bp, 279 aa] {ON} Anc_5.53...    42   0.001
TPHA0C01740 Chr3 (398136..400229) [2094 bp, 697 aa] {ON} Anc_8.4...    43   0.001
KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {...    43   0.001
Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {O...    43   0.001
ZYRO0D12782g Chr4 complement(1077736..1078557) [822 bp, 273 aa] ...    42   0.001
AFL224W Chr6 (18862..19482) [621 bp, 206 aa] {ON} Syntenic homol...    42   0.001
KLTH0B02992g Chr2 complement(234560..235174) [615 bp, 204 aa] {O...    42   0.001
Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}...    43   0.001
KLLA0D08206g Chr4 (700152..701327) [1176 bp, 391 aa] {ON} simila...    42   0.001
Kwal_26.7522 s26 (402305..403093) [789 bp, 262 aa] {ON} YGL044C ...    42   0.001
SAKL0H02332g Chr8 (233859..236312) [2454 bp, 817 aa] {ON} some s...    43   0.001
KAFR0K01050 Chr11 complement(216574..217038) [465 bp, 154 aa] {O...    41   0.001
YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON} ...    43   0.001
Smik_9.200 Chr9 complement(332149..332898) [750 bp, 249 aa] {ON}...    42   0.001
ZYRO0F16214g Chr6 (1331671..1332663) [993 bp, 330 aa] {ON} conse...    42   0.002
NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {O...    42   0.002
CAGL0L12672g Chr12 complement(1361933..1363981) [2049 bp, 682 aa...    42   0.002
NCAS0G02580 Chr7 complement(461003..461677) [675 bp, 224 aa] {ON...    42   0.002
TPHA0B02950 Chr2 complement(672465..673121) [657 bp, 218 aa] {ON...    41   0.002
Skud_13.439 Chr13 complement(776753..778090) [1338 bp, 445 aa] {...    42   0.002
Kpol_259.1 s259 (2949..3947) [999 bp, 332 aa] {ON} (2949..3947) ...    42   0.002
Kpol_1062.7 s1062 (14539..16821) [2283 bp, 760 aa] {ON} (14539.....    42   0.002
NCAS0A05830 Chr1 complement(1146244..1147188) [945 bp, 314 aa] {...    42   0.002
SAKL0H11330g Chr8 (972836..974929) [2094 bp, 697 aa] {ON} simila...    42   0.002
NDAI0E00470 Chr5 complement(91514..92290) [777 bp, 258 aa] {ON} ...    42   0.002
Kwal_26.7179 s26 complement(251330..252700) [1371 bp, 456 aa] {O...    42   0.002
CAGL0J02200g Chr10 complement(217645..218079) [435 bp, 144 aa] {...    40   0.002
ZYRO0B09790g Chr2 (765258..765854) [597 bp, 198 aa] {ON} similar...    41   0.002
TBLA0A08550 Chr1 (2112176..2114533) [2358 bp, 785 aa] {ON} Anc_4...    42   0.002
Kwal_33.13496 s33 complement(251014..252006) [993 bp, 330 aa] {O...    42   0.002
Suva_9.214 Chr9 (351853..352293) [441 bp, 146 aa] {ON} YIR005W (...    40   0.002
Suva_16.440 Chr16 complement(757046..759706) [2661 bp, 886 aa] {...    42   0.002
KLLA0D13772g Chr4 (1185663..1186700) [1038 bp, 345 aa] {ON} some...    42   0.002
Skud_8.20 Chr8 (44743..46833) [2091 bp, 696 aa] {ON} YHL024W (REAL)    42   0.002
TBLA0D04850 Chr4 (1191350..1192639) [1290 bp, 429 aa] {ON} Anc_1...    42   0.002
Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C ...    42   0.002
Smik_16.57 Chr16 (103313..105661) [2349 bp, 782 aa] {ON} YGR250C...    42   0.002
TBLA0C05600 Chr3 complement(1357001..1357648) [648 bp, 215 aa] {...    41   0.003
KAFR0F02770 Chr6 complement(547451..549682) [2232 bp, 743 aa] {O...    42   0.003
Suva_7.231 Chr7 complement(407919..408848) [930 bp, 309 aa] {ON}...    41   0.003
CAGL0D05236g Chr4 (499006..500337) [1332 bp, 443 aa] {ON} weakly...    42   0.003
KLTH0A04554g Chr1 (380152..380988) [837 bp, 278 aa] {ON} weakly ...    41   0.003
TBLA0F03500 Chr6 complement(861480..863774) [2295 bp, 764 aa] {O...    42   0.003
TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {O...    42   0.003
KNAG0I01230 Chr9 (230872..232332) [1461 bp, 486 aa] {ON} Anc_1.4...    41   0.003
Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {...    41   0.004
NDAI0A02810 Chr1 complement(633738..634247) [510 bp, 169 aa] {ON...    40   0.004
TBLA0A01040 Chr1 complement(235996..236433) [438 bp, 145 aa] {ON...    39   0.004
SAKL0F06160g Chr6 complement(462236..464878) [2643 bp, 880 aa] {...    41   0.004
NDAI0C01030 Chr3 (199929..200780) [852 bp, 283 aa] {ON} Anc_5.53...    40   0.004
TBLA0C02300 Chr3 (543570..546176) [2607 bp, 868 aa] {ON} Anc_3.4...    41   0.004
Ecym_4071 Chr4 complement(153279..154091) [813 bp, 270 aa] {ON} ...    40   0.004
Kwal_23.5864 s23 (1347244..1348080) [837 bp, 278 aa] {ON} YIL061...    40   0.004
Ecym_1302 Chr1 complement(613499..614365) [867 bp, 288 aa] {ON} ...    40   0.005
ZYRO0F12716g Chr6 (1035111..1035743) [633 bp, 210 aa] {ON} simil...    40   0.005
Skud_4.704 Chr4 complement(1244854..1245678) [825 bp, 274 aa] {O...    40   0.005
YDR429C Chr4 complement(1324477..1325301) [825 bp, 274 aa] {ON} ...    40   0.005
AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON} S...    41   0.005
Kwal_23.3985 s23 (510995..513625) [2631 bp, 876 aa] {ON} YPR112C...    41   0.005
KAFR0D01270 Chr4 complement(256417..257748) [1332 bp, 443 aa] {O...    41   0.005
NCAS0A13220 Chr1 (2600885..2601400) [516 bp, 171 aa] {ON} Anc_7....    39   0.005
NDAI0F02720 Chr6 (668516..669196) [681 bp, 226 aa] {ON} Anc_2.167      40   0.005
KLTH0D02640g Chr4 complement(261313..262701) [1389 bp, 462 aa] {...    41   0.005
Smik_4.703 Chr4 complement(1245222..1246046) [825 bp, 274 aa] {O...    40   0.005
KNAG0E03510 Chr5 complement(701816..702334) [519 bp, 172 aa] {ON...    39   0.005
Suva_14.344 Chr14 (602901..602930,603310..604644) [1365 bp, 454 ...    40   0.006
SAKL0D01958g Chr4 (151411..154248) [2838 bp, 945 aa] {ON} some s...    41   0.006
Smik_8.17 Chr8 (40206..42356) [2151 bp, 716 aa] {ON} YHL024W (REAL)    41   0.006
Suva_2.605 Chr2 complement(1077179..1078003) [825 bp, 274 aa] {O...    40   0.006
NCAS0H02590 Chr8 complement(514898..515710) [813 bp, 270 aa] {ON...    40   0.006
TBLA0A01570 Chr1 (364733..366961) [2229 bp, 742 aa] {ON} Anc_8.4...    41   0.006
AAR022W Chr1 (381754..382098) [345 bp, 114 aa] {ON} Syntenic hom...    38   0.006
KLTH0F13090g Chr6 complement(1079045..1079482) [438 bp, 145 aa] ...    39   0.007
Ecym_6416 Chr6 (811576..812748) [1173 bp, 390 aa] {ON} similar t...    40   0.007
YNL110C Chr14 complement(417826..418488) [663 bp, 220 aa] {ON}  ...    39   0.008
YLL046C Chr12 complement(46714..47463) [750 bp, 249 aa] {ON}  RN...    40   0.008
YNL004W Chr14 (622915..622944,623287..624621) [1365 bp, 454 aa] ...    40   0.008
ZYRO0G13706g Chr7 complement(1097882..1099144) [1263 bp, 420 aa]...    40   0.008
Kwal_0.250 s0 complement(122111..122758) [648 bp, 216 aa] {OFF} ...    39   0.008
TDEL0H01940 Chr8 complement(334207..335163) [957 bp, 318 aa] {ON...    40   0.008
ACR274W Chr3 (854587..855867) [1281 bp, 426 aa] {ON} Syntenic ho...    40   0.009
SAKL0F04400g Chr6 complement(355542..356108) [567 bp, 188 aa] {O...    39   0.009
Kwal_YGOB_0.250 s0 complement(122081..122758) [678 bp, 226 aa] {...    39   0.009
KAFR0K01170 Chr11 complement(242500..242925) [426 bp, 141 aa] {O...    38   0.009
KAFR0A05510 Chr1 (1098387..1100939) [2553 bp, 850 aa] {ON} Anc_3...    40   0.009
ADL063W Chr4 (569852..569854,569912..570871) [963 bp, 320 aa] {O...    40   0.009
Suva_14.229 Chr14 complement(414648..415316) [669 bp, 222 aa] {O...    39   0.010
AFR649W Chr6 (1619582..1620514) [933 bp, 310 aa] {ON} NOHBY659; ...    40   0.010
YHL024W Chr8 (56649..58790) [2142 bp, 713 aa] {ON}  RIM4Putative...    40   0.010
CAGL0M12573g Chr13 (1247678..1248577) [900 bp, 299 aa] {ON} simi...    39   0.011
NDAI0E04860 Chr5 (1103131..1104102) [972 bp, 323 aa] {ON} Anc_7....    39   0.011
CAGL0F01023g Chr6 complement(108155..109345) [1191 bp, 396 aa] {...    40   0.011
ZYRO0F08294g Chr6 complement(670688..672832) [2145 bp, 714 aa] {...    40   0.011
KAFR0L00970 Chr12 (181689..182546) [858 bp, 285 aa] {ON} Anc_7.2...    39   0.011
KLLA0D14949g Chr4 complement(1259860..1262496) [2637 bp, 878 aa]...    40   0.011
YGR250C Chr7 complement(991176..993521) [2346 bp, 781 aa] {ON} P...    40   0.012
CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {...    40   0.013
KNAG0D03250 Chr4 complement(580147..580956) [810 bp, 269 aa] {ON...    39   0.013
Smik_4.705 Chr4 (1249525..1250769) [1245 bp, 414 aa] {ON} YDR432...    39   0.014
ZYRO0G04004g Chr7 complement(327232..327735) [504 bp, 167 aa] {O...    38   0.014
KAFR0F03150 Chr6 complement(624522..625349) [828 bp, 275 aa] {ON...    39   0.014
KLLA0B11594g Chr2 complement(1018044..1018388) [345 bp, 114 aa] ...    37   0.014
Skud_14.323 Chr14 (589699..589728,590087..591421) [1365 bp, 454 ...    39   0.014
Kpol_479.17 s479 (36215..37738) [1524 bp, 507 aa] {ON} (36215..3...    39   0.015
Ecym_5419 Chr5 (864517..865164) [648 bp, 215 aa] {ON} similar to...    39   0.015
NCAS0A08980 Chr1 (1778830..1780647) [1818 bp, 605 aa] {ON} Anc_1...    39   0.015
KAFR0E03240 Chr5 complement(645818..646963) [1146 bp, 381 aa] {O...    39   0.015
Ecym_1261 Chr1 complement(536914..537255) [342 bp, 113 aa] {ON} ...    37   0.016
ZYRO0C12452g Chr3 complement(983386..985986) [2601 bp, 866 aa] {...    39   0.016
KNAG0L00570 Chr12 complement(86604..87899) [1296 bp, 431 aa] {ON...    39   0.016
KLTH0F13816g Chr6 (1135521..1135895) [375 bp, 124 aa] {ON} simil...    37   0.016
ZYRO0B00924g Chr2 complement(71856..74432) [2577 bp, 858 aa] {ON...    39   0.018
KLTH0G03960g Chr7 complement(314167..315009) [843 bp, 280 aa] {O...    39   0.019
Ecym_4324 Chr4 complement(697762..698754,698828..698830) [996 bp...    39   0.020
Kwal_30.12890 s30 (3814..4656) [843 bp, 280 aa] {ON} YDR429C (TI...    39   0.020
KLLA0B00979g Chr2 (77439..78467) [1029 bp, 342 aa] {ON} weakly s...    39   0.020
ZYRO0D09482g Chr4 complement(808223..809092) [870 bp, 289 aa] {O...    39   0.021
Kwal_26.8458 s26 (793431..794090) [660 bp, 219 aa] {ON} YNL110C ...    38   0.021
Kpol_1040.23 s1040 complement(65741..67144) [1404 bp, 467 aa] {O...    39   0.022
Suva_7.546 Chr7 complement(946681..949020) [2340 bp, 779 aa] {ON...    39   0.022
KLLA0F18216g Chr6 (1677731..1679857) [2127 bp, 708 aa] {ON} some...    39   0.022
TBLA0C04320 Chr3 (1040065..1040874) [810 bp, 269 aa] {ON} Anc_4....    38   0.023
Smik_14.324 Chr14 (581702..582988) [1287 bp, 428 aa] {ON} YNL004...    39   0.023
TPHA0I00420 Chr9 (82903..84300) [1398 bp, 465 aa] {ON} Anc_8.822...    39   0.023
Skud_4.706 Chr4 (1249139..1250398) [1260 bp, 419 aa] {ON} YDR432...    39   0.024
KNAG0F01320 Chr6 complement(237828..239075) [1248 bp, 415 aa] {O...    39   0.025
TDEL0F01640 Chr6 complement(302376..304346) [1971 bp, 656 aa] {O...    39   0.026
NCAS0A11540 Chr1 complement(2283352..2285961) [2610 bp, 869 aa] ...    39   0.027
CAGL0E03630g Chr5 complement(335328..337568) [2241 bp, 746 aa] {...    39   0.028
Smik_14.217 Chr14 complement(397474..398136) [663 bp, 220 aa] {O...    38   0.029
TDEL0H03080 Chr8 complement(508090..508917) [828 bp, 275 aa] {ON...    38   0.032
Kpol_1066.35 s1066 complement(57266..58168) [903 bp, 300 aa] {ON...    38   0.034
SAKL0H25366g Chr8 complement(2212946..2214826) [1881 bp, 626 aa]...    38   0.034
Ecym_7344 Chr7 (717321..718130) [810 bp, 269 aa] {ON} similar to...    38   0.034
TDEL0C05990 Chr3 (1079338..1080351) [1014 bp, 337 aa] {ON} Anc_1...    38   0.035
NDAI0H01670 Chr8 (404385..405596) [1212 bp, 403 aa] {ON} Anc_5.5...    38   0.036
Kwal_55.20414 s55 (388156..389010) [855 bp, 284 aa] {ON} YFR032C...    38   0.037
AGR010C Chr7 complement(736603..737403) [801 bp, 266 aa] {ON} Sy...    37   0.040
Kpol_2000.44 s2000 (86199..87215) [1017 bp, 338 aa] {ON} (86199....    38   0.040
Smik_13.481 Chr13 complement(785925..787286) [1362 bp, 453 aa] {...    38   0.040
TPHA0E01030 Chr5 complement(211573..213444) [1872 bp, 623 aa] {O...    38   0.041
Kpol_1030.41 s1030 complement(91357..93168) [1812 bp, 603 aa] {O...    38   0.042
Skud_14.222 Chr14 complement(408018..408680) [663 bp, 220 aa] {O...    37   0.044
Ecym_7289 Chr7 complement(608012..610132) [2121 bp, 706 aa] {ON}...    38   0.048
ADL126C Chr4 complement(469989..471389) [1401 bp, 466 aa] {ON} S...    38   0.048
Suva_2.607 Chr2 (1081506..1082435) [930 bp, 309 aa] {ON} YDR432W...    37   0.048
SAKL0G05258g Chr7 (432822..433937) [1116 bp, 371 aa] {ON} weakly...    37   0.048
KLLA0F07799g Chr6 complement(734889..736277) [1389 bp, 462 aa] {...    37   0.055
TPHA0O00720 Chr15 complement(136275..137711) [1437 bp, 478 aa] {...    37   0.055
AGL038C Chr7 complement(639306..641444) [2139 bp, 712 aa] {ON} S...    38   0.058
TPHA0J00920 Chr10 (217471..218400) [930 bp, 309 aa] {ON} Anc_7.2...    37   0.060
YIR009W Chr9 (374525..374860) [336 bp, 111 aa] {ON}  MSL1U2B com...    35   0.061
KLTH0E06226g Chr5 (568785..571112) [2328 bp, 775 aa] {ON} weakly...    37   0.064
TPHA0C03940 Chr3 complement(844251..844688) [438 bp, 145 aa] {ON...    36   0.066
ZYRO0C08382g Chr3 (639267..640181) [915 bp, 304 aa] {ON} similar...    37   0.067
NCAS0F01150 Chr6 (227262..228401) [1140 bp, 379 aa] {ON} Anc_5.5...    37   0.074
Skud_7.583 Chr7 complement(965719..968058) [2340 bp, 779 aa] {ON...    37   0.074
SAKL0G05126g Chr7 complement(423140..423985) [846 bp, 281 aa] {O...    37   0.075
NDAI0K00510 Chr11 (114005..115363) [1359 bp, 452 aa] {ON} Anc_8....    37   0.084
TPHA0H01140 Chr8 complement(251773..254277) [2505 bp, 834 aa] {O...    37   0.088
Kpol_1029.3 s1029 complement(3577..4251) [675 bp, 224 aa] {ON} c...    36   0.088
TPHA0H02600 Chr8 (607962..609338) [1377 bp, 458 aa] {ON} Anc_7.9...    37   0.089
TBLA0G00910 Chr7 (221951..222784) [834 bp, 277 aa] {ON} Anc_5.53...    36   0.094
TPHA0K00500 Chr11 (99226..100041) [816 bp, 271 aa] {ON} Anc_5.53...    36   0.096
YDR432W Chr4 (1328783..1330027) [1245 bp, 414 aa] {ON}  NPL3RNA-...    37   0.098
SAKL0H05192g Chr8 (466582..466661,466747..467632) [966 bp, 321 a...    37   0.10 
KLLA0F09383g Chr6 (865710..866486) [777 bp, 258 aa] {ON} similar...    36   0.10 
ADR183C Chr4 complement(1024790..1025752) [963 bp, 320 aa] {ON} ...    36   0.10 
Ecym_2633 Chr2 (1221858..1223150) [1293 bp, 430 aa] {ON} similar...    37   0.11 
ZYRO0D05654g Chr4 complement(485258..486583) [1326 bp, 441 aa] {...    37   0.11 
KLLA0B00847g Chr2 complement(65983..66792) [810 bp, 269 aa] {ON}...    36   0.12 
Suva_9.140 Chr9 complement(235080..235988) [909 bp, 302 aa] {ON}...    36   0.12 
YMR268C Chr13 complement(802888..804222) [1335 bp, 444 aa] {ON} ...    36   0.12 
Kwal_27.11096 s27 complement(635969..636574) [606 bp, 201 aa] {O...    35   0.13 
AFL050W Chr6 (345624..346280) [657 bp, 218 aa] {ON} Syntenic hom...    36   0.13 
KNAG0I03040 Chr9 complement(605783..607876) [2094 bp, 697 aa] {O...    37   0.13 
KAFR0D01660 Chr4 (330013..330651) [639 bp, 212 aa] {ON} Anc_8.79...    35   0.13 
ZYRO0D15224g Chr4 (1279820..1280080) [261 bp, 86 aa] {ON} weakly...    33   0.14 
Smik_9.126 Chr9 complement(219413..220315) [903 bp, 300 aa] {ON}...    36   0.14 
Kpol_1018.135 s1018 (361521..364112) [2592 bp, 863 aa] {ON} (361...    36   0.15 
Smik_9.209 Chr9 (350452..350787) [336 bp, 111 aa] {ON} YIR009W (...    34   0.16 
TPHA0A04440 Chr1 (996689..999121) [2433 bp, 810 aa] {ON} Anc_3.1...    36   0.17 
KLTH0H05214g Chr8 (465108..465710) [603 bp, 200 aa] {ON} highly ...    35   0.18 
ZYRO0D12892g Chr4 (1087239..1088474) [1236 bp, 411 aa] {ON} weak...    36   0.18 
SAKL0F04774g Chr6 (381688..382542) [855 bp, 284 aa] {ON} similar...    35   0.19 
CAGL0G05401g Chr7 complement(508557..510572) [2016 bp, 671 aa] {...    36   0.19 
Kwal_55.20903 s55 complement(604836..605279) [444 bp, 147 aa] {O...    34   0.21 
SAKL0F08866g Chr6 (678049..678054,678125..679027) [909 bp, 302 a...    35   0.21 
NDAI0A08510 Chr1 (1960682..1962106) [1425 bp, 474 aa] {ON} Anc_7...    36   0.21 
Suva_15.128 Chr15 complement(223683..225089) [1407 bp, 468 aa] {...    35   0.22 
KAFR0G02950 Chr7 complement(614874..615782) [909 bp, 302 aa] {ON...    35   0.23 
CAGL0F08217g Chr6 complement(814508..816544) [2037 bp, 678 aa] {...    35   0.24 
KLTH0E04730g Chr5 (423242..424117) [876 bp, 291 aa] {ON} weakly ...    35   0.25 
TDEL0H03570 Chr8 (590287..591546) [1260 bp, 419 aa] {ON} Anc_7.9...    35   0.26 
CAGL0H04763g Chr8 (454589..455740) [1152 bp, 383 aa] {ON} highly...    35   0.29 
Kwal_47.18572 s47 complement(878877..879968) [1092 bp, 363 aa] {...    35   0.33 
Ecym_4483 Chr4 (978489..979556) [1068 bp, 355 aa] {ON} similar t...    35   0.34 
Skud_15.116 Chr15 complement(210151..211533) [1383 bp, 460 aa] {...    35   0.35 
Kpol_322.1 s322 complement(711..974) [264 bp, 87 aa] {ON} comple...    32   0.35 
TDEL0A04050 Chr1 (722870..724075) [1206 bp, 401 aa] {ON} Anc_5.5...    35   0.36 
KLTH0G04114g Chr7 (328845..330074) [1230 bp, 409 aa] {ON} weakly...    35   0.37 
YOL041C Chr15 complement(251267..252646) [1380 bp, 459 aa] {ON} ...    35   0.38 
KLTH0D12826g Chr4 (1049629..1050321) [693 bp, 230 aa] {ON} simil...    34   0.41 
YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putati...    35   0.41 
Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W ...    35   0.42 
SAKL0F07326g Chr6 complement(560379..561308) [930 bp, 309 aa] {O...    34   0.44 
TBLA0A07650 Chr1 (1894958..1897168) [2211 bp, 736 aa] {ON} Anc_7...    35   0.47 
TDEL0G01000 Chr7 (206991..209408) [2418 bp, 805 aa] {ON} Anc_5.7...    35   0.49 
KNAG0L01580 Chr12 (280914..281831) [918 bp, 305 aa] {ON} Anc_7.2...    34   0.55 
TBLA0A04750 Chr1 complement(1177080..1178501) [1422 bp, 473 aa] ...    34   0.56 
NCAS0A14270 Chr1 (2808773..2810638) [1866 bp, 621 aa] {ON} Anc_7...    34   0.59 
KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON...    34   0.62 
Smik_15.126 Chr15 complement(217400..218782) [1383 bp, 460 aa] {...    34   0.64 
ADR001C Chr4 complement(708435..709409) [975 bp, 324 aa] {ON} Sy...    34   0.66 
TDEL0B00750 Chr2 (139060..140316) [1257 bp, 418 aa] {ON} Anc_8.8...    34   0.68 
CAGL0C01529g Chr3 (167802..168512) [711 bp, 236 aa] {ON} similar...    33   0.68 
KNAG0B01400 Chr2 complement(261331..262335) [1005 bp, 334 aa] {O...    34   0.69 
Ecym_2246 Chr2 (485381..486091) [711 bp, 236 aa] {ON} similar to...    33   0.73 
Suva_7.74 Chr7 complement(141302..142891) [1590 bp, 529 aa] {ON}...    34   0.79 
Ecym_4077 Chr4 (162858..163817) [960 bp, 319 aa] {ON} similar to...    33   0.84 
NDAI0A01780 Chr1 complement(395250..397340) [2091 bp, 696 aa] {O...    34   0.87 
YIL061C Chr9 complement(244657..245559) [903 bp, 300 aa] {ON}  S...    33   0.88 
KLTH0D13706g Chr4 complement(1117480..1118310) [831 bp, 276 aa] ...    33   0.88 
Kpol_1069.8 s1069 (14170..15519) [1350 bp, 449 aa] {ON} (14170.....    33   0.88 
SAKL0B09702g Chr2 (819107..820528) [1422 bp, 473 aa] {ON} simila...    33   0.91 
ZYRO0B02860g Chr2 (229241..231307) [2067 bp, 688 aa] {ON} weakly...    33   0.98 
TPHA0J02110 Chr10 complement(472245..473024) [780 bp, 259 aa] {O...    33   1.0  
Kwal_26.7525 s26 (403321..404499) [1179 bp, 392 aa] {ON} YGR156W...    33   1.1  
Smik_7.83 Chr7 complement(140174..141754) [1581 bp, 526 aa] {ON}...    33   1.1  
Kpol_1002.79 s1002 (208736..209365) [630 bp, 209 aa] {ON} (20873...    33   1.2  
YGL190C Chr7 complement(145809..147389) [1581 bp, 526 aa] {ON}  ...    33   1.2  
KLLA0C07194g Chr3 (624694..625587) [894 bp, 297 aa] {ON} conserv...    33   1.4  
Kwal_55.20718 s55 (528743..530527) [1785 bp, 594 aa] {ON} YHL024...    33   1.4  
ZYRO0G19250g Chr7 (1595380..1596999) [1620 bp, 539 aa] {ON} high...    33   1.4  
Skud_7.83 Chr7 complement(151496..153076) [1581 bp, 526 aa] {ON}...    33   1.4  
KLTH0D04180g Chr4 (395761..396993) [1233 bp, 410 aa] {ON} weakly...    33   1.5  
NDAI0B01910 Chr2 complement(463465..464985) [1521 bp, 506 aa] {O...    33   1.5  
Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,...    33   1.5  
KLTH0B04950g Chr2 (405537..407279) [1743 bp, 580 aa] {ON} some s...    33   1.6  
SAKL0F11924g Chr6 (925625..927466) [1842 bp, 613 aa] {ON} some s...    33   1.6  
ZYRO0D15686g Chr4 complement(1313019..1314032) [1014 bp, 337 aa]...    33   1.7  
TBLA0B02730 Chr2 complement(628543..629310) [768 bp, 255 aa] {ON...    32   1.7  
TDEL0E00830 Chr5 (169821..170693) [873 bp, 290 aa] {ON} Anc_3.74...    32   1.8  
SAKL0A05588g Chr1 (505510..506133) [624 bp, 207 aa] {ON} highly ...    32   2.1  
ZYRO0G19844g Chr7 (1642204..1642860) [657 bp, 218 aa] {ON} highl...    32   2.2  
KNAG0K00460 Chr11 (77388..79508) [2121 bp, 706 aa] {ON} Anc_5.76...    32   2.3  
ACR235W Chr3 (771971..773707) [1737 bp, 578 aa] {ON} Syntenic ho...    32   2.4  
Smik_12.284 Chr12 (536350..537537) [1188 bp, 395 aa] {ON} YLR226...    32   2.4  
KNAG0H01710 Chr8 (304440..304469,304846..306099) [1284 bp, 427 a...    32   2.5  
Kpol_400.1 s400 (3149..4951) [1803 bp, 600 aa] {ON} (3149..4951)...    32   2.6  
AFR195W Chr6 (792029..793393) [1365 bp, 454 aa] {ON} Syntenic ho...    32   2.6  
Kwal_33.14810 s33 complement(824910..826634) [1725 bp, 574 aa] {...    32   3.1  
KLTH0D00946g Chr4 (89863..92082) [2220 bp, 739 aa] {ON} similar ...    32   3.2  
YBR119W Chr2 (479338..479345,479435..480323) [897 bp, 298 aa] {O...    32   3.3  
Ecym_6211 Chr6 complement(393887..395530) [1644 bp, 547 aa] {ON}...    32   3.3  
NCAS0E03280 Chr5 complement(650337..651302) [966 bp, 321 aa] {ON...    32   3.3  
KLLA0F20834g Chr6 complement(1942016..1943866) [1851 bp, 616 aa]...    32   3.3  
TDEL0C01770 Chr3 complement(309215..311113) [1899 bp, 632 aa] {O...    32   3.4  
KAFR0K01000 Chr11 complement(207961..208242) [282 bp, 93 aa] {ON...    30   3.5  
NCAS0A12190 Chr1 (2415445..2415786) [342 bp, 113 aa] {ON} Anc_7....    30   3.6  
Suva_10.24 Chr10 complement(50291..51052) [762 bp, 253 aa] {ON} ...    31   3.7  
Kpol_1023.90 s1023 complement(213517..214764) [1248 bp, 415 aa] ...    32   3.7  
KAFR0A04360 Chr1 (869776..870402) [627 bp, 208 aa] {ON} Anc_6.17...    31   3.8  
YLR226W Chr12 (589354..590541) [1188 bp, 395 aa] {ON}  BUR2Cycli...    32   3.8  
KAFR0C02950 Chr3 complement(589512..590963) [1452 bp, 483 aa] {O...    32   4.0  
TBLA0A01830 Chr1 complement(446153..446839) [687 bp, 228 aa] {ON...    31   4.3  
Kwal_26.6824 s26 (80841..83060) [2220 bp, 739 aa] {ON} YOR361C (...    32   4.5  
KLLA0E05237g Chr5 (460483..464460) [3978 bp, 1325 aa] {ON} highl...    32   4.6  
SAKL0H25014g Chr8 (2178085..2179431) [1347 bp, 448 aa] {ON} high...    31   4.6  
KNAG0C03150 Chr3 complement(623367..624425) [1059 bp, 352 aa] {O...    31   4.7  
TDEL0B04610 Chr2 complement(821716..823281) [1566 bp, 521 aa] {O...    31   4.8  
Kwal_55.21039 s55 (660549..660908) [360 bp, 119 aa] {ON} YIR009W...    30   5.2  
Suva_7.447 Chr7 (770016..771314) [1299 bp, 432 aa] {ON} YGR156W ...    31   5.2  
Ecym_8417 Chr8 (872889..873764) [876 bp, 291 aa] {ON} similar to...    31   5.5  
Skud_9.111 Chr9 complement(215540..216442) [903 bp, 300 aa] {ON}...    31   5.6  
TPHA0O01260 Chr15 (250335..252413) [2079 bp, 692 aa] {ON} Anc_1....    31   6.0  
TBLA0C05500 Chr3 complement(1328942..1332592) [3651 bp, 1216 aa]...    31   6.1  
TBLA0D01550 Chr4 complement(387300..388562) [1263 bp, 420 aa] {O...    31   6.2  
KLTH0E06534g Chr5 complement(600189..601571) [1383 bp, 460 aa] {...    31   6.2  
KLTH0B07546g Chr2 (609954..611873) [1920 bp, 639 aa] {ON} some s...    31   6.3  
Smik_12.12 Chr12 complement(31593..32339) [747 bp, 248 aa] {ON} ...    30   6.4  
Kpol_246.2 s246 (4897..6507) [1611 bp, 536 aa] {ON} (4897..6507)...    31   6.7  
KLLA0F09053g Chr6 (842591..843949) [1359 bp, 452 aa] {ON} simila...    31   6.7  
Kwal_23.4597 s23 complement(781763..783757) [1995 bp, 664 aa] {O...    31   6.8  
NCAS0B05510 Chr2 complement(1038543..1040039) [1497 bp, 498 aa] ...    31   7.5  
CAGL0H02211g Chr8 (200049..201194) [1146 bp, 381 aa] {ON} simila...    30   7.8  
KLLA0D16049g Chr4 complement(1352380..1353657) [1278 bp, 425 aa]...    30   8.2  
KLTH0E10868g Chr5 (975831..976856) [1026 bp, 341 aa] {ON} simila...    30   8.4  
TBLA0D03940 Chr4 (968349..969938) [1590 bp, 529 aa] {ON} Anc_8.2...    30   9.0  
ZYRO0C10164g Chr3 (777453..779690) [2238 bp, 745 aa] {ON} some s...    30   9.7  

>TDEL0G02360 Chr7 (454633..455841) [1209 bp, 402 aa] {ON} Anc_2.306
           YNL016W
          Length = 402

 Score =  648 bits (1672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/402 (81%), Positives = 328/402 (81%)

Query: 1   MSEQENLEQNPTVESEVPASETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEIL 60
           MSEQENLEQNPTVESEVPASETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEIL
Sbjct: 1   MSEQENLEQNPTVESEVPASETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEIL 60

Query: 61  KQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAF 120
           KQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAF
Sbjct: 61  KQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAF 120

Query: 121 QSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSF 180
           QSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSF
Sbjct: 121 QSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSF 180

Query: 181 GSQEEAQKAMDAMQGHELNGRPLRINWASKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           GSQEEAQKAMDAMQGHELNGRPLRINWASK                              
Sbjct: 181 GSQEEAQKAMDAMQGHELNGRPLRINWASKRENNNNNNRRNVNGPRNNGFRHNNGGFPGS 240

Query: 241 XXXXXXXXXXXXXXXXVVPPPQALXXXXXXXXXXXXXXQAVDSMIRRAPPRVTTAYIGNI 300
                           VVPPPQAL              QAVDSMIRRAPPRVTTAYIGNI
Sbjct: 241 RGMPMPPPNSMSLPMGVVPPPQALGNPNGPSVPPPVNPQAVDSMIRRAPPRVTTAYIGNI 300

Query: 301 PHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRT 360
           PHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRT
Sbjct: 301 PHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRT 360

Query: 361 GWGKERTSFVPMSXXXXXXXXXXXXXXEEAVPPVDMTEENAQ 402
           GWGKERTSFVPMS              EEAVPPVDMTEENAQ
Sbjct: 361 GWGKERTSFVPMSQQQPPQQPQQPQQQEEAVPPVDMTEENAQ 402

>Suva_14.330 Chr14 (582310..583040,583082..583721) [1371 bp, 457 aa]
           {ON} YNL016W (REAL)
          Length = 457

 Score =  331 bits (849), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 163/205 (79%), Positives = 179/205 (87%), Gaps = 3/205 (1%)

Query: 8   EQNPTVE--SEVPASETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQ 65
           EQN + E  SE    E    +PSVVPANAI GGRETSD+VLYVGNLD +I E+ILKQYFQ
Sbjct: 38  EQNVSSEGNSEQVDDEQGENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQ 97

Query: 66  VGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQV 125
           VGGPIAN+KIM+DKNN N NYAFVEY QSHDANIALQTLNGKQIENNVVKINWAFQSQQ 
Sbjct: 98  VGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNVVKINWAFQSQQS 157

Query: 126 SPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEE 185
           S D+ TFNLFVGDLNV+VDDETLRNAFK+FP+YL GHVMWDMQTG SRGYGFVSF SQ++
Sbjct: 158 SSDD-TFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDD 216

Query: 186 AQKAMDAMQGHELNGRPLRINWASK 210
           AQ AMD+MQG +LNGRPLRINWA+K
Sbjct: 217 AQTAMDSMQGQDLNGRPLRINWAAK 241

 Score =  193 bits (491), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (95%)

Query: 279 QAVDSMIRRAPPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTH 338
           QAVD +IR APPRVTTAYIGNIPHFA EADLIPL QNFGFI+DFKHYPEKGCCFIKYDTH
Sbjct: 329 QAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTH 388

Query: 339 EQAAVCIVALANFPFQGRNLRTGWGKERTSFVP 371
           EQAAVCIVALANFPFQGRNLRTGWGKER++F+P
Sbjct: 389 EQAAVCIVALANFPFQGRNLRTGWGKERSNFMP 421

>Smik_14.313 Chr14 (561320..562675) [1356 bp, 451 aa] {ON} YNL016W
           (REAL)
          Length = 451

 Score =  330 bits (845), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 171/185 (92%), Gaps = 1/185 (0%)

Query: 26  EPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNAN 85
           +PSVVPANAI GGRETSDKVLYVGNLD +I E+ILKQYFQVGGPIAN+KIM+DKNN N N
Sbjct: 55  DPSVVPANAITGGRETSDKVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVN 114

Query: 86  YAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDD 145
           YAFVEY QSHDANIALQTLNGKQIENN+VKINWAFQSQQ S D+ TFNLFVGDLNV+VDD
Sbjct: 115 YAFVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSSSDD-TFNLFVGDLNVNVDD 173

Query: 146 ETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRI 205
           ETLRNAFK+FP+YL GHVMWDMQTG SRGYGFVSF SQ++AQ AMD+MQG +LNGRPLRI
Sbjct: 174 ETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRI 233

Query: 206 NWASK 210
           NWA+K
Sbjct: 234 NWAAK 238

 Score =  193 bits (490), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (95%)

Query: 279 QAVDSMIRRAPPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTH 338
           QAVD +IR APPRVTTAYIGNIPHFA EADLIPL QNFGFI+DFKHYPEKGCCFIKYDTH
Sbjct: 327 QAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTH 386

Query: 339 EQAAVCIVALANFPFQGRNLRTGWGKERTSFVP 371
           EQAAVCIVALANFPFQGRNLRTGWGKER++F+P
Sbjct: 387 EQAAVCIVALANFPFQGRNLRTGWGKERSNFMP 419

>YNL016W Chr14 (602907..604268) [1362 bp, 453 aa] {ON}  PUB1Poly
           (A)+ RNA-binding protein, abundant mRNP-component
           protein that binds mRNA and is required for stability of
           many mRNAs; component of glucose deprivation induced
           stress granules, involved in P-body-dependent granule
           assembly
          Length = 453

 Score =  329 bits (844), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 155/185 (83%), Positives = 171/185 (92%), Gaps = 1/185 (0%)

Query: 26  EPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNAN 85
           +PSVVPANAI GGRETSD+VLYVGNLD +I E+ILKQYFQVGGPIAN+KIM+DKNN N N
Sbjct: 57  DPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVN 116

Query: 86  YAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDD 145
           YAFVEY QSHDANIALQTLNGKQIENN+VKINWAFQSQQ S D+ TFNLFVGDLNV+VDD
Sbjct: 117 YAFVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSSSDD-TFNLFVGDLNVNVDD 175

Query: 146 ETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRI 205
           ETLRNAFK+FP+YL GHVMWDMQTG SRGYGFVSF SQ++AQ AMD+MQG +LNGRPLRI
Sbjct: 176 ETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRI 235

Query: 206 NWASK 210
           NWA+K
Sbjct: 236 NWAAK 240

 Score =  193 bits (491), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (95%)

Query: 279 QAVDSMIRRAPPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTH 338
           QAVD +IR APPRVTTAYIGNIPHFA EADLIPL QNFGFI+DFKHYPEKGCCFIKYDTH
Sbjct: 327 QAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTH 386

Query: 339 EQAAVCIVALANFPFQGRNLRTGWGKERTSFVP 371
           EQAAVCIVALANFPFQGRNLRTGWGKER++F+P
Sbjct: 387 EQAAVCIVALANFPFQGRNLRTGWGKERSNFMP 419

>ZYRO0A02398g Chr1 (188639..189871) [1233 bp, 410 aa] {ON} similar
           to uniprot|P32588 Saccharomyces cerevisiae YNL016W PUB1
           Poly(A) RNA-binding protein abundant mRNP- component
           protein hypothesized to bind a pool of non- translatable
           mRNAs not reported to associate with polyribosomes
          Length = 410

 Score =  328 bits (840), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 179/205 (87%), Gaps = 1/205 (0%)

Query: 7   LEQNPTVESEVPASETISEEPS-VVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQ 65
           +++ PTV      S++   E + VVPANA KGGRETSD+VLYVGNLD SI EE+L+QYFQ
Sbjct: 18  VQEEPTVSPSPERSDSEERETTPVVPANATKGGRETSDRVLYVGNLDKSITEEVLRQYFQ 77

Query: 66  VGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQV 125
           VGG I+NVK+M+DKNN+ ANYAFVEYF+SHDANIALQTLNGKQIENNVV+INWAFQSQQ 
Sbjct: 78  VGGQISNVKVMIDKNNARANYAFVEYFKSHDANIALQTLNGKQIENNVVRINWAFQSQQA 137

Query: 126 SPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEE 185
            PDE T+NLFVGDL+VDVDDETL NAF+ FP+++QGHVMWDMQTGGSRGYGFVSFG QE+
Sbjct: 138 LPDENTYNLFVGDLSVDVDDETLCNAFRSFPSFIQGHVMWDMQTGGSRGYGFVSFGDQEQ 197

Query: 186 AQKAMDAMQGHELNGRPLRINWASK 210
           AQ AMD+MQ  ELNGRPLRINWASK
Sbjct: 198 AQLAMDSMQSQELNGRPLRINWASK 222

 Score =  194 bits (492), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 84/95 (88%), Positives = 93/95 (97%)

Query: 279 QAVDSMIRRAPPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTH 338
           QAV++MIRRAPPRVTT+YIGNIPHFA ++DLIPLLQNFGFI+DFKHYPEKGCCF+KYDTH
Sbjct: 298 QAVEAMIRRAPPRVTTSYIGNIPHFATDSDLIPLLQNFGFILDFKHYPEKGCCFVKYDTH 357

Query: 339 EQAAVCIVALANFPFQGRNLRTGWGKERTSFVPMS 373
           EQAAVCIVALANF FQGRNLRTGWGKERT+FVPM+
Sbjct: 358 EQAAVCIVALANFFFQGRNLRTGWGKERTTFVPMA 392

>Skud_14.312 Chr14 (569627..571006) [1380 bp, 459 aa] {ON} YNL016W
           (REAL)
          Length = 459

 Score =  328 bits (842), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 155/185 (83%), Positives = 170/185 (91%), Gaps = 1/185 (0%)

Query: 26  EPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNAN 85
           +PSVVPANAI GGRETSD+VLYVGNLD +I E+ILKQYFQVGGPIAN+KIM+DKNN N N
Sbjct: 57  DPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVN 116

Query: 86  YAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDD 145
           YAFVEY QSHDANIALQTLNGKQIENN+VKINWAFQSQQ S D+ TFNLFVGDLNV+VDD
Sbjct: 117 YAFVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSSSDD-TFNLFVGDLNVNVDD 175

Query: 146 ETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRI 205
           ETLRNAFK+FP+YL GHVMWDMQTG SRGYGFVSF SQ++AQ AMD MQG +LNGRPLRI
Sbjct: 176 ETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDTMQGQDLNGRPLRI 235

Query: 206 NWASK 210
           NWA+K
Sbjct: 236 NWAAK 240

 Score =  193 bits (490), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (95%)

Query: 279 QAVDSMIRRAPPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTH 338
           QAVD +IR APPRVTTAYIGNIPHFA EADLIPL QNFGFI+DFKHYPEKGCCFIKYDTH
Sbjct: 333 QAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTH 392

Query: 339 EQAAVCIVALANFPFQGRNLRTGWGKERTSFVP 371
           EQAAVCIVALANFPFQGRNLRTGWGKER++F+P
Sbjct: 393 EQAAVCIVALANFPFQGRNLRTGWGKERSNFMP 425

>SAKL0E07128g Chr5 complement(587416..588621) [1206 bp, 401 aa] {ON}
           some similarities with uniprot|P32588 Saccharomyces
           cerevisiae YNL016W PUB1 Poly(A) RNA-binding protein
           abundant mRNP-component protein hypothesized to bind a
           pool of non-translatable mRNAs not reported to associate
           with polyribosomes
          Length = 401

 Score =  303 bits (776), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 145/210 (69%), Positives = 169/210 (80%), Gaps = 1/210 (0%)

Query: 1   MSEQENLEQNPTVESEVPASETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEIL 60
           MSE +   Q   VE+    +  + E+P + PAN  +GGRETSDK+LYVGNLD SI E++L
Sbjct: 1   MSEPQQPTQEKVVENNQDETTPVEEQPQITPANVARGGRETSDKILYVGNLDKSITEDLL 60

Query: 61  KQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAF 120
           KQYFQVGGP+ANVKI+VDKNN  ANYAFVEY + HDAN+A QTL+GK IENN +KINWAF
Sbjct: 61  KQYFQVGGPVANVKILVDKNNQEANYAFVEYHKPHDANVAFQTLDGKTIENNQIKINWAF 120

Query: 121 QSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSF 180
           QS QV+ DE +FNLFVGDLNVDVDDETL NAF EF  ++Q HVMWDMQ+G SRGYGFVSF
Sbjct: 121 QSHQVASDE-SFNLFVGDLNVDVDDETLANAFSEFSAFIQAHVMWDMQSGRSRGYGFVSF 179

Query: 181 GSQEEAQKAMDAMQGHELNGRPLRINWASK 210
           G QE+AQKAM+  QG ELNGR +RINWASK
Sbjct: 180 GEQEQAQKAMETKQGFELNGRAIRINWASK 209

 Score =  189 bits (479), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 80/90 (88%), Positives = 87/90 (96%)

Query: 282 DSMIRRAPPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQA 341
           ++MIRRAPPR+TTAYIGNIPHFA E DLIPLLQNFGFI+DFKHYPEKGCCFIKYDTHEQA
Sbjct: 287 EAMIRRAPPRITTAYIGNIPHFATEPDLIPLLQNFGFIVDFKHYPEKGCCFIKYDTHEQA 346

Query: 342 AVCIVALANFPFQGRNLRTGWGKERTSFVP 371
           AVCIVALANFPFQGRNLRTGWGKE+ +F+P
Sbjct: 347 AVCIVALANFPFQGRNLRTGWGKEKPTFIP 376

>TBLA0B07170 Chr2 complement(1698573..1699985) [1413 bp, 470 aa]
           {ON} Anc_2.306 YNL016W
          Length = 470

 Score =  303 bits (776), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 146/204 (71%), Positives = 168/204 (82%), Gaps = 2/204 (0%)

Query: 8   EQNPTVESEVPASETISEEPS-VVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQV 66
           EQ P   S     +  +EE + VVPANAI+GGRETSDK+LYVGNLD SINE+ LKQYFQV
Sbjct: 46  EQTPAESSSEQTGDNDTEESANVVPANAIRGGRETSDKILYVGNLDKSINEDSLKQYFQV 105

Query: 67  GGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVS 126
           GGPIANVKI+VDKNN   NYAFVEY + HDAN+ALQTLNGK IE  +VKINWAFQSQQ S
Sbjct: 106 GGPIANVKIIVDKNNKYCNYAFVEYLKHHDANVALQTLNGKHIEKKIVKINWAFQSQQSS 165

Query: 127 PDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEA 186
            D+ TFNLF+GDLN+DV+DE+L  AFK+FP+++Q HVMWDMQTG SRGYGF SF +Q +A
Sbjct: 166 NDD-TFNLFIGDLNIDVNDESLTAAFKDFPSFVQAHVMWDMQTGRSRGYGFASFSTQNDA 224

Query: 187 QKAMDAMQGHELNGRPLRINWASK 210
           Q AMD MQG ELNGRP+RINWASK
Sbjct: 225 QLAMDQMQGKELNGRPIRINWASK 248

 Score =  178 bits (452), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 76/91 (83%), Positives = 85/91 (93%)

Query: 280 AVDSMIRRAPPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHE 339
           AV+ MIRRAPPRVTTAYIGN+P FA EADLIPLLQNFGFI+DFKHYP++G CFIKYDTHE
Sbjct: 326 AVEDMIRRAPPRVTTAYIGNLPRFATEADLIPLLQNFGFILDFKHYPDRGICFIKYDTHE 385

Query: 340 QAAVCIVALANFPFQGRNLRTGWGKERTSFV 370
           QAAVCIVALANFP QGRNL+TGWGKE+ +F+
Sbjct: 386 QAAVCIVALANFPLQGRNLKTGWGKEKPTFM 416

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 45/93 (48%), Gaps = 6/93 (6%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVD-KNNSNANYAFVEYFQSHDANIALQTL 104
           L++G+L+  +N+E L   F+         +M D +   +  Y F  +   +DA +A+  +
Sbjct: 172 LFIGDLNIDVNDESLTAAFKDFPSFVQAHVMWDMQTGRSRGYGFASFSTQNDAQLAMDQM 231

Query: 105 NGKQIENNVVKINWAF-----QSQQVSPDEATF 132
            GK++    ++INWA      Q QQ S +   F
Sbjct: 232 QGKELNGRPIRINWASKRDNQQGQQQSHNNGGF 264

>KLTH0G10912g Chr7 (917604..918914) [1311 bp, 436 aa] {ON} some
           similarities with uniprot|P32588 Saccharomyces
           cerevisiae YNL016W PUB1 Poly(A) RNA-binding protein
           abundant mRNP-component protein hypothesized to bind a
           pool of non-translatable mRNAs not reported to associate
           with polyribosomes
          Length = 436

 Score =  300 bits (768), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 142/195 (72%), Positives = 164/195 (84%), Gaps = 1/195 (0%)

Query: 16  EVPASETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKI 75
           + P S T  EEP+V PANA +GGRETSD++LYVGNLD ++ EE+LKQYFQVGG IANVKI
Sbjct: 39  QTPESSTKPEEPTVTPANASRGGRETSDRILYVGNLDLAVTEEMLKQYFQVGGSIANVKI 98

Query: 76  MVDKNNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLF 135
           ++DKNN  ANYAFVE+ Q HDAN+A QTL+GKQIEN+V+KINWAFQSQQVS  E TFNLF
Sbjct: 99  LMDKNNKQANYAFVEFHQPHDANVAFQTLDGKQIENHVIKINWAFQSQQVS-SEDTFNLF 157

Query: 136 VGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQG 195
           VGDLNVDVDDETL   FK+ PT++Q HVMWDMQTG SRGYGFVSFG Q +AQKAM+  QG
Sbjct: 158 VGDLNVDVDDETLARTFKDIPTFIQAHVMWDMQTGRSRGYGFVSFGEQTQAQKAMEDNQG 217

Query: 196 HELNGRPLRINWASK 210
             +NGR +RINWASK
Sbjct: 218 AVVNGRAIRINWASK 232

 Score =  181 bits (458), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 75/93 (80%), Positives = 85/93 (91%)

Query: 279 QAVDSMIRRAPPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTH 338
           QAV++M+R APPRVTT YIGNIPHFA E DLIPLLQNFGFI+DFKHYP++GCCFIKY TH
Sbjct: 307 QAVEAMMRSAPPRVTTVYIGNIPHFATEQDLIPLLQNFGFIVDFKHYPDRGCCFIKYGTH 366

Query: 339 EQAAVCIVALANFPFQGRNLRTGWGKERTSFVP 371
           EQAAVCI+ L NFPFQGRNLRTGWGKE+ S++P
Sbjct: 367 EQAAVCILTLGNFPFQGRNLRTGWGKEKPSYIP 399

>AGR390C Chr7 complement(1447328..1448464) [1137 bp, 378 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL016W
           (PUB1)
          Length = 378

 Score =  297 bits (761), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 141/181 (77%), Positives = 157/181 (86%), Gaps = 1/181 (0%)

Query: 30  VPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFV 89
            P  A KGGRETSD++LYVGNLD +INE  LKQYFQVGGPIANVK++VDKNN  ANYAFV
Sbjct: 21  TPVLATKGGRETSDRILYVGNLDKTINEATLKQYFQVGGPIANVKVLVDKNNEEANYAFV 80

Query: 90  EYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLR 149
           EY Q  DAN+A QTL+GKQIENNV+KINWAFQSQQVS D+ TFNLFVGDLNVDVDDETL 
Sbjct: 81  EYRQPRDANVAFQTLDGKQIENNVIKINWAFQSQQVSSDD-TFNLFVGDLNVDVDDETLS 139

Query: 150 NAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
           + FKEFPT++Q HVMWDMQ+G SRGYGFVSFG QEEAQKAMDA QG  LNGR +R+NWA+
Sbjct: 140 STFKEFPTFIQAHVMWDMQSGRSRGYGFVSFGEQEEAQKAMDAKQGFNLNGRAIRVNWAA 199

Query: 210 K 210
           K
Sbjct: 200 K 200

 Score =  185 bits (469), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 93/121 (76%)

Query: 279 QAVDSMIRRAPPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTH 338
           QAV++MIRRAP RVTTAYIGNIPHFA E DLIPLLQNFGFIIDFKHY EKGCCFIKYDTH
Sbjct: 257 QAVEAMIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYAEKGCCFIKYDTH 316

Query: 339 EQAAVCIVALANFPFQGRNLRTGWGKERTSFVPMSXXXXXXXXXXXXXXEEAVPPVDMTE 398
           +QAA+CIVALANFPFQGR LRTGWGKE+ SFVP                 +AVP  D   
Sbjct: 317 DQAALCIVALANFPFQGRTLRTGWGKEKPSFVPNGAVPHAAAPAPVQPASDAVPAQDQEH 376

Query: 399 E 399
           +
Sbjct: 377 Q 377

>CAGL0H10604g Chr8 complement(1033488..1034738) [1251 bp, 416 aa]
           {ON} similar to uniprot|P32588 Saccharomyces cerevisiae
           YNL016w PUB1
          Length = 416

 Score =  296 bits (759), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 165/198 (83%)

Query: 13  VESEVPASETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIAN 72
           VE +  + E   ++PSVVPA+A KGGRETSD+VLYVGNLD SI E++LKQYFQ GGPI N
Sbjct: 27  VEGDNASQENDDDKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQN 86

Query: 73  VKIMVDKNNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVSPDEATF 132
           VKI+ D  N   NYAFVEY +SHDAN+ALQTLNG Q+EN  +KINWAF++QQ + ++ TF
Sbjct: 87  VKIIEDMKNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTF 146

Query: 133 NLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDA 192
           NLFVGDLNVDVDDETL   F+EFPT++Q HVMWDMQTG SRGYGFVSF +QEEAQKAMDA
Sbjct: 147 NLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDA 206

Query: 193 MQGHELNGRPLRINWASK 210
           MQG +L+GR +RINWA+K
Sbjct: 207 MQGKDLSGRQIRINWATK 224

 Score =  195 bits (496), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 90/93 (96%)

Query: 279 QAVDSMIRRAPPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTH 338
           QA++ MIRRAPPRVTTAYIGNIPH+A EADLIPLLQNFGFI+DF HYPEKGCCFIKYDTH
Sbjct: 301 QAIEDMIRRAPPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTH 360

Query: 339 EQAAVCIVALANFPFQGRNLRTGWGKERTSFVP 371
           EQAAVCIVALANFPFQGRNLRTGWGKERT+F+P
Sbjct: 361 EQAAVCIVALANFPFQGRNLRTGWGKERTNFMP 393

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 40/80 (50%), Gaps = 1/80 (1%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVD-KNNSNANYAFVEYFQSHDANIALQTL 104
           L+VG+L+  +++E L   F+         +M D +   +  Y FV +    +A  A+  +
Sbjct: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207

Query: 105 NGKQIENNVVKINWAFQSQQ 124
            GK +    ++INWA + ++
Sbjct: 208 QGKDLSGRQIRINWATKRER 227

>NDAI0B03440 Chr2 complement(872200..873699) [1500 bp, 499 aa] {ON}
           Anc_6.104 YBR212W
          Length = 499

 Score =  299 bits (765), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 158/186 (84%)

Query: 25  EEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNA 84
           EEP+VVPA+A  GGRETSD+VLYVGNLD SINE++LKQYFQVGG I +VKIMVDK N N 
Sbjct: 68  EEPNVVPASATHGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNQNV 127

Query: 85  NYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVD 144
           NYAFVEY +SHDAN+ALQTLNG QIEN ++KINWAFQSQQ      TFNLFVGDLN+DVD
Sbjct: 128 NYAFVEYLKSHDANVALQTLNGIQIENKIIKINWAFQSQQNLNSNDTFNLFVGDLNIDVD 187

Query: 145 DETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLR 204
           DETL + FK FP+Y+Q HVMWDMQT  SRGYGFVSF  +++AQ AMD MQG E+NGRP+R
Sbjct: 188 DETLSSNFKNFPSYIQAHVMWDMQTSRSRGYGFVSFADRDQAQNAMDTMQGKEINGRPIR 247

Query: 205 INWASK 210
           INWA+K
Sbjct: 248 INWATK 253

 Score =  200 bits (508), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 89/93 (95%)

Query: 279 QAVDSMIRRAPPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTH 338
           QAVD MIRRAPPRVTTAYIGNIPHFA EADLIPLLQ FGFI+DF HYPEKGCCFIKYDTH
Sbjct: 352 QAVDDMIRRAPPRVTTAYIGNIPHFATEADLIPLLQTFGFILDFSHYPEKGCCFIKYDTH 411

Query: 339 EQAAVCIVALANFPFQGRNLRTGWGKERTSFVP 371
           EQAAVCIVALANFPFQGRNLRTGWGKERT+F+P
Sbjct: 412 EQAAVCIVALANFPFQGRNLRTGWGKERTTFIP 444

>NCAS0B06140 Chr2 complement(1162144..1163475) [1332 bp, 443 aa]
           {ON} Anc_2.306
          Length = 443

 Score =  296 bits (759), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 141/199 (70%), Positives = 166/199 (83%), Gaps = 3/199 (1%)

Query: 15  SEVPASETIS---EEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIA 71
           SE PA+   S   +E SVVPA+A +GGRETSD+VLYVGNLD SINE++LKQYFQVGG I 
Sbjct: 51  SEAPAAGEQSAENQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQIT 110

Query: 72  NVKIMVDKNNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVSPDEAT 131
           +VKIMVDK N+N NYAF+EY +SHDAN+ALQTLNG QIE   V+INWAFQSQQ +  + T
Sbjct: 111 DVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDT 170

Query: 132 FNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMD 191
           FNLFVGDLNVDVDDETL +AF +FP+Y+Q HVMWDMQTG SRGYGFVSF  QE+AQ+AM+
Sbjct: 171 FNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMN 230

Query: 192 AMQGHELNGRPLRINWASK 210
            MQG  +NGR +RINWA+K
Sbjct: 231 VMQGMPINGRAVRINWATK 249

 Score =  196 bits (499), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 84/92 (91%), Positives = 88/92 (95%)

Query: 279 QAVDSMIRRAPPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTH 338
           QA+D MIRRAPPRVTTAYIGNIPHFA EADLIPLLQNFGFI+DF HYPEKGCCFIKYDTH
Sbjct: 311 QAIDDMIRRAPPRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTH 370

Query: 339 EQAAVCIVALANFPFQGRNLRTGWGKERTSFV 370
           EQAAVCIVALANFPFQGRNLRTGWGKER +F+
Sbjct: 371 EQAAVCIVALANFPFQGRNLRTGWGKERNTFI 402

>KNAG0A05440 Chr1 (805095..806423) [1329 bp, 442 aa] {ON} Anc_2.306
           YNL016W
          Length = 442

 Score =  296 bits (758), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 164/191 (85%)

Query: 20  SETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDK 79
           +E  ++EP VVPANA  GGRETSD+VLYVGNLD SI E+ILKQYFQV G I +VK+M+DK
Sbjct: 55  NEEANKEPPVVPANATHGGRETSDRVLYVGNLDKSITEDILKQYFQVAGQIVDVKVMIDK 114

Query: 80  NNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDL 139
            ++  NYAFVEY ++HDA++ALQTLNG QIENN VKIN AFQSQQ + D++TFNLFVGDL
Sbjct: 115 KSNYVNYAFVEYAKAHDASVALQTLNGIQIENNKVKINRAFQSQQSTTDDSTFNLFVGDL 174

Query: 140 NVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELN 199
           N+D+DD+TL  +FK+FP+Y+Q HVMWDMQTG SRGYGFVSF  QE+AQKAM+ MQG ELN
Sbjct: 175 NIDIDDDTLSRSFKDFPSYIQAHVMWDMQTGRSRGYGFVSFADQEQAQKAMEEMQGKELN 234

Query: 200 GRPLRINWASK 210
           GRP+RINWA+K
Sbjct: 235 GRPIRINWATK 245

 Score =  189 bits (480), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 86/91 (94%)

Query: 279 QAVDSMIRRAPPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTH 338
           QAVD MIRRAPPRV+TAYIGNIPHFA EADLIPLLQ+FGFI+DF HYPEKGCCFIKYDTH
Sbjct: 325 QAVDDMIRRAPPRVSTAYIGNIPHFATEADLIPLLQSFGFILDFTHYPEKGCCFIKYDTH 384

Query: 339 EQAAVCIVALANFPFQGRNLRTGWGKERTSF 369
           EQAAVCIVALANF FQGRNLRTGWGKER +F
Sbjct: 385 EQAAVCIVALANFNFQGRNLRTGWGKERNTF 415

>TPHA0C03520 Chr3 (764414..765742) [1329 bp, 442 aa] {ON} Anc_2.306
           YNL016W
          Length = 442

 Score =  295 bits (754), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 145/208 (69%), Positives = 168/208 (80%), Gaps = 4/208 (1%)

Query: 3   EQENLEQNPTVESEVPASETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQ 62
           E EN ++    ES   A+E  S+   VVPANAI GGRETSDK+LYVGNLD SINEE LKQ
Sbjct: 41  EDENQDRQKDQESVGTAAEDDSD---VVPANAINGGRETSDKILYVGNLDKSINEETLKQ 97

Query: 63  YFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQS 122
           YFQ+GGPI+NVK++ DKNNS  NYAFVEY Q HDA++A + LNGK IE  V+KINWAFQS
Sbjct: 98  YFQIGGPISNVKVINDKNNS-VNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQS 156

Query: 123 QQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGS 182
           QQ + DE+ FNLFVGDLNVDVDDETL +AF EFP+++Q HVMWDMQTG SRGYGF+SF +
Sbjct: 157 QQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSN 216

Query: 183 QEEAQKAMDAMQGHELNGRPLRINWASK 210
           QE+AQ AMD MQ  ELNGR +RINWASK
Sbjct: 217 QEDAQTAMDKMQSTELNGRQIRINWASK 244

 Score =  184 bits (466), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 86/94 (91%)

Query: 279 QAVDSMIRRAPPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTH 338
           QAVD MIRRAP RVTT YIGNIPHFA EADLIPLLQNFGFI+DFK+YPEKG CFIKYDTH
Sbjct: 311 QAVDDMIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTH 370

Query: 339 EQAAVCIVALANFPFQGRNLRTGWGKERTSFVPM 372
           EQAAVCIV LAN+PFQGRNL+TGWGKE+  F+PM
Sbjct: 371 EQAAVCIVVLANYPFQGRNLKTGWGKEKAVFIPM 404

>Kpol_1043.34 s1043 complement(70168..71496) [1329 bp, 442 aa] {ON}
           complement(70168..71496) [1329 nt, 443 aa]
          Length = 442

 Score =  293 bits (750), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 159/183 (86%), Gaps = 1/183 (0%)

Query: 28  SVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYA 87
           S+VPANAI GGRETSDK+LYVGNLD SINE+ILKQYFQVGGPI NVK++ DKNN  ANYA
Sbjct: 61  SIVPANAINGGRETSDKILYVGNLDKSINEDILKQYFQVGGPITNVKVINDKNNE-ANYA 119

Query: 88  FVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDET 147
           FVEY Q HDA+IAL+TLNGKQIENN +KINWAFQSQQ +  + TFNLF+GDLNVDVDDET
Sbjct: 120 FVEYSQHHDASIALKTLNGKQIENNTLKINWAFQSQQNTTSDETFNLFIGDLNVDVDDET 179

Query: 148 LRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINW 207
           L  AFK+F +++Q HVMWDMQTG SRGYGFVSF + ++AQ AMD MQG ELNGR LRINW
Sbjct: 180 LVAAFKDFKSFIQAHVMWDMQTGRSRGYGFVSFSNLDDAQVAMDTMQGSELNGRQLRINW 239

Query: 208 ASK 210
           ASK
Sbjct: 240 ASK 242

 Score =  187 bits (476), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 88/94 (93%)

Query: 279 QAVDSMIRRAPPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTH 338
           QAVD MIRRAP RVTT YIGNIPHFA EADLIPLLQNFGFI+DFKHYPEKG CFIKYDTH
Sbjct: 310 QAVDDMIRRAPQRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKHYPEKGNCFIKYDTH 369

Query: 339 EQAAVCIVALANFPFQGRNLRTGWGKERTSFVPM 372
           EQAAVCIV LANFPFQGRNL+TGWGKE+++F+PM
Sbjct: 370 EQAAVCIVVLANFPFQGRNLKTGWGKEKSTFMPM 403

>Kwal_27.11447 s27 complement(805408..806727) [1320 bp, 439 aa] {ON}
           YNL016W (PUB1) - poly(A)+ RNA-binding protein [contig
           27] FULL
          Length = 439

 Score =  293 bits (749), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 172/214 (80%), Gaps = 5/214 (2%)

Query: 1   MSEQENLEQNPTVESEVPASET----ISEEPSVVPANAIKGGRETSDKVLYVGNLDTSIN 56
           ++EQ+    +   E+E P+ E      + EP+V PANA +GGRETSD++LYVGNLD ++ 
Sbjct: 15  IAEQQGTAGSSQTEAEQPSQEPQTAGKAAEPAVTPANATRGGRETSDRILYVGNLDLAVT 74

Query: 57  EEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKI 116
           E++LKQYFQVGG IANVKI++DKNN  ANYAFVE+ Q HDA++A QTL+GKQIEN+V+KI
Sbjct: 75  EDMLKQYFQVGGAIANVKILMDKNNKEANYAFVEFHQPHDASVAFQTLDGKQIENHVIKI 134

Query: 117 NWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYG 176
           N+AFQSQQVS  E TFNLFVGDLNVDVDDETL N FK  PT++Q HVMWDMQTG SRGYG
Sbjct: 135 NYAFQSQQVS-SEDTFNLFVGDLNVDVDDETLANTFKHVPTFIQAHVMWDMQTGRSRGYG 193

Query: 177 FVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
           FVSFG Q +AQKAM+  QG  +NGR +RINWASK
Sbjct: 194 FVSFGEQVQAQKAMEEKQGTVVNGRAIRINWASK 227

 Score =  177 bits (448), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 84/93 (90%)

Query: 279 QAVDSMIRRAPPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTH 338
           QA+++MIR AP RVTT YIGNIPHFA E DLIPLLQNFGFI+DFKHYP++GCCFIKY TH
Sbjct: 310 QAIEAMIRSAPSRVTTVYIGNIPHFASEQDLIPLLQNFGFIVDFKHYPDRGCCFIKYGTH 369

Query: 339 EQAAVCIVALANFPFQGRNLRTGWGKERTSFVP 371
           EQAA+CI+ L NFPFQGRNLRTGWGKE+ ++VP
Sbjct: 370 EQAAICILTLGNFPFQGRNLRTGWGKEKPTYVP 402

>Ecym_3344 Chr3 (653783..655048) [1266 bp, 421 aa] {ON} similar to
           Ashbya gossypii AGR390C
          Length = 421

 Score =  285 bits (728), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 135/186 (72%), Positives = 156/186 (83%), Gaps = 1/186 (0%)

Query: 25  EEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNA 84
           ++  V P  A KGGRETSD++LYVGNLD +INE+ LKQYFQVGGPIANVK++VDKNN  A
Sbjct: 44  DQSQVTPVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA 103

Query: 85  NYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVD 144
           NYAFVEY Q HDAN+A QTL+GKQIE NV+KINWAFQSQ VS D+ TFNLFVGDLNVDVD
Sbjct: 104 NYAFVEYHQPHDANVAFQTLDGKQIEGNVIKINWAFQSQHVSSDD-TFNLFVGDLNVDVD 162

Query: 145 DETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLR 204
           DETL   FKEFP+++Q HVMWDM +G SRGYGFVSF  Q+ AQ+AM++ QG  LNGR +R
Sbjct: 163 DETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIR 222

Query: 205 INWASK 210
           INWASK
Sbjct: 223 INWASK 228

 Score =  185 bits (469), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 86/90 (95%)

Query: 282 DSMIRRAPPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQA 341
           ++MIRRAP RVTTAYIGNIPHFA E DLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQA
Sbjct: 303 EAMIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQA 362

Query: 342 AVCIVALANFPFQGRNLRTGWGKERTSFVP 371
           AVCIVALANFPFQGRNLRTGWGKE+ +F+P
Sbjct: 363 AVCIVALANFPFQGRNLRTGWGKEKPAFIP 392

>KAFR0J01260 Chr10 complement(234244..235341) [1098 bp, 365 aa] {ON}
           Anc_2.306 YNL016W
          Length = 365

 Score =  279 bits (713), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 157/196 (80%)

Query: 15  SEVPASETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVK 74
           S+   SET+    +V+PA+A +GGRETSDKVLY+GNLD SINE+ LKQYFQV G I +VK
Sbjct: 2   SDQQPSETVVPVENVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIVDVK 61

Query: 75  IMVDKNNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNL 134
           +MVDK N++ NYAF+EY  +HDAN+ALQTLNG QIEN  +KINWAFQSQ    D+ +FNL
Sbjct: 62  VMVDKKNNHVNYAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNL 121

Query: 135 FVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQ 194
           F+GDLNV+VDD TL NAFK  P +LQ HVMWDMQT  SRGYGFVSF + E AQ AMD MQ
Sbjct: 122 FIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQ 181

Query: 195 GHELNGRPLRINWASK 210
           GHE+NGR +RINWA+K
Sbjct: 182 GHEINGRAIRINWATK 197

 Score =  188 bits (478), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 81/92 (88%), Positives = 87/92 (94%)

Query: 279 QAVDSMIRRAPPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTH 338
           QAV+ MIRRAPPRVTTAYIGNIPHFA E DLIPLLQNFGFI+DF HYPEKGCCFIKYDTH
Sbjct: 246 QAVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTH 305

Query: 339 EQAAVCIVALANFPFQGRNLRTGWGKERTSFV 370
           EQAAVCIVAL+NF FQGRNLRTGWGKER++F+
Sbjct: 306 EQAAVCIVALSNFQFQGRNLRTGWGKERSTFI 337

 Score = 33.5 bits (75), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 21/46 (45%)

Query: 321 DFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKER 366
           D +    +G  F+ +DTHE A   +  +      GR +R  W  +R
Sbjct: 153 DMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 31/73 (42%), Gaps = 5/73 (6%)

Query: 296 YIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEK-----GCCFIKYDTHEQAAVCIVALAN 350
           YIGN+     E  L    Q  G I+D K   +K        FI+Y T+  A V +  L  
Sbjct: 34  YIGNLDKSINEDALKQYFQVAGQIVDVKVMVDKKNNHVNYAFIEYSTNHDANVALQTLNG 93

Query: 351 FPFQGRNLRTGWG 363
              + +N++  W 
Sbjct: 94  IQIENKNIKINWA 106

>KLLA0E08779g Chr5 (782800..784227) [1428 bp, 475 aa] {ON} similar
           to uniprot|P32588 Saccharomyces cerevisiae YNL016W PUB1
           Poly(A) RNA-binding protein abundant mRNP- component
           protein hypothesized to bind a pool of non- translatable
           mRNAs not reported to associate with polyribosomes
          Length = 475

 Score =  275 bits (702), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 155/190 (81%), Gaps = 1/190 (0%)

Query: 21  ETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKN 80
           E   E+ S  P  A +GGRE SDK+LYVGNL  SI++++LKQYFQ+GG I++VKI+ DKN
Sbjct: 74  EGDEEDDSAAPVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKN 133

Query: 81  NSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLN 140
           +   NYAFVEYF+ HDAN+A QTLNGK++E  V+KINWAFQSQQV+ DE TFNLFVGDLN
Sbjct: 134 SQECNYAFVEYFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQVNSDE-TFNLFVGDLN 192

Query: 141 VDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNG 200
           VDVDD TL   FKEFP+++Q HVMWDMQ+G SRGYGFVSFG Q++AQ AM+  QG ELNG
Sbjct: 193 VDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNG 252

Query: 201 RPLRINWASK 210
           R LRINWASK
Sbjct: 253 RALRINWASK 262

 Score =  186 bits (472), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 80/92 (86%), Positives = 87/92 (94%)

Query: 279 QAVDSMIRRAPPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTH 338
           +AV+ M+RRAPPRVTTAYIGNIPHFA E DLIPLLQNFGFIIDFKHYPEKGCCFIKYDTH
Sbjct: 345 EAVEDMMRRAPPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTH 404

Query: 339 EQAAVCIVALANFPFQGRNLRTGWGKERTSFV 370
           EQAA+CIVAL NFPFQGRNLRTGWGKE+ +F+
Sbjct: 405 EQAALCIVALTNFPFQGRNLRTGWGKEKPTFI 436

>ADR307W Chr4 (1238221..1239921) [1701 bp, 566 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR086W (NAM8)
          Length = 566

 Score = 95.9 bits (237), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 68/180 (37%), Positives = 103/180 (57%), Gaps = 12/180 (6%)

Query: 38  GRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNS---NANYAFVEYFQS 94
           G +TS   LY+G+LD S  E  +KQ +   G  ANV++ + KN+S   N+ Y FVE+  +
Sbjct: 46  GADTSSTQLYMGDLDPSWTEGDIKQIWATLGE-ANVQVKLIKNSSGGGNSGYCFVEFPSN 104

Query: 95  HDANIALQTLNGKQI---ENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNA 151
             A  AL    G  I    +  +K+NWA  S   +P  + F++FVGDL  +V +  L   
Sbjct: 105 LAATNALLK-TGLPIPVDASRTLKLNWA--SFATTPG-SEFSIFVGDLAPNVTESQLFEL 160

Query: 152 F-KEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
           F   + + L   +++D  TG S+GYGFV FG++ E Q+++  MQG  LNGR +R++  SK
Sbjct: 161 FISRYSSTLNAKIVFDQGTGVSKGYGFVKFGNEAEQQRSLLEMQGVFLNGRAIRVSTTSK 220

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 34/78 (43%)

Query: 288 APPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVA 347
           A P  TT +IG +     E +L    Q FG I+  K    KGC F++Y     A   I  
Sbjct: 277 ADPNNTTVFIGGLSSLVTEDELRAYFQPFGQIVYVKIPVGKGCGFVQYVDRSSAENAIAK 336

Query: 348 LANFPFQGRNLRTGWGKE 365
           +  FP     +R  WG+ 
Sbjct: 337 MQGFPIGNSRVRLSWGRS 354

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 5/84 (5%)

Query: 43  DKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQ 102
           +  +++G L + + E+ L+ YFQ  G I  VKI V K        FV+Y     A  A+ 
Sbjct: 281 NTTVFIGGLSSLVTEDELRAYFQPFGQIVYVKIPVGK-----GCGFVQYVDRSSAENAIA 335

Query: 103 TLNGKQIENNVVKINWAFQSQQVS 126
            + G  I N+ V+++W   ++Q +
Sbjct: 336 KMQGFPIGNSRVRLSWGRSAKQTA 359

 Score = 37.7 bits (86), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 45/87 (51%), Gaps = 8/87 (9%)

Query: 122 SQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFG 181
           SQ   P+  T  +F+G L+  V ++ LR  F+ F     G +++ ++    +G GFV + 
Sbjct: 274 SQFADPNNTT--VFIGGLSSLVTEDELRAYFQPF-----GQIVY-VKIPVGKGCGFVQYV 325

Query: 182 SQEEAQKAMDAMQGHELNGRPLRINWA 208
            +  A+ A+  MQG  +    +R++W 
Sbjct: 326 DRSSAENAIAKMQGFPIGNSRVRLSWG 352

>TPHA0B03420 Chr2 complement(794369..796108) [1740 bp, 579 aa] {ON}
           Anc_8.229 YER165W
          Length = 579

 Score = 92.8 bits (229), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 60/203 (29%), Positives = 101/203 (49%), Gaps = 4/203 (1%)

Query: 5   ENLEQNPTVESE-VPASETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQY 63
           E LE+    E+E  PA+      P+     A     +T+   LYVG LD S++E +L   
Sbjct: 10  EQLEKLNINETEGAPAASETEGTPAASETEANNSNVDTTSASLYVGELDPSVSEALLYDI 69

Query: 64  FQVGGPIANVKIMVDK-NNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQS 122
           F   GP+ ++++  D    ++  YA+V +        A++ LN   I+    +I W+ Q 
Sbjct: 70  FSPIGPVTSIRVCRDAITKTSLGYAYVNFNDHESGRTAIEKLNYSPIKGKPCRIMWS-QR 128

Query: 123 QQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGS 182
                 +   N+F+ +L+ D+D++ L + F  F   L   +  D +TG S+G+GFV F  
Sbjct: 129 DPALRKKGAGNIFIKNLHPDIDNKALHDTFSVFGNILSCKIATD-ETGKSKGFGFVHFEE 187

Query: 183 QEEAQKAMDAMQGHELNGRPLRI 205
              A +A+DA+ G  LNGR + +
Sbjct: 188 DNAAVEAVDAINGMMLNGREVYV 210

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 81/180 (45%), Gaps = 16/180 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           +YV N+D    E+     F   GPI ++ +  D       + F+ +    DA  A++ LN
Sbjct: 233 VYVKNVDVDTPEDEFTALFSKYGPITSIAMEKDSEGKFRGFGFINFENHDDAAKAVEELN 292

Query: 106 GKQIENNVVKINWAFQS----QQVSPD-EAT----------FNLFVGDLNVDVDDETLRN 150
             + +   + +  A +     Q++    EA+           NLFV +L+  +DDE L  
Sbjct: 293 DLEFKGQKLYVGRAQKKYERLQELKKQYEASRLEKLAKYQGVNLFVKNLDDSIDDEKLEA 352

Query: 151 AFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
            F  F +     VM + + G S+ +GFV F + EEA KA+       + G+PL +  A +
Sbjct: 353 EFAPFGSITSAKVMRN-EEGKSKNFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 411

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 82/170 (48%), Gaps = 6/170 (3%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           +++ NL   I+ + L   F V G I + KI  D+   +  + FV + + + A  A+  +N
Sbjct: 140 IFIKNLHPDIDNKALHDTFSVFGNILSCKIATDETGKSKGFGFVHFEEDNAAVEAVDAIN 199

Query: 106 GKQIENNVV----KINWAFQSQQVSPDEATF-NLFVGDLNVDVDDETLRNAFKEFPTYLQ 160
           G  +    V     ++   +  ++   +A F N++V +++VD  ++     F ++   + 
Sbjct: 200 GMMLNGREVYVAQHVSKKDRESKLEEVKANFTNVYVKNVDVDTPEDEFTALFSKYGP-IT 258

Query: 161 GHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
              M     G  RG+GF++F + ++A KA++ +   E  G+ L +  A K
Sbjct: 259 SIAMEKDSEGKFRGFGFINFENHDDAAKAVEELNDLEFKGQKLYVGRAQK 308

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 40/83 (48%)

Query: 128 DEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQ 187
           D  + +L+VG+L+  V +  L + F          V  D  T  S GY +V+F   E  +
Sbjct: 46  DTTSASLYVGELDPSVSEALLYDIFSPIGPVTSIRVCRDAITKTSLGYAYVNFNDHESGR 105

Query: 188 KAMDAMQGHELNGRPLRINWASK 210
            A++ +    + G+P RI W+ +
Sbjct: 106 TAIEKLNYSPIKGKPCRIMWSQR 128

>ZYRO0B11660g Chr2 (918547..920310) [1764 bp, 587 aa] {ON} highly
           similar to uniprot|P04147 Saccharomyces cerevisiae
           YER165W PAB1 Poly(A) binding protein part of the 3'-end
           RNA-processing complex mediates interactions between the
           5' cap structure and the 3' mRNA poly(A) tail involved
           in control of poly(A) tail length interacts with
           translation factor eIF-4G
          Length = 587

 Score = 92.8 bits (229), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/186 (29%), Positives = 97/186 (52%), Gaps = 4/186 (2%)

Query: 23  ISEEPSVVPANAIKGGR--ETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDK- 79
           + E P   P +     +  ETS   LYVG LD +++E +L   F   G ++++++  D  
Sbjct: 17  LQEAPQTAPTSTDSDSQKVETSTASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAI 76

Query: 80  NNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDL 139
             ++  YA+V +        A++ LN   I+    +I W+ Q       + + N+F+ +L
Sbjct: 77  TKTSLGYAYVNFNDYEAGRQAIEKLNYTPIKGQPCRIMWS-QRDPSLRKKGSGNIFIKNL 135

Query: 140 NVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELN 199
           + D+D++ L + F  F   L   +  D  TG S+G+GFV F S E A++A+DA+ G  LN
Sbjct: 136 HADIDNKALHDTFSVFGNILSCKIATDEVTGNSKGFGFVHFESDEAAREAIDAINGMLLN 195

Query: 200 GRPLRI 205
           G+ + +
Sbjct: 196 GQEVYV 201

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 81/180 (45%), Gaps = 16/180 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           +Y+ N+     E+  +++F+   P+ +V +  D       + FV Y     A  A++ LN
Sbjct: 224 VYIKNISLETPEQEFEEFFKKVAPVTSVHLEKDSEGKLRGFGFVNYETHAGAAKAVEELN 283

Query: 106 GKQIENNVVKINWA---FQSQQVSPDE------------ATFNLFVGDLNVDVDDETLRN 150
           G +     + +  A   ++ QQ    +               NLF+ +L+  +DDE LR 
Sbjct: 284 GVEFHGQQLHVGRAQKKYERQQELRRQYEQSKLEKMEKYQGVNLFIKNLDDSIDDERLRE 343

Query: 151 AFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
            F  F T     VM   + G S+G+GFV F + EEA KA+       + G+PL +  A +
Sbjct: 344 EFSPFGTITSVKVMT-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 402

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 47/89 (52%), Gaps = 2/89 (2%)

Query: 122 SQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFG 181
           SQ+V  + +T +L+VG+L+  V +  L + F    +     V  D  T  S GY +V+F 
Sbjct: 32  SQKV--ETSTASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFN 89

Query: 182 SQEEAQKAMDAMQGHELNGRPLRINWASK 210
             E  ++A++ +    + G+P RI W+ +
Sbjct: 90  DYEAGRQAIEKLNYTPIKGQPCRIMWSQR 118

>Ecym_8010 Chr8 (22168..23976) [1809 bp, 602 aa] {ON} similar to
           Ashbya gossypii ADR307W
          Length = 602

 Score = 92.8 bits (229), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 103/181 (56%), Gaps = 14/181 (7%)

Query: 38  GRETSDKVLYVGNLDTSINEEILKQ-YFQVGGPIANVKIMVDKNN---SNANYAFVEYFQ 93
           G ET+   LY+G+LD S  E  +KQ +  +G P  NV++ + KN+   +N+ Y FVE+  
Sbjct: 47  GPETTSTQLYMGDLDASWTENDIKQIWATLGEP--NVQVKLIKNSGPMNNSGYCFVEFPS 104

Query: 94  SHDANIALQTLNGKQIE---NNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRN 150
           +  A  AL    G  I    +  +K+NWA  S   +P    F++FVGDL  +V +  L  
Sbjct: 105 NLSATNALLK-TGLPIPVDPSRSLKLNWA--SFATAPG-TEFSIFVGDLAPNVSESQLFE 160

Query: 151 AF-KEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
            F   + + L   +++D  TG S+GYGFV FG++ E Q+++  MQG  LNGR +R++  S
Sbjct: 161 LFISRYSSTLNAKIVFDQVTGVSKGYGFVKFGNEAEQQRSLVEMQGVFLNGRAIRVSTTS 220

Query: 210 K 210
           K
Sbjct: 221 K 221

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%)

Query: 290 PRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALA 349
           P  TT +IG +     E +L    Q FG I+  K    KGC F++Y     A   I  + 
Sbjct: 283 PNNTTVFIGGLSSLVTEEELRAYFQPFGQIVYVKIPVGKGCGFVQYVDRSSAENAIAKMQ 342

Query: 350 NFPFQGRNLRTGWGKE 365
            FP     +R  WG+ 
Sbjct: 343 GFPIGNSRIRLSWGRS 358

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 46/92 (50%), Gaps = 5/92 (5%)

Query: 43  DKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQ 102
           +  +++G L + + EE L+ YFQ  G I  VKI V K        FV+Y     A  A+ 
Sbjct: 285 NTTVFIGGLSSLVTEEELRAYFQPFGQIVYVKIPVGK-----GCGFVQYVDRSSAENAIA 339

Query: 103 TLNGKQIENNVVKINWAFQSQQVSPDEATFNL 134
            + G  I N+ ++++W   ++Q +  +  F +
Sbjct: 340 KMQGFPIGNSRIRLSWGRSAKQAAGMQQVFAM 371

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 45/87 (51%), Gaps = 8/87 (9%)

Query: 122 SQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFG 181
           SQ   P+  T  +F+G L+  V +E LR  F+ F     G +++ ++    +G GFV + 
Sbjct: 278 SQFTDPNNTT--VFIGGLSSLVTEEELRAYFQPF-----GQIVY-VKIPVGKGCGFVQYV 329

Query: 182 SQEEAQKAMDAMQGHELNGRPLRINWA 208
            +  A+ A+  MQG  +    +R++W 
Sbjct: 330 DRSSAENAIAKMQGFPIGNSRIRLSWG 356

>Kpol_1032.49 s1032 (111076..112818) [1743 bp, 580 aa] {ON}
           (111076..112818) [1743 nt, 581 aa]
          Length = 580

 Score = 90.5 bits (223), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 59/191 (30%), Positives = 101/191 (52%), Gaps = 9/191 (4%)

Query: 16  EVPASETISEEPSVVPANAIKGGRETSDKV----LYVGNLDTSINEEILKQYFQVGGPIA 71
           E PAS+  S   S    ++   G  +   V    LYVG LD S++E +L   F   GP++
Sbjct: 19  EQPASQEESSSGSAAEVSSASNGGNSGTAVDSASLYVGELDPSVSEALLYDIFSPIGPVS 78

Query: 72  NVKIMVDK-NNSNANYAFVEYFQSHDA-NIALQTLNGKQIENNVVKINWAFQSQQVSPDE 129
           ++++  D    ++  YA+V  F  HD+  +A++ LN   I+    +I W+ +   +  + 
Sbjct: 79  SIRVCRDAVTKTSLGYAYVN-FNDHDSGKVAIEKLNYTPIKGKPCRIMWSQRDPSMRKN- 136

Query: 130 ATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKA 189
            + N+F+ +L+ D+D++ L + F  F   L   +  D +TG S+G+GFV F     A +A
Sbjct: 137 GSGNIFIKNLHADIDNKALHDTFSVFGNILSCKIATD-ETGKSKGFGFVHFEEDTAASEA 195

Query: 190 MDAMQGHELNG 200
           +DA+ G  LNG
Sbjct: 196 IDAINGMMLNG 206

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 85/180 (47%), Gaps = 16/180 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           +YV N+D    EE  ++ F+  GPI ++ +  D       + FV Y     A  A+  LN
Sbjct: 234 VYVKNVDLEATEEEFEELFKKFGPITSISMEKDSEGKFRGFGFVNYENHESAAKAVDELN 293

Query: 106 GKQIENNVVKINWA------FQSQQVSPDEATF---------NLFVGDLNVDVDDETLRN 150
             + ++  + +  A       Q  +   +EA           NLFV +L+  +DDE L+ 
Sbjct: 294 DLEFKSQKLYVGRAQKKYERLQELKKQYEEAKLEKMAKYQGVNLFVKNLDDTIDDELLKK 353

Query: 151 AFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
            F+ F T     VM + +TG S+G+GFV F S EEA +A+       + G+PL +  A +
Sbjct: 354 EFESFGTITSVKVMRN-ETGKSKGFGFVCFSSPEEATRAITEKNQQIVAGKPLYVALAQR 412

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 38/78 (48%)

Query: 133 NLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDA 192
           +L+VG+L+  V +  L + F          V  D  T  S GY +V+F   +  + A++ 
Sbjct: 52  SLYVGELDPSVSEALLYDIFSPIGPVSSIRVCRDAVTKTSLGYAYVNFNDHDSGKVAIEK 111

Query: 193 MQGHELNGRPLRINWASK 210
           +    + G+P RI W+ +
Sbjct: 112 LNYTPIKGKPCRIMWSQR 129

>KNAG0G01810 Chr7 (401679..403469) [1791 bp, 596 aa] {ON} Anc_8.229
           YER165W
          Length = 596

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 103/205 (50%), Gaps = 14/205 (6%)

Query: 5   ENL---EQNPTVESEVPASETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILK 61
           ENL   E+ P  E+  PAS   SE           G  + +   LYVG LD S++E +L 
Sbjct: 13  ENLKISEEQPQQEA-TPASTASSESQQA-------GDNDVTSTSLYVGELDPSVSEALLY 64

Query: 62  QYFQVGGPIANVKIMVDK-NNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAF 120
             F   G +A++++  D    ++  YA+V +        A++ LN   I+  + +I W+ 
Sbjct: 65  DLFSPIGSVASIRVCRDAITKTSLGYAYVNFSDHEAGKQAIEKLNYTPIKGKLCRIMWS- 123

Query: 121 QSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSF 180
           Q       +   N+F+ +LN D+D++ L + F  F   L   +  D +TG S+G+GFV F
Sbjct: 124 QRDPSLRKKGHGNIFIKNLNQDIDNKALFDTFSVFGNILSSKIATD-ETGKSKGFGFVHF 182

Query: 181 GSQEEAQKAMDAMQGHELNGRPLRI 205
             +  A +A+DA+ G  LNG+ + +
Sbjct: 183 EEESAANEAIDALNGMLLNGQEIYV 207

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 83/180 (46%), Gaps = 16/180 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           +YV N+D    +E  K++F   G + +V +    +     + FV Y   +DA  A++ LN
Sbjct: 230 VYVKNIDLETTDEEFKEFFGKIGTVTSVALERGPDGKLKGFGFVNYEDHNDAVKAVEELN 289

Query: 106 GKQIENNVVKINWA------FQSQQVSPDEATF---------NLFVGDLNVDVDDETLRN 150
           G + ++  + +  A       QS +   +             NLFV +L+  +DDE L+ 
Sbjct: 290 GAEFKDQELFVGRAQKKYERIQSLKKQYESTRLEKMAKYQGVNLFVKNLDDSIDDEKLQE 349

Query: 151 AFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
            F  F       VM   + G S+G+GFV F S EEA KA+       + G+PL +  A +
Sbjct: 350 EFAPFGNITSVKVMR-TENGKSKGFGFVCFSSPEEATKAITEKNQQIVAGKPLYVAIAQR 408

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 46/91 (50%), Gaps = 1/91 (1%)

Query: 121 QSQQVSPDEAT-FNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVS 179
           +SQQ   ++ T  +L+VG+L+  V +  L + F    +     V  D  T  S GY +V+
Sbjct: 35  ESQQAGDNDVTSTSLYVGELDPSVSEALLYDLFSPIGSVASIRVCRDAITKTSLGYAYVN 94

Query: 180 FGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
           F   E  ++A++ +    + G+  RI W+ +
Sbjct: 95  FSDHEAGKQAIEKLNYTPIKGKLCRIMWSQR 125

>TBLA0F03780 Chr6 (933778..935511) [1734 bp, 577 aa] {ON} Anc_8.229
           YER165W
          Length = 577

 Score = 89.4 bits (220), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 57/186 (30%), Positives = 101/186 (54%), Gaps = 7/186 (3%)

Query: 25  EEPSVVPAN-AIKGGRETSDKV---LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDK- 79
           E+P+  PA  AI+      + V   LYVG LD S++E +L   F   G ++++++  D  
Sbjct: 20  EQPAATPATTAIEAESPNVENVTASLYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAI 79

Query: 80  NNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDL 139
             ++  YA+V +        A++ LN   I+    +I W+ Q       + + N+F+ +L
Sbjct: 80  TKTSLGYAYVNFNDHEAGKTAIEKLNYTAIKGRPCRIMWS-QRDPSMRKKGSGNIFIKNL 138

Query: 140 NVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELN 199
           + D+D++TL   F  F   L   +  D +TG S+G+GFV F ++E A++A+DA+ G  LN
Sbjct: 139 HPDIDNKTLYETFSVFGNILSCKIAND-ETGKSKGFGFVHFENEEAAREAIDAINGMLLN 197

Query: 200 GRPLRI 205
           G+ + +
Sbjct: 198 GQEVYV 203

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 83/180 (46%), Gaps = 16/180 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           +YV NLD    EE  +  F+  G I +V +  D    +  + FV++    DA  A++ LN
Sbjct: 226 VYVKNLDLEATEEDFENLFKPYGTITSVALEKDAEGKSRGFGFVDFENHEDAVKAVEALN 285

Query: 106 GKQIENNVVKINWA-------------FQSQQVSP--DEATFNLFVGDLNVDVDDETLRN 150
             + +   + +  A             +Q+ ++         NLF+ +L+  +DDE L+ 
Sbjct: 286 DTEYKGQTLYVGRAQKKYERLQELKKQYQASKLEKLAKYQGINLFIKNLDDSIDDEKLKE 345

Query: 151 AFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
            F  F T     VM   + G S+G+GFV F + EEA +A+       + G+PL +  A +
Sbjct: 346 EFAPFGTITSARVMR-TENGKSKGFGFVCFSTPEEATRAITEKNQQIVAGKPLYVAIAQR 404

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 88/177 (49%), Gaps = 6/177 (3%)

Query: 39  RETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDAN 98
           R+     +++ NL   I+ + L + F V G I + KI  D+   +  + FV +     A 
Sbjct: 126 RKKGSGNIFIKNLHPDIDNKTLYETFSVFGNILSCKIANDETGKSKGFGFVHFENEEAAR 185

Query: 99  IALQTLNGKQIENNVVKI--NWAFQSQQVSPDEAT---FNLFVGDLNVDVDDETLRNAFK 153
            A+  +NG  +    V +  + + + +Q   DEA     N++V +L+++  +E   N FK
Sbjct: 186 EAIDAINGMLLNGQEVYVAPHVSKKDRQSKLDEARANFTNVYVKNLDLEATEEDFENLFK 245

Query: 154 EFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
            + T     +  D + G SRG+GFV F + E+A KA++A+   E  G+ L +  A K
Sbjct: 246 PYGTITSVALEKDAE-GKSRGFGFVDFENHEDAVKAVEALNDTEYKGQTLYVGRAQK 301

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 52/110 (47%)

Query: 101 LQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQ 160
           L+ LN +  +        A +++  + +  T +L+VG+L+  V +  L + F    +   
Sbjct: 12  LEKLNIQDEQPAATPATTAIEAESPNVENVTASLYVGELDPSVSEALLYDIFSPIGSVSS 71

Query: 161 GHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
             V  D  T  S GY +V+F   E  + A++ +    + GRP RI W+ +
Sbjct: 72  IRVCRDAITKTSLGYAYVNFNDHEAGKTAIEKLNYTAIKGRPCRIMWSQR 121

>TDEL0E02450 Chr5 complement(475232..476650) [1419 bp, 472 aa] {ON}
           Anc_5.382 YHR086W
          Length = 472

 Score = 88.6 bits (218), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 60/181 (33%), Positives = 96/181 (53%), Gaps = 12/181 (6%)

Query: 38  GRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNAN------YAFVEY 91
           G ++ +  LY+G+LD S +E +++  +   G  +NV+I +  NN NA       Y FV++
Sbjct: 42  GSQSRNNQLYMGDLDPSWDENVIRSIWNSLGE-SNVEIKLMWNNRNAGVRTHLGYCFVQF 100

Query: 92  FQSHDANIALQTLNGKQIE---NNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETL 148
                A+ AL   NG  I    +  +++NW+  S   +      ++FVGDL  +V +  L
Sbjct: 101 SSRSQASNALLK-NGMAIPGYPSKTLRLNWSSASGNSADGSNEISVFVGDLAPNVTESDL 159

Query: 149 RNAF-KEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINW 207
              F  + P+     VM+D  TG S+GY FV FG+QE+ Q+A+  M G  L GR +R+  
Sbjct: 160 FELFISKCPSTSNAKVMYDQVTGVSKGYAFVRFGNQEDQQRALQEMTGTFLKGRAIRVGS 219

Query: 208 A 208
           A
Sbjct: 220 A 220

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 36/72 (50%)

Query: 293 TTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 352
           TT ++ ++ H   E +L    Q FG +I  K    K C F++Y     A + I+ L  FP
Sbjct: 279 TTLFVSSLSHMVTENELKAFFQPFGNVIYAKLPENKQCGFVQYVDRASAEMAILKLQGFP 338

Query: 353 FQGRNLRTGWGK 364
            +G  ++  WG+
Sbjct: 339 IRGSRIKISWGR 350

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 55/237 (23%), Positives = 90/237 (37%), Gaps = 57/237 (24%)

Query: 20  SETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGP-IANVKIMVD 78
           S+T+    S    N+  G  E S   ++VG+L  ++ E  L + F    P  +N K+M D
Sbjct: 122 SKTLRLNWSSASGNSADGSNEIS---VFVGDLAPNVTESDLFELFISKCPSTSNAKVMYD 178

Query: 79  K-NNSNANYAFVEYFQSHDANIALQTL-----------------------NGKQIENNVV 114
           +    +  YAFV +    D   ALQ +                       NG  +EN + 
Sbjct: 179 QVTGVSKGYAFVRFGNQEDQQRALQEMTGTFLKGRAIRVGSAGHQNQRNRNGPGLENKLK 238

Query: 115 KINWAFQS------------------QQVSP-----DEATFNLFVGDLNVDVDDETLRNA 151
            +N    S                  QQ+ P     D     LFV  L+  V +  L+  
Sbjct: 239 GLNATVSSPKPANISSTNFSQFILPTQQLPPLNSFTDRNNTTLFVSSLSHMVTENELKAF 298

Query: 152 FKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWA 208
           F+ F   +   +  + Q G      FV +  +  A+ A+  +QG  + G  ++I+W 
Sbjct: 299 FQPFGNVIYAKLPENKQCG------FVQYVDRASAEMAILKLQGFPIRGSRIKISWG 349

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 51/117 (43%), Gaps = 15/117 (12%)

Query: 10  NPTVESEVPA-------SETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQ 62
           N TV S  PA       S+ I     + P N+     + ++  L+V +L   + E  LK 
Sbjct: 241 NATVSSPKPANISSTNFSQFILPTQQLPPLNSFT---DRNNTTLFVSSLSHMVTENELKA 297

Query: 63  YFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWA 119
           +FQ   P  NV  +  K   N    FV+Y     A +A+  L G  I  + +KI+W 
Sbjct: 298 FFQ---PFGNV--IYAKLPENKQCGFVQYVDRASAEMAILKLQGFPIRGSRIKISWG 349

>CAGL0L11792g Chr12 (1261571..1263310) [1740 bp, 579 aa] {ON} highly
           similar to uniprot|P04147 Saccharomyces cerevisiae
           YER165w PAB1 mRNA polyadenylate-binding protein
          Length = 579

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 55/168 (32%), Positives = 93/168 (55%), Gaps = 5/168 (2%)

Query: 40  ETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDK-NNSNANYAFVEYFQSHDA- 97
           ET    LYVG+LD S++E  L   F   G ++++++  D    ++  YA+V  F  HDA 
Sbjct: 31  ETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVN-FNDHDAA 89

Query: 98  NIALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPT 157
             A++ LN   I+  + +I W+ +   +    A  N+F+ +L+ D+D++ L + F  F  
Sbjct: 90  KTAIEKLNFTPIKGKLCRIMWSQRDPSLRKKGAG-NIFIKNLHPDIDNKALYDTFSVFGN 148

Query: 158 YLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRI 205
            L   V  D +TG S+G+G+V F   E A +A+DA+ G  LNG+ + +
Sbjct: 149 ILSSKVATD-ETGKSKGFGYVHFEEDESASEAIDALNGMLLNGQEIYV 195

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 81/180 (45%), Gaps = 16/180 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           +Y+ N++T   ++  ++     G   +V +       N  + FV +    DA   ++ LN
Sbjct: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELN 277

Query: 106 GKQIENNVVKINWA---FQSQQVSPD--EAT----------FNLFVGDLNVDVDDETLRN 150
             + +   + +N A   ++ QQ      EAT           NLF+ +L+  +DD+ L  
Sbjct: 278 NTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEE 337

Query: 151 AFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
            F  + T     VM   + G S+G+GFV F + EEA KA+       + G+PL +  A +
Sbjct: 338 EFAPYGTITSAKVMT-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 396

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 80/170 (47%), Gaps = 6/170 (3%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           +++ NL   I+ + L   F V G I + K+  D+   +  + +V + +   A+ A+  LN
Sbjct: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFEEDESASEAIDALN 184

Query: 106 GKQIENNVVKINWAFQSQQVSPD----EATF-NLFVGDLNVDVDDETLRNAFKEFPTYLQ 160
           G  +    + +      ++        +A F N+++ ++N +  D+       +F     
Sbjct: 185 GMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFGK-TD 243

Query: 161 GHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
             V+     G ++G+GFV+F + E+A K ++ +   E  G+PL +N A K
Sbjct: 244 SVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQK 293

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 55/114 (48%), Gaps = 2/114 (1%)

Query: 97  ANIALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFP 156
           A+I  +T   +Q+EN  ++      +++   +  + +L+VGDL+  V +  L + F    
Sbjct: 2   ADITEKT--AEQLENLSLQDKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIG 59

Query: 157 TYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
                 V  D  T  S GY +V+F   + A+ A++ +    + G+  RI W+ +
Sbjct: 60  AVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQR 113

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 32/71 (45%), Gaps = 5/71 (7%)

Query: 293 TTAYIGNIPHFAIEADLIPLLQNFGFI--IDFKHYPE---KGCCFIKYDTHEQAAVCIVA 347
           T  YI NI     + +   L+  FG    +  +  PE   KG  F+ +  HE A  C+  
Sbjct: 216 TNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEE 275

Query: 348 LANFPFQGRNL 358
           L N  F+G+ L
Sbjct: 276 LNNTEFKGQPL 286

>NDAI0C06100 Chr3 (1406421..1408178) [1758 bp, 585 aa] {ON} 
          Length = 585

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 94/181 (51%), Gaps = 3/181 (1%)

Query: 24  SEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDK-NNS 82
           S+E     +       E S   LYVG+LD S++E +L   F   G ++++++  D    +
Sbjct: 20  SQEQQTATSTPSSATTENSSASLYVGDLDPSVSEALLYDIFSPIGSVSSIRVCRDAITKT 79

Query: 83  NANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVD 142
           +  YA+V +        A++ LN   I+  + +I W+ Q       + + N+F+ +L+ D
Sbjct: 80  SLGYAYVNFNDHEAGKKAIEKLNYTPIKGRLCRIMWS-QRDPALRKKGSANIFIKNLHSD 138

Query: 143 VDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRP 202
           +D++ L + F  F   L   +  D +TG S+G+GFV F     A++A+DA+ G  LNG+ 
Sbjct: 139 IDNKALYDTFSVFGNILSSKIATD-ETGKSKGFGFVHFEDDTAAKEAIDALNGMLLNGQE 197

Query: 203 L 203
           +
Sbjct: 198 I 198

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 84/180 (46%), Gaps = 16/180 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           +YV N++    +E   + F   G + +  +   ++     + FV++    DA  A++ LN
Sbjct: 223 IYVKNINLETTDEEFTELFSKYGKVLSAALEKTEDGKLKGFGFVDFENHEDAAKAVEELN 282

Query: 106 GKQIENNVVKINWAFQSQQVSPD-----EAT----------FNLFVGDLNVDVDDETLRN 150
           G Q ++  + ++ A +  +   +     EA+           NLF+ +L+  +DDE L+ 
Sbjct: 283 GSQFKDQELFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFIKNLDDSIDDEKLKE 342

Query: 151 AFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
            F  +       VM   + G SRG+GFV F + EEA KA+       + G+PL +  A +
Sbjct: 343 EFAPYGNITSVRVMR-TENGKSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 43/86 (50%)

Query: 125 VSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQE 184
            + + ++ +L+VGDL+  V +  L + F    +     V  D  T  S GY +V+F   E
Sbjct: 33  ATTENSSASLYVGDLDPSVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHE 92

Query: 185 EAQKAMDAMQGHELNGRPLRINWASK 210
             +KA++ +    + GR  RI W+ +
Sbjct: 93  AGKKAIEKLNYTPIKGRLCRIMWSQR 118

>TDEL0A01350 Chr1 complement(240288..242054) [1767 bp, 588 aa] {ON}
           Anc_8.229 YER165W
          Length = 588

 Score = 88.2 bits (217), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 90/167 (53%), Gaps = 3/167 (1%)

Query: 40  ETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDK-NNSNANYAFVEYFQSHDAN 98
           ETS   LYVG LD S++E +L   F   G ++++++  D    ++  YA+V +       
Sbjct: 38  ETSSASLYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGK 97

Query: 99  IALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTY 158
            A++ LN   I+    +I W+ Q       + + N+F+ +L+ D+D++ L + F  F   
Sbjct: 98  TAIEKLNYAPIKGVPCRIMWS-QRDPSMRKKGSGNIFIKNLHPDIDNKALHDTFSVFGNI 156

Query: 159 LQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRI 205
           L   +  D + G SRG+GFV F   E A++A+DA+ G  LNG+ + +
Sbjct: 157 LSCKIATD-EAGNSRGFGFVHFEDDEAAKEAIDAINGMLLNGQEVYV 202

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 80/180 (44%), Gaps = 16/180 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           +YV N+     +E  +++F   GPI +  +  D       + FV Y   +DA  A++ LN
Sbjct: 225 VYVKNIHPDTGDEEFEEFFTKVGPITSAHLEKDNEGKLRGFGFVNYENHNDAAKAVEELN 284

Query: 106 GKQIENNVVKINWAFQS----QQVSPDEATF-----------NLFVGDLNVDVDDETLRN 150
               +   + +  A +     Q++      F           NLFV +L+  +DD+ L  
Sbjct: 285 ETDFKGQTLHVGRAQKKHERLQELKKQYEAFRLEKLEKYQGVNLFVKNLDDTIDDQKLEE 344

Query: 151 AFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
            F  + T     VM   + G S+G+GFV F + EEA KA+       + G+PL +  A +
Sbjct: 345 EFAPYGTITSVKVMRS-ENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 403

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 44/90 (48%), Gaps = 2/90 (2%)

Query: 121 QSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSF 180
           +SQ+V    A+  L+VG+L+  V +  L + F    +     V  D  T  S GY +V+F
Sbjct: 33  ESQKVETSSAS--LYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNF 90

Query: 181 GSQEEAQKAMDAMQGHELNGRPLRINWASK 210
              E  + A++ +    + G P RI W+ +
Sbjct: 91  NDHEAGKTAIEKLNYAPIKGVPCRIMWSQR 120

>Ecym_5562 Chr5 (1143566..1145308) [1743 bp, 580 aa] {ON} similar to
           Ashbya gossypii AGR122C
          Length = 580

 Score = 87.4 bits (215), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 102/204 (50%), Gaps = 14/204 (6%)

Query: 5   ENLEQNPTVESEVPASETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYF 64
           E LEQ    E   P + T SE P V          ETS   LYVG LD S++E +L   F
Sbjct: 10  EQLEQLKIEEQTAPTT-TESETPKV----------ETSGASLYVGELDPSVSEALLYDIF 58

Query: 65  QVGGPIANVKIMVDK-NNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQ 123
              G ++++++  D   N++  YA+V +        A++ LN   I+    +I W+ Q  
Sbjct: 59  SPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGRKAIEQLNYTLIKGKPCRIMWS-QRD 117

Query: 124 QVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQ 183
                + + N+++ +L+  +D+++L   F  F   L   V  D   G SRG+GFV F ++
Sbjct: 118 PSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATD-DNGVSRGFGFVHFENE 176

Query: 184 EEAQKAMDAMQGHELNGRPLRINW 207
            +A+ A++A+ G  +N + + + W
Sbjct: 177 SDARDAIEAVNGMLMNDQEVYVAW 200

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 79/180 (43%), Gaps = 16/180 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           +YV N+D   ++E  +Q F   G I +  +  D       + F+ +     A  A+  LN
Sbjct: 221 IYVKNIDLETSQEEFEQLFSKYGKITSAVLEKDSEGKLRGFGFINFEDHSTAARAVDELN 280

Query: 106 GKQIENNVVKINWAFQS----QQVSPDEAT-----------FNLFVGDLNVDVDDETLRN 150
                   + +  A +     Q++     T            NLF+ +L+  +DDE L++
Sbjct: 281 ESDFRGQTLYVGRAQKKHERQQELKKQYETARLEKLAKYQGVNLFIKNLDDSIDDEKLKD 340

Query: 151 AFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
            F  F T     VM D + G SRG+GFV F + EEA KA+       + G+PL +  A +
Sbjct: 341 EFAPFGTITSVKVMKD-EAGSSRGFGFVCFSTPEEATKAITEKNQQLVAGKPLYVAIAQR 399

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 83/177 (46%), Gaps = 6/177 (3%)

Query: 39  RETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDAN 98
           R+     +Y+ NL  +I+ + L + F   G I + K+  D N  +  + FV +    DA 
Sbjct: 121 RKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDDNGVSRGFGFVHFENESDAR 180

Query: 99  IALQTLNGKQIENNVVKINWAFQSQ----QVSPDEATF-NLFVGDLNVDVDDETLRNAFK 153
            A++ +NG  + +  V + W    +    ++   +A F N++V +++++   E     F 
Sbjct: 181 DAIEAVNGMLMNDQEVYVAWHVSKKDRQSKLEEVKAKFTNIYVKNIDLETSQEEFEQLFS 240

Query: 154 EFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
           ++   +   V+     G  RG+GF++F     A +A+D +   +  G+ L +  A K
Sbjct: 241 KYGK-ITSAVLEKDSEGKLRGFGFINFEDHSTAARAVDELNESDFRGQTLYVGRAQK 296

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%)

Query: 133 NLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDA 192
           +L+VG+L+  V +  L + F    +     V  D  T  S GY +V+F   E  +KA++ 
Sbjct: 39  SLYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGRKAIEQ 98

Query: 193 MQGHELNGRPLRINWASK 210
           +    + G+P RI W+ +
Sbjct: 99  LNYTLIKGKPCRIMWSQR 116

>Kwal_55.20154 s55 complement(274557..276125) [1569 bp, 522 aa] {ON}
           YHR086W (NAM8) - putative RNA binding protein, involved
           in meiosis-specific splicing of the REC107 transcripts
           in cooperation with the Mer1 protein [contig 153] FULL
          Length = 522

 Score = 86.7 bits (213), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 59/179 (32%), Positives = 98/179 (54%), Gaps = 11/179 (6%)

Query: 39  RETSDKVLYVGNLDTSINEEILKQ-YFQVGGPIANVKIMVDKNN--SNANYAFVEYFQSH 95
             T    LY+G+LD + +E  ++  +  +G P   +K++    +   N+ Y FVE+    
Sbjct: 40  HSTRSNSLYMGDLDPNWDEAAIRAVWATLGEPNVQIKLIRSSGSPGHNSGYCFVEFPSHT 99

Query: 96  DANIALQTLNGKQIENN---VVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAF 152
           +A+ AL   NG  I N    ++K+NWA  S   +P    +++FVGD+  +V +  L   F
Sbjct: 100 NASNALLK-NGLVIPNTGNRILKLNWA--SFATTPGNE-YSVFVGDVAPNVTEAQLFELF 155

Query: 153 -KEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
              + + L   +++D  TG S+GYGFV FG + E Q+++  MQG  LNGR +R++  SK
Sbjct: 156 ISRYASTLNAKIVFDQMTGVSKGYGFVKFGQESEQQRSLLEMQGVFLNGRAIRVSTTSK 214

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 36/83 (43%)

Query: 283 SMIRRAPPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAA 342
           ++ +   P  TT +IG +     E +L    Q FG I+  K    KGC F++Y     A 
Sbjct: 263 TLTQYTDPNNTTVFIGGLSSLVTEDELRAFFQPFGSIVYVKIPVGKGCGFVQYVDRLSAE 322

Query: 343 VCIVALANFPFQGRNLRTGWGKE 365
             I  +  FP     +R  WG+ 
Sbjct: 323 TAIAKMQGFPIGNSRIRLSWGRS 345

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 43/84 (51%), Gaps = 5/84 (5%)

Query: 43  DKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQ 102
           +  +++G L + + E+ L+ +FQ  G I  VKI V K        FV+Y     A  A+ 
Sbjct: 272 NTTVFIGGLSSLVTEDELRAFFQPFGSIVYVKIPVGK-----GCGFVQYVDRLSAETAIA 326

Query: 103 TLNGKQIENNVVKINWAFQSQQVS 126
            + G  I N+ ++++W   ++Q +
Sbjct: 327 KMQGFPIGNSRIRLSWGRSAKQAA 350

 Score = 37.0 bits (84), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 45/87 (51%), Gaps = 8/87 (9%)

Query: 122 SQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFG 181
           +Q   P+  T  +F+G L+  V ++ LR  F+ F     G +++ ++    +G GFV + 
Sbjct: 265 TQYTDPNNTT--VFIGGLSSLVTEDELRAFFQPF-----GSIVY-VKIPVGKGCGFVQYV 316

Query: 182 SQEEAQKAMDAMQGHELNGRPLRINWA 208
            +  A+ A+  MQG  +    +R++W 
Sbjct: 317 DRLSAETAIAKMQGFPIGNSRIRLSWG 343

>SAKL0G08118g Chr7 complement(689908..691545) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q759G9 Ashbya gossypii ADR307W
           ADR307Wp and some similarites with YHR086W
           uniprot|Q00539 Saccharomyces cerevisiae YHR086W NAM8 RNA
           binding protein component of the U1 snRNP protein
           mutants are defective in meiotic recombination and in
           formation of viable spores involved in the formation of
           DSBs through meiosis-specific splicing of MER2 pre-mRNA
          Length = 545

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 60/173 (34%), Positives = 97/173 (56%), Gaps = 13/173 (7%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKN----NSNANYAFVEYFQSHDANIAL 101
           LY+G+LD S +E  +K  +   G   N+ + + +N     +N+ + FVE+    +A+ AL
Sbjct: 57  LYMGDLDPSWDESSIKSIWSSLGE-QNILVKLIRNAGTTTTNSGFCFVEFPSHLNASNAL 115

Query: 102 QTLNGKQIENNV---VKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAF-KEFPT 157
              NG  + N V   +K+NWA  S   +P    +++FVGDL  +V +  L   F   + +
Sbjct: 116 LK-NGLPVPNAVNKFLKLNWA--SISTTPGNE-YSIFVGDLAPNVTEAQLFELFISRYSS 171

Query: 158 YLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
            L   +++D  TG S+GYGFV FG++ E  +A+  MQG  LNGR +R++  SK
Sbjct: 172 TLNSKIVFDQLTGVSKGYGFVKFGNEAEQHRALLEMQGVFLNGRAIRVSTTSK 224

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%)

Query: 290 PRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALA 349
           P  TT +IG +     E +L    Q FG I+  K    KGC F++Y     A   I  + 
Sbjct: 278 PNNTTVFIGGLSSLVTEDELRTYFQPFGSIVYVKIPVGKGCGFVQYIDRISAETAIAKMQ 337

Query: 350 NFPFQGRNLRTGWGKE 365
            FP     +R  WG+ 
Sbjct: 338 GFPIGNSRIRLSWGRS 353

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 43/84 (51%), Gaps = 5/84 (5%)

Query: 43  DKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQ 102
           +  +++G L + + E+ L+ YFQ  G I  VKI V K        FV+Y     A  A+ 
Sbjct: 280 NTTVFIGGLSSLVTEDELRTYFQPFGSIVYVKIPVGK-----GCGFVQYIDRISAETAIA 334

Query: 103 TLNGKQIENNVVKINWAFQSQQVS 126
            + G  I N+ ++++W   ++Q +
Sbjct: 335 KMQGFPIGNSRIRLSWGRSAKQTA 358

 Score = 37.0 bits (84), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 44/86 (51%), Gaps = 8/86 (9%)

Query: 123 QQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGS 182
           Q   P+  T  +F+G L+  V ++ LR  F+ F     G +++ ++    +G GFV +  
Sbjct: 274 QFTDPNNTT--VFIGGLSSLVTEDELRTYFQPF-----GSIVY-VKIPVGKGCGFVQYID 325

Query: 183 QEEAQKAMDAMQGHELNGRPLRINWA 208
           +  A+ A+  MQG  +    +R++W 
Sbjct: 326 RISAETAIAKMQGFPIGNSRIRLSWG 351

>KLLA0C17600g Chr3 (1553322..1555100) [1779 bp, 592 aa] {ON} similar
           to uniprot|P04147 Saccharomyces cerevisiae YER165W PAB1
           Poly(A) binding protein part of the 3'-end
           RNA-processing complex mediates interactions between the
           5' cap structure and the 3' mRNA poly(A) tail involved
           in control of poly(A) tail length interacts with
           translation factor eIF-4G
          Length = 592

 Score = 85.5 bits (210), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 86/162 (53%), Gaps = 3/162 (1%)

Query: 40  ETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDK-NNSNANYAFVEYFQSHDAN 98
           E ++  LYVG LD +I E +L   F   GPI+++++  D    ++  YA+V Y       
Sbjct: 46  ENNNASLYVGELDPNITEALLYDVFSPLGPISSIRVCRDAVTKASLGYAYVNYTDYEAGK 105

Query: 99  IALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTY 158
            A+Q LN  +I     +I W+ +   +   + + N+F+ +L+  +D++ L   F  F   
Sbjct: 106 KAIQELNYAEINGRPCRIMWSERDPAIR-KKGSGNIFIKNLHPAIDNKALHETFSTFGEV 164

Query: 159 LQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNG 200
           L   V  D + G SRG+GFV F  + +A+ A++A+ G  +NG
Sbjct: 165 LSCKVALD-ENGNSRGFGFVHFKEESDAKDAIEAVNGMLMNG 205

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 55/180 (30%), Positives = 86/180 (47%), Gaps = 16/180 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           +YV N+D    +E  +Q F   G I +  +  D       + FV +   + A  A++ LN
Sbjct: 233 IYVKNIDVETTDEEFEQLFSQYGEIVSAALEKDAEGKPKGFGFVNFVDHNAAAKAVEELN 292

Query: 106 GKQIENNVVKINWA-----------FQSQQVSPDE-ATF---NLFVGDLNVDVDDETLRN 150
           GK+ ++  + +  A            Q +Q   ++ A F   NLF+ +L+  +DDE L+ 
Sbjct: 293 GKEFKSQALYVGRAQKKYERAEELKKQYEQYRLEKLAKFQGVNLFIKNLDDSIDDEKLKE 352

Query: 151 AFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
            F  + T     VM D Q G S+G+GFV F S EEA KAM       + G+PL +  A +
Sbjct: 353 EFAPYGTITSARVMRD-QEGNSKGFGFVCFSSPEEATKAMTEKNQQIVAGKPLYVAIAQR 411

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 87/177 (49%), Gaps = 6/177 (3%)

Query: 39  RETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDAN 98
           R+     +++ NL  +I+ + L + F   G + + K+ +D+N ++  + FV + +  DA 
Sbjct: 133 RKKGSGNIFIKNLHPAIDNKALHETFSTFGEVLSCKVALDENGNSRGFGFVHFKEESDAK 192

Query: 99  IALQTLNGKQIENNVVKINWAFQSQ----QVSPDEATF-NLFVGDLNVDVDDETLRNAFK 153
            A++ +NG  +    V +      +    ++   +A F N++V +++V+  DE     F 
Sbjct: 193 DAIEAVNGMLMNGLEVYVAMHVPKKDRISKLEEAKANFTNIYVKNIDVETTDEEFEQLFS 252

Query: 154 EFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
           ++   +   +  D + G  +G+GFV+F     A KA++ + G E   + L +  A K
Sbjct: 253 QYGEIVSAALEKDAE-GKPKGFGFVNFVDHNAAAKAVEELNGKEFKSQALYVGRAQK 308

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 41/78 (52%)

Query: 133 NLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDA 192
           +L+VG+L+ ++ +  L + F          V  D  T  S GY +V++   E  +KA+  
Sbjct: 51  SLYVGELDPNITEALLYDVFSPLGPISSIRVCRDAVTKASLGYAYVNYTDYEAGKKAIQE 110

Query: 193 MQGHELNGRPLRINWASK 210
           +   E+NGRP RI W+ +
Sbjct: 111 LNYAEINGRPCRIMWSER 128

>NCAS0A03680 Chr1 complement(738305..740032) [1728 bp, 575 aa] {ON}
           Anc_8.229
          Length = 575

 Score = 84.7 bits (208), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 88/161 (54%), Gaps = 3/161 (1%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDK-NNSNANYAFVEYFQSHDANIALQTL 104
           LYVG LD +++E +L   F   G ++++++  D    ++  YA+V +        A++ L
Sbjct: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96

Query: 105 NGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVM 164
           N   I+  + +I W+ Q       + + N+F+ +L+ D+D++ L   F  F   L   + 
Sbjct: 97  NYTPIKGRLCRIMWS-QRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIA 155

Query: 165 WDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRI 205
            D +TG S+G+GFV F  +  A++A+DA+ G  LNG+ + +
Sbjct: 156 TD-ETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYV 195

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 82/177 (46%), Gaps = 6/177 (3%)

Query: 39  RETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDAN 98
           R+     +++ NL   I+ + L + F V G I + KI  D+   +  + FV +     A 
Sbjct: 118 RKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAK 177

Query: 99  IALQTLNGKQIENNVV----KINWAFQSQQVSPDEATF-NLFVGDLNVDVDDETLRNAFK 153
            A+  LNG  +    +     +    +  Q+   +A F N++V ++N++  DE     F 
Sbjct: 178 EAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFA 237

Query: 154 EFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
           ++   L    +   + G  +G+GFV F   E+A KA++ + G E   + L ++ A K
Sbjct: 238 KYGNVLSSS-LEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQK 293

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 85/180 (47%), Gaps = 16/180 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           +YV N++    +E   + F   G + +  +   ++     + FV++ +  DA  A++ LN
Sbjct: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELN 277

Query: 106 GKQIENNVVKINWAFQSQQVSPD-----EAT----------FNLFVGDLNVDVDDETLRN 150
           G + ++  + ++ A +  +   +     EA+           NLFV +L+  +DDE L+ 
Sbjct: 278 GTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKE 337

Query: 151 AFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
            F  + T     VM     G S+G+GFV F + EEA KA+       + G+PL +  A +
Sbjct: 338 EFAPYGTITSVRVMR-TDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 396

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 39/78 (50%)

Query: 133 NLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDA 192
           +L+VG+L+  V +  L + F    +     V  D  T  S GY +V+F   E  +KA++ 
Sbjct: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95

Query: 193 MQGHELNGRPLRINWASK 210
           +    + GR  RI W+ +
Sbjct: 96  LNYTPIKGRLCRIMWSQR 113

>CAGL0H02123g Chr8 complement(188454..190121) [1668 bp, 555 aa] {ON}
           similar to uniprot|Q00539 Saccharomyces cerevisiae
           YHR086w NAM8 meiotic recombination protein
          Length = 555

 Score = 84.3 bits (207), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 98/191 (51%), Gaps = 21/191 (10%)

Query: 38  GRETSDKVLYVGNLDTSINEEILKQ-YFQVGGPIANVKIM----VDKNNSNANYAFVEYF 92
           G  T    LY+G+LD S +E ++K  +  +G     V++M     D +  N  Y FVE+ 
Sbjct: 78  GASTPGSQLYMGDLDPSWDEAVVKGIWAALGEENIGVRMMWGGDADFHRKNLGYCFVEFP 137

Query: 93  QSHDANIALQTLNGKQIENNV---VKINWAFQS-----------QQVSPDEATFNLFVGD 138
               A+ AL   NG +I   V   +K+NW+ QS             V+  +   ++FVGD
Sbjct: 138 SPAHASNALMK-NGMEIPGFVHKKLKLNWSAQSVNNGSGASVANGAVANQQTNNSIFVGD 196

Query: 139 LNVDVDDETLRNAF-KEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHE 197
           L   V +  L + F  ++P+ +   VM+D  TG S+GYGFV F S  + Q+A+  MQG  
Sbjct: 197 LAPSVTEAQLFDLFINKYPSTVHAKVMYDQLTGISKGYGFVKFKSSMDQQRALVEMQGCF 256

Query: 198 LNGRPLRINWA 208
           LNGR ++I  A
Sbjct: 257 LNGRAIKIGIA 267

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 38/83 (45%), Gaps = 2/83 (2%)

Query: 290 PRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALA 349
           P  TT ++G +     E +L    + FG II  K    KGC F++Y     A   I  + 
Sbjct: 324 PNNTTVFVGGLSPLVTEDELRSYFEPFGTIIYVKIPAGKGCGFVQYVERSSAETAITKMQ 383

Query: 350 NFPFQGRNLRTGWGK--ERTSFV 370
            FP     +R  WG+  ++T+ +
Sbjct: 384 GFPIANSRVRLSWGRSAKKTALI 406

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 43  DKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQ 102
           +  ++VG L   + E+ L+ YF+  G I  VKI   K        FV+Y +   A  A+ 
Sbjct: 326 NTTVFVGGLSPLVTEDELRSYFEPFGTIIYVKIPAGK-----GCGFVQYVERSSAETAIT 380

Query: 103 TLNGKQIENNVVKINWAFQSQQVS 126
            + G  I N+ V+++W   +++ +
Sbjct: 381 KMQGFPIANSRVRLSWGRSAKKTA 404

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 50/239 (20%), Positives = 95/239 (39%), Gaps = 56/239 (23%)

Query: 19  ASETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGP-IANVKIMV 77
           ++++++       AN     ++T++ + +VG+L  S+ E  L   F    P   + K+M 
Sbjct: 166 SAQSVNNGSGASVANGAVANQQTNNSI-FVGDLAPSVTEAQLFDLFINKYPSTVHAKVMY 224

Query: 78  DK-NNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAF---------------- 120
           D+    +  Y FV++  S D   AL  + G  +    +KI  A                 
Sbjct: 225 DQLTGISKGYGFVKFKSSMDQQRALVEMQGCFLNGRAIKIGIAGGNNNNNSNSNYNNQRM 284

Query: 121 -----------QSQQV-----------SPDEATFN---------LFVGDLNVDVDDETLR 149
                      QS+ +           +P +   N         +FVG L+  V ++ LR
Sbjct: 285 ANDNISNGLGQQSRSLNGQLPQQFVNATPQQPVLNHFTDPNNTTVFVGGLSPLVTEDELR 344

Query: 150 NAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWA 208
           + F+ F T +       ++    +G GFV +  +  A+ A+  MQG  +    +R++W 
Sbjct: 345 SYFEPFGTIIY------VKIPAGKGCGFVQYVERSSAETAITKMQGFPIANSRVRLSWG 397

>KAFR0B02500 Chr2 (494025..495773) [1749 bp, 582 aa] {ON} Anc_8.229
           YER165W
          Length = 582

 Score = 84.3 bits (207), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 99/186 (53%), Gaps = 5/186 (2%)

Query: 23  ISEEPSVVPANAIKGGRET--SDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDK- 79
           I +E    P++    G+++  +   LYVG+LD S++E +L   F   G + ++++  D  
Sbjct: 17  IKDEQQNAPSSTGSEGQQSDSNSTSLYVGDLDPSVSEALLYDIFSPIGSVTSIRVCRDAI 76

Query: 80  NNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDL 139
             ++  YA+V +       +A++ LN   I+  + +I W+ Q       +   N+F+ +L
Sbjct: 77  TKTSLGYAYVNFADHEAGKVAIERLNYTPIKGRLCRIMWS-QRDPALRKKGNGNIFIKNL 135

Query: 140 NVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELN 199
           N D+D++ L + F  F   L   +  D + G S+G+GFV F  +  A++A+DA+ G  LN
Sbjct: 136 NADIDNKALYDTFSVFGNILSSKIATD-ENGNSKGFGFVHFEEEAAAKEAIDALNGMLLN 194

Query: 200 GRPLRI 205
           G+ + +
Sbjct: 195 GQEIYV 200

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 65/140 (46%), Gaps = 16/140 (11%)

Query: 86  YAFVEYFQSHDANIALQTLNGKQIENNVVKINWA---FQSQQVSPD--EAT--------- 131
           + FV Y    DA  A++ LN  + +   + +  A   ++  Q      EAT         
Sbjct: 263 FGFVNYENHEDALKAVEELNNTEFKGQELYVGRAQKKYERMQALKQQYEATRLEKMAKYQ 322

Query: 132 -FNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAM 190
             NLF+ +L+  +DDE L+  F  F T     VM   + G S+G+GFV F S EEA KA+
Sbjct: 323 GVNLFIKNLDDSIDDEKLKEEFAPFGTITSTKVMR-TENGKSKGFGFVCFSSPEEATKAI 381

Query: 191 DAMQGHELNGRPLRINWASK 210
                  + G+PL +  A +
Sbjct: 382 TEKNQQIVAGKPLYVAIAQR 401

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 86/177 (48%), Gaps = 6/177 (3%)

Query: 39  RETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDAN 98
           R+  +  +++ NL+  I+ + L   F V G I + KI  D+N ++  + FV + +   A 
Sbjct: 123 RKKGNGNIFIKNLNADIDNKALYDTFSVFGNILSSKIATDENGNSKGFGFVHFEEEAAAK 182

Query: 99  IALQTLNGKQIENNVV----KINWAFQSQQVSPDEATF-NLFVGDLNVDVDDETLRNAFK 153
            A+  LNG  +    +     ++   +  Q+    A F N++V ++ +D  +E  +    
Sbjct: 183 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEKTRANFTNVYVKNVPLDTTEEEFKEL-F 241

Query: 154 EFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
           E P      V+   + G  +G+GFV++ + E+A KA++ +   E  G+ L +  A K
Sbjct: 242 EKPGKTSSIVLEKGEDGKLKGFGFVNYENHEDALKAVEELNNTEFKGQELYVGRAQK 298

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 40/83 (48%)

Query: 128 DEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQ 187
           D  + +L+VGDL+  V +  L + F    +     V  D  T  S GY +V+F   E  +
Sbjct: 36  DSNSTSLYVGDLDPSVSEALLYDIFSPIGSVTSIRVCRDAITKTSLGYAYVNFADHEAGK 95

Query: 188 KAMDAMQGHELNGRPLRINWASK 210
            A++ +    + GR  RI W+ +
Sbjct: 96  VAIERLNYTPIKGRLCRIMWSQR 118

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           L++ NLD SI++E LK+ F   G I + K+M  +N  +  + FV +    +A  A+   N
Sbjct: 326 LFIKNLDDSIDDEKLKEEFAPFGTITSTKVMRTENGKSKGFGFVCFSSPEEATKAITEKN 385

 Score = 30.8 bits (68), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 21/39 (53%)

Query: 328 KGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKER 366
           KG  F+ Y+ HE A   +  L N  F+G+ L  G  +++
Sbjct: 261 KGFGFVNYENHEDALKAVEELNNTEFKGQELYVGRAQKK 299

>SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]
           {ON} highly similar to uniprot|P04147 Saccharomyces
           cerevisiae YER165W PAB1 Poly(A) binding protein part of
           the 3'-end RNA-processing complex mediates interactions
           between the 5' cap structure and the 3' mRNA poly(A)
           tail involved in control of poly(A) tail length
           interacts with translation factor eIF-4G
          Length = 589

 Score = 84.3 bits (207), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 52/168 (30%), Positives = 91/168 (54%), Gaps = 5/168 (2%)

Query: 40  ETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDK-NNSNANYAFVEYFQSHDA- 97
           +TS   LYVG LD ++ E +L   F   G ++++++  D    ++  YA+V  F  HDA 
Sbjct: 36  DTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVN-FHDHDAG 94

Query: 98  NIALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPT 157
             A+Q LN   I+    +I W+ Q       + + N+F+ +L+  +D++ L + F  F  
Sbjct: 95  RTAIQKLNYTTIKGRPCRIMWS-QRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGN 153

Query: 158 YLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRI 205
            L   +  D + G S+G+GFV F  +  A++A+DA+ G  LNG+ + +
Sbjct: 154 ILSCKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYV 200

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 77/180 (42%), Gaps = 16/180 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           +YV N+D    +E  +  F   G I +  +  D       + F+ +     A  A+  LN
Sbjct: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELN 282

Query: 106 GKQIENNVVKINWA----------FQSQQVSPDEAT-----FNLFVGDLNVDVDDETLRN 150
               ++  + +  A           +  +VS  E        NLFV +L+  +DDE LR+
Sbjct: 283 DTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRD 342

Query: 151 AFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
            F  F       VM D   G S+G+GFV F + EEA KA+       + G+PL +  A +
Sbjct: 343 EFAPFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 44/90 (48%)

Query: 121 QSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSF 180
           +S+    D ++ +L+VG+L+  V +  L + F    +     V  D  T  S GY +V+F
Sbjct: 29  ESENAKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNF 88

Query: 181 GSQEEAQKAMDAMQGHELNGRPLRINWASK 210
              +  + A+  +    + GRP RI W+ +
Sbjct: 89  HDHDAGRTAIQKLNYTTIKGRPCRIMWSQR 118

>KNAG0D03220 Chr4 (576080..577279) [1200 bp, 399 aa] {ON} Anc_4.61
           YGR159C
          Length = 399

 Score = 83.6 bits (205), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 93/178 (52%), Gaps = 13/178 (7%)

Query: 45  VLYVGNLDTSINEEILKQYFQ-VGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQT 103
            L+VG L  S+++E LK  F  +GG ++   IM    + +  Y +V++     A  AL+ 
Sbjct: 150 TLFVGRLSWSVDDEWLKNEFAPIGGVVSARVIMERGTDRSRGYGYVDFEDISYAEKALKE 209

Query: 104 LNGKQIENNVVKINWAFQSQQVS------------PDEATFNLFVGDLNVDVDDETLRNA 151
           + GK+I+   + ++ +                   P E +  LF+G+L+ D D + L   
Sbjct: 210 MQGKEIDGRPINVDMSTSKPAGGASNDRAKKFGDVPSEPSDTLFLGNLSFDADRDNLYEI 269

Query: 152 FKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
           F +F   +   +    +T   +G+G+V + + E+A+KA+DA+QG  +N RP+R+++++
Sbjct: 270 FGKFGEIISVRIPTHPETEQPKGFGYVQYTNTEDAKKALDALQGESINDRPVRLDFST 327

>Ecym_6201 Chr6 (375019..376365) [1347 bp, 448 aa] {ON} similar to
           Ashbya gossypii AFR107W
          Length = 448

 Score = 83.6 bits (205), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 96/178 (53%), Gaps = 13/178 (7%)

Query: 45  VLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNAN-YAFVEYFQSHDANIALQT 103
            ++VG L  SI++E LK  F+  G + + +++ ++    +  Y +V++     A  A++ 
Sbjct: 212 TIFVGRLSWSIDDEWLKTEFEHIGGVISARVIYERGTERSRGYGYVDFEDKSYAEKAIKE 271

Query: 104 LNGKQIENNVVKINWAFQSQQVSPDE------------ATFNLFVGDLNVDVDDETLRNA 151
           + GK+I+   + ++ +      +P E             +  LF+G+L+ + D + +   
Sbjct: 272 MQGKEIDGRPINVDMSTSKPASNPKEDRAKKFGDVPSQPSDTLFLGNLSFNADRDNIFEL 331

Query: 152 FKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
           FK++ + +   +    +T   +G+G+V + S EEAQKA+D +QG  ++ RP+R++++S
Sbjct: 332 FKDYGSIISVRIPTHPETNQPKGFGYVQYASIEEAQKALDKLQGEYIDNRPVRLDFSS 389

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 54/89 (60%), Gaps = 1/89 (1%)

Query: 121 QSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSF 180
           + ++ SP E    +FVG L+  +DDE L+  F+     +   V+++  T  SRGYG+V F
Sbjct: 201 KHKKDSPTEPA-TIFVGRLSWSIDDEWLKTEFEHIGGVISARVIYERGTERSRGYGYVDF 259

Query: 181 GSQEEAQKAMDAMQGHELNGRPLRINWAS 209
             +  A+KA+  MQG E++GRP+ ++ ++
Sbjct: 260 EDKSYAEKAIKEMQGKEIDGRPINVDMST 288

>TBLA0C04360 Chr3 complement(1046454..1047665) [1212 bp, 403 aa]
           {ON} Anc_4.61 YGR159C
          Length = 403

 Score = 83.2 bits (204), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 93/177 (52%), Gaps = 12/177 (6%)

Query: 45  VLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNAN-YAFVEYFQSHDANIALQT 103
            ++VG L  SI++E LK  F+  G + + +++ +K    +  Y +V++     A  A++ 
Sbjct: 162 TIFVGRLSWSIDDEWLKTEFEPIGGVLSARVIYEKGTDRSRGYGYVDFKNKTFAEKAIKE 221

Query: 104 LNGKQIENNVVKINWAFQSQQV-----------SPDEATFNLFVGDLNVDVDDETLRNAF 152
           + GK+I+   +  + +                 +P E +  LF+G+L+ D D + +   F
Sbjct: 222 MQGKEIDGRPINCDMSTSKPASNGGDRAKKFGDTPSEPSETLFLGNLSFDADRDNIYEVF 281

Query: 153 KEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
            ++   +   +    +T   +G+G+V +G  E A+KA+DA+QG  +N RP+R+++++
Sbjct: 282 SKYGEIISVRIPTHPETEQPKGFGYVQYGDVESAKKALDALQGEYINNRPVRLDFST 338

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 56/91 (61%), Gaps = 2/91 (2%)

Query: 121 QSQQVSPDEAT--FNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFV 178
           +S++  PDE+     +FVG L+  +DDE L+  F+     L   V+++  T  SRGYG+V
Sbjct: 148 ESKKQKPDESEEPATIFVGRLSWSIDDEWLKTEFEPIGGVLSARVIYEKGTDRSRGYGYV 207

Query: 179 SFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
            F ++  A+KA+  MQG E++GRP+  + ++
Sbjct: 208 DFKNKTFAEKAIKEMQGKEIDGRPINCDMST 238

>TPHA0H01520 Chr8 (343322..344806) [1485 bp, 494 aa] {ON} Anc_5.382
           YHR086W
          Length = 494

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 92/188 (48%), Gaps = 26/188 (13%)

Query: 43  DKVLYVGNLDTSINEEILKQYF-QVGGPIANVKIMVD----KNN-------SNANYAFVE 90
           + VLY+G LD S NE ++K  + +VG P  NV++M +     NN       SN  Y FVE
Sbjct: 42  NNVLYMGGLDYSWNEAVIKDIWNKVGEPATNVRMMWNMQFQHNNAGPTEGKSNLGYCFVE 101

Query: 91  YFQSHDANIALQTLNGKQI---ENNVVKINW---------AFQSQQVSPDEATFNLFVGD 138
            F +H+        NG  I   +    K+NW         A  ++   P    +++FVGD
Sbjct: 102 -FSTHETASNAIMKNGTMIPGYKGRYFKLNWSSGSSLSSSATHTENQGPQSNDYSVFVGD 160

Query: 139 LNVDVDDETLRNAFK-EFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHE 197
           L  +V +  L N FK  + + L   ++ D  T  S+GYGF+ F  Q +   A+  MQ   
Sbjct: 161 LGQNVTESQLYNLFKSHYASTLSSKIIHDPLTYISKGYGFIKFHDQNDYNDALSKMQNKI 220

Query: 198 LNGRPLRI 205
           LNGR +++
Sbjct: 221 LNGRGIKV 228

>CAGL0E03245g Chr5 complement(299473..300750) [1278 bp, 425 aa] {ON}
           similar to uniprot|P27476 Saccharomyces cerevisiae
           YGR159c NSR1 nuclear localization sequence binding
           protein
          Length = 425

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 97/178 (54%), Gaps = 13/178 (7%)

Query: 45  VLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNAN-YAFVEYFQSHDANIALQT 103
            ++VG L  SI++E LKQ F+  G +   ++M ++    +  Y +V++     A  A++ 
Sbjct: 177 TVFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYERGTDRSRGYGYVDFEDKSYAEKAVKE 236

Query: 104 LNGKQIENNVVKINWAFQSQQVSP------------DEATFNLFVGDLNVDVDDETLRNA 151
           ++GK+I+   + ++ +     V+P             E +  LF+G+L+ + D + +   
Sbjct: 237 MHGKEIDGRPINVDMSTSKPTVNPREDRQKRFGDIPSEPSDTLFLGNLSFNADRDNIYEI 296

Query: 152 FKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
           F +F   +   +    +T   +G+G+V + S ++A+KA++A+QG  ++ RP+R+++++
Sbjct: 297 FGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEALQGEYIDNRPVRLDYST 354

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 55/94 (58%), Gaps = 5/94 (5%)

Query: 121 QSQQVSPDEATFN-----LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGY 175
           + ++ SP +A  +     +FVG L+  +DDE L+  F+     +   VM++  T  SRGY
Sbjct: 160 EEEESSPKKAKTDGEPATVFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYERGTDRSRGY 219

Query: 176 GFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
           G+V F  +  A+KA+  M G E++GRP+ ++ ++
Sbjct: 220 GYVDFEDKSYAEKAVKEMHGKEIDGRPINVDMST 253

>KAFR0D04830 Chr4 (947731..948951) [1221 bp, 406 aa] {ON} Anc_5.382
           YHR086W
          Length = 406

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/166 (35%), Positives = 90/166 (54%), Gaps = 16/166 (9%)

Query: 45  VLYVGNLDTSINEEILKQ-YFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQT 103
           VLY+G+LD S +E ++ Q +  +G P  +VK+M         Y F+ +  S  A+ AL  
Sbjct: 33  VLYMGDLDLSWDERVVSQIWASLGEPNVSVKMM-------NRYCFITFLDSLTASNALLK 85

Query: 104 LNGKQIEN---NVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAF-KEFPTYL 159
            NG  I       +K+NWA   Q  S     +++FVGDL+ +V +  L + F  ++ +  
Sbjct: 86  -NGMLIPGYGGKRLKLNWA---QASSNASNGYSIFVGDLSPNVTEAQLFDLFINKYASTD 141

Query: 160 QGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRI 205
              +++D  TG SRGYGFV F S  + Q A+  MQG  LNGR ++I
Sbjct: 142 HAKIVYDQATGVSRGYGFVRFNSLMDQQHALLEMQGIFLNGRAIKI 187

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 33/76 (43%)

Query: 290 PRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALA 349
           P  TT ++G +     E +L    + FG I+  K    KGC F++Y     A   I  + 
Sbjct: 241 PNNTTVFVGGLSSLVTEDELREYFKPFGTIVYVKIPVGKGCGFVQYIDRVSAENAISKMQ 300

Query: 350 NFPFQGRNLRTGWGKE 365
            FP     +R  WG+ 
Sbjct: 301 GFPIANSRIRLSWGRS 316

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 42  SDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIAL 101
           ++  ++VG L + + E+ L++YF+  G I  VKI V K        FV+Y     A  A+
Sbjct: 242 NNTTVFVGGLSSLVTEDELREYFKPFGTIVYVKIPVGK-----GCGFVQYIDRVSAENAI 296

Query: 102 QTLNGKQIENNVVKINWA 119
             + G  I N+ ++++W 
Sbjct: 297 SKMQGFPIANSRIRLSWG 314

 Score = 37.4 bits (85), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 41/82 (50%), Gaps = 8/82 (9%)

Query: 127 PDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEA 186
           P+  T  +FVG L+  V ++ LR  FK F T     V   +  G  +G GFV +  +  A
Sbjct: 241 PNNTT--VFVGGLSSLVTEDELREYFKPFGTI----VYVKIPVG--KGCGFVQYIDRVSA 292

Query: 187 QKAMDAMQGHELNGRPLRINWA 208
           + A+  MQG  +    +R++W 
Sbjct: 293 ENAISKMQGFPIANSRIRLSWG 314

>KLTH0E03520g Chr5 complement(317318..318868) [1551 bp, 516 aa] {ON}
           similar to uniprot|Q00539 Saccharomyces cerevisiae
           YHR086W NAM8 RNA binding protein component of the U1
           snRNP protein mutants are defective in meiotic
           recombination and in formation of viable spores involved
           in the formation of DSBs through meiosis-specific
           splicing of MER2 pre-mRNA
          Length = 516

 Score = 82.0 bits (201), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 96/172 (55%), Gaps = 11/172 (6%)

Query: 46  LYVGNLDTSINEEILKQ-YFQVGGPIANVKIMVDKNNSNAN--YAFVEYFQSHDANIALQ 102
           LY+G+LD S +E  ++  +  +G P   VK++ +  ++  +  Y FVE+    +A+ AL 
Sbjct: 45  LYMGDLDPSWDENAIRAVWANLGEPNVQVKLIRNSGSTGGSSGYCFVEFPSHLNASNALL 104

Query: 103 TLNGKQI---ENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAF-KEFPTY 158
             NG  I    N  +K+NWA  S   +P     ++FVGD+  +V +  L   F   + + 
Sbjct: 105 K-NGLLIPNARNRYLKLNWA--SFATAPGN-EHSVFVGDIAPNVSEAQLFELFISRYAST 160

Query: 159 LQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
           L   +++D  TG S+GYGFV FG + E Q+A+  MQG  LNGR +R++  SK
Sbjct: 161 LNAKIVFDQMTGVSKGYGFVKFGQESEQQRALLEMQGVFLNGRAVRVSTTSK 212

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 36/83 (43%)

Query: 283 SMIRRAPPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAA 342
           ++ +   P  TT +IG +     E +L    Q FG I+  K    KGC F++Y     A 
Sbjct: 263 TLTQYTDPNNTTVFIGGLSSLVSEDELRAYFQPFGSIVYVKIPVGKGCGFVQYVDRISAE 322

Query: 343 VCIVALANFPFQGRNLRTGWGKE 365
             I  +  +P     +R  WG+ 
Sbjct: 323 TAIAKMQGYPIGNSRIRLSWGRS 345

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 46/90 (51%), Gaps = 5/90 (5%)

Query: 43  DKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQ 102
           +  +++G L + ++E+ L+ YFQ  G I  VKI V K        FV+Y     A  A+ 
Sbjct: 272 NTTVFIGGLSSLVSEDELRAYFQPFGSIVYVKIPVGK-----GCGFVQYVDRISAETAIA 326

Query: 103 TLNGKQIENNVVKINWAFQSQQVSPDEATF 132
            + G  I N+ ++++W   ++Q +  +  F
Sbjct: 327 KMQGYPIGNSRIRLSWGRSAKQAAVMQQAF 356

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 46/87 (52%), Gaps = 8/87 (9%)

Query: 122 SQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFG 181
           +Q   P+  T  +F+G L+  V ++ LR  F+ F     G +++ ++    +G GFV + 
Sbjct: 265 TQYTDPNNTT--VFIGGLSSLVSEDELRAYFQPF-----GSIVY-VKIPVGKGCGFVQYV 316

Query: 182 SQEEAQKAMDAMQGHELNGRPLRINWA 208
            +  A+ A+  MQG+ +    +R++W 
Sbjct: 317 DRISAETAIAKMQGYPIGNSRIRLSWG 343

>YER165W Chr5 (510373..512106) [1734 bp, 577 aa] {ON}  PAB1Poly(A)
           binding protein, part of the 3'-end RNA-processing
           complex, mediates interactions between the 5' cap
           structure and the 3' mRNA poly(A) tail, involved in
           control of poly(A) tail length, interacts with
           translation factor eIF-4G
          Length = 577

 Score = 80.9 bits (198), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 48/167 (28%), Positives = 90/167 (53%), Gaps = 3/167 (1%)

Query: 40  ETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDK-NNSNANYAFVEYFQSHDAN 98
           E S   LYVG+L+ S++E  L   F   G ++++++  D    ++  YA+V +       
Sbjct: 34  ENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGR 93

Query: 99  IALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTY 158
            A++ LN   I+  + +I W+ Q       + + N+F+ +L+ D+D++ L + F  F   
Sbjct: 94  KAIEQLNYTPIKGRLCRIMWS-QRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDI 152

Query: 159 LQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRI 205
           L   +  D + G S+G+GFV F  +  A++A+DA+ G  LNG+ + +
Sbjct: 153 LSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 88/181 (48%), Gaps = 18/181 (9%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           LYV N+++   +E  ++ F   GPI +  +  D +     + FV Y +  DA  A++ LN
Sbjct: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALN 280

Query: 106 GKQIEN---------------NVVKINW-AFQSQQVSPDEATFNLFVGDLNVDVDDETLR 149
             ++                 +V+K  + A++ ++++  +   NLFV +L+  VDDE L 
Sbjct: 281 DSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGV-NLFVKNLDDSVDDEKLE 339

Query: 150 NAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
             F  + T     VM   + G S+G+GFV F + EEA KA+       + G+PL +  A 
Sbjct: 340 EEFAPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 398

Query: 210 K 210
           +
Sbjct: 399 R 399

 Score = 72.0 bits (175), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 86/177 (48%), Gaps = 6/177 (3%)

Query: 39  RETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDAN 98
           R+     +++ NL   I+ + L   F V G I + KI  D+N  +  + FV + +   A 
Sbjct: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAK 180

Query: 99  IALQTLNGKQIENNVV----KINWAFQSQQVSPDEATF-NLFVGDLNVDVDDETLRNAFK 153
            A+  LNG  +    +     ++   +  Q+   +A + NL+V ++N +  DE  +  F 
Sbjct: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFA 240

Query: 154 EFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
           +F   +   +  D   G  +G+GFV++   E+A KA++A+   ELNG  L +  A K
Sbjct: 241 KFGPIVSASLEKDA-DGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQK 296

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 44/89 (49%)

Query: 122 SQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFG 181
           S+  S + ++ +L+VGDL   V +  L + F    +     V  D  T  S GY +V+F 
Sbjct: 28  SESQSVENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFN 87

Query: 182 SQEEAQKAMDAMQGHELNGRPLRINWASK 210
             E  +KA++ +    + GR  RI W+ +
Sbjct: 88  DHEAGRKAIEQLNYTPIKGRLCRIMWSQR 116

>Skud_5.304 Chr5 (495460..497193) [1734 bp, 577 aa] {ON} YER165W
           (REAL)
          Length = 577

 Score = 80.9 bits (198), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 48/167 (28%), Positives = 90/167 (53%), Gaps = 3/167 (1%)

Query: 40  ETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDK-NNSNANYAFVEYFQSHDAN 98
           E S   LYVG+L+ S++E  L   F   G ++++++  D    ++  YA+V +       
Sbjct: 34  ENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGR 93

Query: 99  IALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTY 158
            A++ LN   I+  + +I W+ Q       + + N+F+ +L+ D+D++ L + F  F   
Sbjct: 94  KAIEQLNYTPIKGRLCRIMWS-QRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDI 152

Query: 159 LQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRI 205
           L   +  D + G S+G+GFV F  +  A++A+DA+ G  LNG+ + +
Sbjct: 153 LSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 88/177 (49%), Gaps = 6/177 (3%)

Query: 39  RETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDAN 98
           R+     +++ NL   I+ + L   F V G I + KI  D+N  +  + FV + +   A 
Sbjct: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAK 180

Query: 99  IALQTLNGKQIENNVV----KINWAFQSQQVSPDEATF-NLFVGDLNVDVDDETLRNAFK 153
            A+  LNG  +    +     ++   +  Q+   +A + NL+V ++N +  DE  ++ F 
Sbjct: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQDLFI 240

Query: 154 EFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
           +F   +   +  D   G  +G+GFV++ + E+A KA++A+   +LNG  L +  A K
Sbjct: 241 QFGPIVSASLEKDA-DGKLKGFGFVNYENHEDAVKAVEALNESDLNGEKLYVGRAQK 296

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 87/181 (48%), Gaps = 18/181 (9%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           LYV N+++   +E  +  F   GPI +  +  D +     + FV Y    DA  A++ LN
Sbjct: 221 LYVKNINSETTDEQFQDLFIQFGPIVSASLEKDADGKLKGFGFVNYENHEDAVKAVEALN 280

Query: 106 -----------GKQIENN----VVKINW-AFQSQQVSPDEATFNLFVGDLNVDVDDETLR 149
                      G+  + N    V+K  + A++ ++++  +   NLFV +L+  VDDE L 
Sbjct: 281 ESDLNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGV-NLFVKNLDDSVDDEKLE 339

Query: 150 NAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
             F  + T     VM   + G S+G+GFV F + EEA KA+       + G+PL +  A 
Sbjct: 340 EEFTPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 398

Query: 210 K 210
           +
Sbjct: 399 R 399

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 44/89 (49%)

Query: 122 SQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFG 181
           S+  S + ++ +L+VGDL   V +  L + F    +     V  D  T  S GY +V+F 
Sbjct: 28  SEGQSVENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFN 87

Query: 182 SQEEAQKAMDAMQGHELNGRPLRINWASK 210
             E  +KA++ +    + GR  RI W+ +
Sbjct: 88  DHEAGRKAIEQLNYTPIKGRLCRIMWSQR 116

>KLLA0F14861g Chr6 (1375042..1376811) [1770 bp, 589 aa] {ON} some
           similarities with uniprot|Q00539 Saccharomyces
           cerevisiae YHR086W NAM8 RNA binding protein component of
           the U1 snRNP protein
          Length = 589

 Score = 80.9 bits (198), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 61/176 (34%), Positives = 94/176 (53%), Gaps = 15/176 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQ-VGGPIANVKIMVDKNNS------NANYAFVEYFQSHDAN 98
           LY+G+L+    E  +K  +  +G P   VK++   N +      N+ Y FVE+     A+
Sbjct: 58  LYMGDLNPDWTENDIKSIWSMLGEPNVQVKLIKSSNPNKSHAVNNSGYCFVEFPNQMAAS 117

Query: 99  IALQTLNGKQI---ENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAF-KE 154
            AL   +G ++    N  +K+NWA  S   +P  + F LFVGDL  +V +  L   F   
Sbjct: 118 NALMK-SGLRVPMDSNYALKLNWA--SFATAPG-SEFTLFVGDLAPNVTEAQLFELFISR 173

Query: 155 FPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
           + + L   +++D  TG S+GYGFV F ++ E Q+A+  MQG  LNGR +R+   SK
Sbjct: 174 YSSTLNAKIVFDQFTGVSKGYGFVKFVNEMEQQRALVEMQGTFLNGRAIRVGTTSK 229

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 36/83 (43%)

Query: 283 SMIRRAPPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAA 342
           S+ +   P  TT +IG +     E +L    Q FG I+  K    KGC F++Y     A 
Sbjct: 306 SLSQFTDPNNTTVFIGGLSTLITEDELRSYFQPFGQIVYVKIPVGKGCGFVQYVDRISAE 365

Query: 343 VCIVALANFPFQGRNLRTGWGKE 365
             I  +  FP     +R  WG+ 
Sbjct: 366 TAISKMQGFPIGNSRIRLSWGRS 388

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 43  DKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQ 102
           +  +++G L T I E+ L+ YFQ  G I  VKI V K        FV+Y     A  A+ 
Sbjct: 315 NTTVFIGGLSTLITEDELRSYFQPFGQIVYVKIPVGK-----GCGFVQYVDRISAETAIS 369

Query: 103 TLNGKQIENNVVKINWA 119
            + G  I N+ ++++W 
Sbjct: 370 KMQGFPIGNSRIRLSWG 386

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 46/87 (52%), Gaps = 8/87 (9%)

Query: 122 SQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFG 181
           SQ   P+  T  +F+G L+  + ++ LR+ F+ F     G +++ ++    +G GFV + 
Sbjct: 308 SQFTDPNNTT--VFIGGLSTLITEDELRSYFQPF-----GQIVY-VKIPVGKGCGFVQYV 359

Query: 182 SQEEAQKAMDAMQGHELNGRPLRINWA 208
            +  A+ A+  MQG  +    +R++W 
Sbjct: 360 DRISAETAISKMQGFPIGNSRIRLSWG 386

>AGR122C Chr7 complement(978628..980385) [1758 bp, 585 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER165W
           (PAB1)
          Length = 585

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 102/197 (51%), Gaps = 16/197 (8%)

Query: 5   ENLEQNPTVESEVPASETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYF 64
           E LEQ    E   P + T SE P V          ETS   LYVG L+ +++E +L   F
Sbjct: 10  EQLEQLKIEEQTAPTT-TESETPKV----------ETSGASLYVGELEPTVSEALLYDIF 58

Query: 65  QVGGPIANVKIMVDK-NNSNANYAFVEYFQSHDAN-IALQTLNGKQIENNVVKINWAFQS 122
              G ++++++  D   N++  YA+V  F  H+A   A++ LN   I+    +I W+ Q 
Sbjct: 59  SPIGSVSSIRVCRDAITNTSLGYAYVN-FHDHEAGPKAIEQLNYTLIKGKPCRIMWS-QR 116

Query: 123 QQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGS 182
                 + + N+++ +L+  +D+++L   F  F   L   V  D + G SRG+GFV F +
Sbjct: 117 DPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATD-ENGVSRGFGFVHFEN 175

Query: 183 QEEAQKAMDAMQGHELN 199
           + +A+ A++A+ G  +N
Sbjct: 176 ESDARDAIEAVDGMLMN 192

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 80/180 (44%), Gaps = 16/180 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           +YV N+D   ++E  ++ F   G I +  +  D       + FV +     A  A+  LN
Sbjct: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELN 280

Query: 106 GKQIENNVVKINWA------FQSQQVSPDEATF---------NLFVGDLNVDVDDETLRN 150
             + +   + +  A       Q  +   + A           NLFV +L+  +DDE L+ 
Sbjct: 281 ELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKE 340

Query: 151 AFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
            F  F T     VM D +TG SRG+GFV F + EEA KA+       + G+PL +  A +
Sbjct: 341 EFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 85/177 (48%), Gaps = 6/177 (3%)

Query: 39  RETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDAN 98
           R+     +Y+ NL  +I+ + L + F   G I + K+  D+N  +  + FV +    DA 
Sbjct: 121 RKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDAR 180

Query: 99  IALQTLNGKQIENN--VVKINWAFQSQQVSPDE--ATF-NLFVGDLNVDVDDETLRNAFK 153
            A++ ++G  + +    V ++ + + +Q   +E  A F N++V +++ +   E     F 
Sbjct: 181 DAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFG 240

Query: 154 EFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
           ++   +   V+     G  RG+GFV+F     A KA+D +   E  G+ L +  A K
Sbjct: 241 KYGK-ITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQK 296

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 38/78 (48%)

Query: 133 NLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDA 192
           +L+VG+L   V +  L + F    +     V  D  T  S GY +V+F   E   KA++ 
Sbjct: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQ 98

Query: 193 MQGHELNGRPLRINWASK 210
           +    + G+P RI W+ +
Sbjct: 99  LNYTLIKGKPCRIMWSQR 116

>Smik_5.337 Chr5 (509907..511640) [1734 bp, 577 aa] {ON} YER165W
           (REAL)
          Length = 577

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/167 (28%), Positives = 90/167 (53%), Gaps = 3/167 (1%)

Query: 40  ETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDK-NNSNANYAFVEYFQSHDAN 98
           E S   LYVG+L+ S++E  L   F   G ++++++  D    ++  YA+V +       
Sbjct: 34  ENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGR 93

Query: 99  IALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTY 158
            A++ LN   I+  + +I W+ Q       + + N+F+ +L+ D+D++ L + F  F   
Sbjct: 94  KAIEQLNYTPIKGRLCRIMWS-QRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDI 152

Query: 159 LQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRI 205
           L   +  D + G S+G+GFV F  +  A++A+DA+ G  LNG+ + +
Sbjct: 153 LSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 88/181 (48%), Gaps = 18/181 (9%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           LYV N+++   +E  ++ F   GPI +  +  D +     + FV Y    DA  A++TLN
Sbjct: 221 LYVKNINSETTDEQFQELFAQFGPIVSASLEKDADGKLKGFGFVNYENHEDAVKAVETLN 280

Query: 106 GKQIEN---------------NVVKINW-AFQSQQVSPDEATFNLFVGDLNVDVDDETLR 149
             ++                 +V+K  + A++ ++++  +   NLFV +L+  VDDE L 
Sbjct: 281 DSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGV-NLFVKNLDDSVDDEKLE 339

Query: 150 NAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
             F  + T     VM   + G S+G+GFV F + EEA KA+       + G+PL +  A 
Sbjct: 340 EEFAPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 398

Query: 210 K 210
           +
Sbjct: 399 R 399

 Score = 71.6 bits (174), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 86/177 (48%), Gaps = 6/177 (3%)

Query: 39  RETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDAN 98
           R+     +++ NL   I+ + L   F V G I + KI  D+N  +  + FV + +   A 
Sbjct: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAK 180

Query: 99  IALQTLNGKQIENNVV----KINWAFQSQQVSPDEATF-NLFVGDLNVDVDDETLRNAFK 153
            A+  LNG  +    +     ++   +  Q+   +A F NL+V ++N +  DE  +  F 
Sbjct: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHFTNLYVKNINSETTDEQFQELFA 240

Query: 154 EFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
           +F   +   +  D   G  +G+GFV++ + E+A KA++ +   ELNG  L +  A K
Sbjct: 241 QFGPIVSASLEKDA-DGKLKGFGFVNYENHEDAVKAVETLNDSELNGEKLYVGRAQK 296

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 44/89 (49%)

Query: 122 SQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFG 181
           S+  S + ++ +L+VGDL   V +  L + F    +     V  D  T  S GY +V+F 
Sbjct: 28  SEGQSVENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFN 87

Query: 182 SQEEAQKAMDAMQGHELNGRPLRINWASK 210
             E  +KA++ +    + GR  RI W+ +
Sbjct: 88  DHEAGRKAIEQLNYTPIKGRLCRIMWSQR 116

>KLTH0D03916g Chr4 (378839..380356) [1518 bp, 505 aa] {ON} some
           similarities with uniprot|P27476 Saccharomyces
           cerevisiae YGR159C NSR1 Nucleolar protein that binds
           nuclear localization sequences required for pre- rRNA
           processing and ribosome biogenesis
          Length = 505

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 98/178 (55%), Gaps = 13/178 (7%)

Query: 45  VLYVGNLDTSINEEILKQYFQ-VGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQT 103
            ++VG L  S+++E LK  F+ +GG I+   IM    + +  Y +V++     A  A++ 
Sbjct: 257 TIFVGRLSWSVDDEWLKTEFEPIGGVISARVIMERGTDRSRGYGYVDFENKFYAEKAVKE 316

Query: 104 LNGKQIENNVVKINWAF----------QSQQV--SPDEATFNLFVGDLNVDVDDETLRNA 151
           ++GK+I+   +  + +           +++Q   +P + +  LF+G+L+ + D + +   
Sbjct: 317 MHGKEIDGRPINCDMSTSKPAGNPRNDRAKQFGDTPSQPSDTLFLGNLSFNADRDNIFET 376

Query: 152 FKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
           F E    +   +    +T   +G+G+V + S +EAQKA +A+QGH ++ RP+R+++++
Sbjct: 377 FAEHGEVVSVRLPTHPETNQPKGFGYVQYSSVDEAQKAFEALQGHYIDNRPVRLDFST 434

>AFR107W Chr6 (628898..630088) [1191 bp, 396 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR159C (NSR1)
          Length = 396

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 92/178 (51%), Gaps = 13/178 (7%)

Query: 45  VLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNAN-YAFVEYFQSHDANIALQT 103
            ++VG L  S+++E LK  F   G +   +++ ++    +  Y +V++     A  A++ 
Sbjct: 168 TIFVGRLSWSVDDEWLKTEFDHIGGVVGARVIYERGTDKSRGYGYVDFEDVSYAEKAVKE 227

Query: 104 LNGKQIENNVVKINWAFQSQQVSPDE------------ATFNLFVGDLNVDVDDETLRNA 151
           ++GK+I+   +  + +      +P E             +  LF+G+L+ + D + L   
Sbjct: 228 MHGKEIDGRAINCDMSTSKPASAPREDRAKKYGDTPSQPSDTLFLGNLSFNADRDALFEL 287

Query: 152 FKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
           F +    +   +    ++   +G+G+V +GS EEAQ A+DA+QG  ++ RP+RI+++S
Sbjct: 288 FSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAALDALQGEYIDNRPVRIDFSS 345

>NCAS0H01810 Chr8 (349311..350642) [1332 bp, 443 aa] {ON} Anc_5.382
          Length = 443

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/171 (33%), Positives = 92/171 (53%), Gaps = 9/171 (5%)

Query: 41  TSDKVLYVGNLDTSINEEILKQYFQ-VGGPIANVKIMVDKN-NSNANYAFVEYFQSHDAN 98
           T    LY+G+LD + +E +++Q ++ +G    +VK+M + N   N  Y FVE+      N
Sbjct: 44  TGSSQLYMGDLDPNWDENVIRQIWRDLGESNVHVKMMWNSNLGVNQGYCFVEFPSMEHGN 103

Query: 99  IALQTLNGKQIEN---NVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAF-KE 154
            AL   NG  I       +K+NWA  S   + + + F++FVGDL+ +V +  L   F   
Sbjct: 104 NALLK-NGIVIPGFPQRRLKLNWA--SAGANGNNSGFSVFVGDLSPNVTEAQLFELFIGR 160

Query: 155 FPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRI 205
           +P+     V+ D  TG S+ YGFV F S  + Q+ +  MQG  LNGR +++
Sbjct: 161 YPSTCHAKVVHDQLTGVSKCYGFVKFNSATDQQRVLVEMQGVFLNGRSIKV 211

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 34/76 (44%)

Query: 290 PRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALA 349
           P  TT +IG +     E DL    Q FG II  K    KGC F++Y     A + I  + 
Sbjct: 280 PNNTTVFIGGLSSLVSEDDLRQYFQPFGDIIYVKIPTGKGCGFVQYVDRLSAELAISKMQ 339

Query: 350 NFPFQGRNLRTGWGKE 365
            FP     +R  WG+ 
Sbjct: 340 GFPLANSRIRLSWGRS 355

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 46/85 (54%), Gaps = 5/85 (5%)

Query: 40  ETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANI 99
           + ++  +++G L + ++E+ L+QYFQ  G I  VKI   K        FV+Y     A +
Sbjct: 279 DPNNTTVFIGGLSSLVSEDDLRQYFQPFGDIIYVKIPTGK-----GCGFVQYVDRLSAEL 333

Query: 100 ALQTLNGKQIENNVVKINWAFQSQQ 124
           A+  + G  + N+ ++++W   S+Q
Sbjct: 334 AISKMQGFPLANSRIRLSWGRSSKQ 358

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 44/83 (53%), Gaps = 10/83 (12%)

Query: 127 PDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMW-DMQTGGSRGYGFVSFGSQEE 185
           P+  T  +F+G L+  V ++ LR  F+ F     G +++  + TG  +G GFV +  +  
Sbjct: 280 PNNTT--VFIGGLSSLVSEDDLRQYFQPF-----GDIIYVKIPTG--KGCGFVQYVDRLS 330

Query: 186 AQKAMDAMQGHELNGRPLRINWA 208
           A+ A+  MQG  L    +R++W 
Sbjct: 331 AELAISKMQGFPLANSRIRLSWG 353

>Suva_5.299 Chr5 (478113..479846) [1734 bp, 577 aa] {ON} YER165W
           (REAL)
          Length = 577

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 90/167 (53%), Gaps = 3/167 (1%)

Query: 40  ETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDK-NNSNANYAFVEYFQSHDAN 98
           E S   LYVG+L+ +++E  L   F   G ++++++  D    ++  YA+V +       
Sbjct: 34  ENSSASLYVGDLEPAVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGR 93

Query: 99  IALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTY 158
            A++ LN   I+  + +I W+ Q       + + N+F+ +L+ D+D++ L + F  F   
Sbjct: 94  KAIEQLNYTPIKGRLCRIMWS-QRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDI 152

Query: 159 LQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRI 205
           L   +  D + G S+G+GFV F  +  A++A+DA+ G  LNG+ + +
Sbjct: 153 LSSKIATD-ENGNSKGFGFVHFEEEVAAKEAIDALNGMLLNGQEIYV 198

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 88/181 (48%), Gaps = 18/181 (9%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           LYV N+++   +E  ++ F   GPI +  +  D +     + FV Y    DA  A++ LN
Sbjct: 221 LYVKNINSETTDEQFQEMFVKFGPIVSASLEKDADGQLKGFGFVNYENHEDAVKAVEALN 280

Query: 106 -----------GKQIENN----VVKINW-AFQSQQVSPDEATFNLFVGDLNVDVDDETLR 149
                      G+  + N    V+K  + A++ ++++  +   NLFV +L+  VDDE L 
Sbjct: 281 ESDLNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGV-NLFVKNLDDTVDDEKLE 339

Query: 150 NAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
             F  + T     VM   + G S+G+GFV F + EEA KA+       + G+PL +  A 
Sbjct: 340 EEFAPYGTITSAKVMRS-ENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 398

Query: 210 K 210
           +
Sbjct: 399 R 399

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 88/177 (49%), Gaps = 6/177 (3%)

Query: 39  RETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDAN 98
           R+     +++ NL   I+ + L   F V G I + KI  D+N ++  + FV + +   A 
Sbjct: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGNSKGFGFVHFEEEVAAK 180

Query: 99  IALQTLNGKQIENNVV----KINWAFQSQQVSPDEATF-NLFVGDLNVDVDDETLRNAFK 153
            A+  LNG  +    +     ++   +  Q+   +A + NL+V ++N +  DE  +  F 
Sbjct: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQEMFV 240

Query: 154 EFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
           +F   +   +  D   G  +G+GFV++ + E+A KA++A+   +LNG  L +  A K
Sbjct: 241 KFGPIVSASLEKDA-DGQLKGFGFVNYENHEDAVKAVEALNESDLNGEKLYVGRAQK 296

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 44/89 (49%)

Query: 122 SQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFG 181
           S+  S + ++ +L+VGDL   V +  L + F    +     V  D  T  S GY +V+F 
Sbjct: 28  SEGQSVENSSASLYVGDLEPAVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFN 87

Query: 182 SQEEAQKAMDAMQGHELNGRPLRINWASK 210
             E  +KA++ +    + GR  RI W+ +
Sbjct: 88  DHEAGRKAIEQLNYTPIKGRLCRIMWSQR 116

>KLLA0C11495g Chr3 complement(990832..992169) [1338 bp, 445 aa] {ON}
           some similarities with uniprot|P27476 Saccharomyces
           cerevisiae YGR159C NSR1 Nucleolar protein that binds
           nuclear localization sequences required for pre-rRNA
           processing and ribosome biogenesis
          Length = 445

 Score = 78.6 bits (192), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 92/177 (51%), Gaps = 13/177 (7%)

Query: 45  VLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNA-NYAFVEYFQSHDANIALQT 103
            ++VG L  SI++E LK  F+  G + + ++M ++    +  Y +V++     A  A++ 
Sbjct: 197 TIFVGRLSWSIDDEWLKTEFEPIGGVISARVMYERGTDRSRGYGYVDFEDKSYAEKAIKE 256

Query: 104 LNGKQIENNVVKINWAFQSQQVSP------------DEATFNLFVGDLNVDVDDETLRNA 151
           ++GK+I+   +  + +      +P             E +  LF+G+L+ + D + L   
Sbjct: 257 MHGKEIDGRPINCDMSTSKPAGAPRDDRAKKFGDVPSEPSDTLFLGNLSFEADRDNLYEI 316

Query: 152 FKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWA 208
           F ++   +   +    +T   +G+G+V +GS E+A KA + +QG  +N RP+R++++
Sbjct: 317 FGKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDATKAFEGLQGEYINNRPVRLDYS 373

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 46/76 (60%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           +FVG L+  +DDE L+  F+     +   VM++  T  SRGYG+V F  +  A+KA+  M
Sbjct: 198 IFVGRLSWSIDDEWLKTEFEPIGGVISARVMYERGTDRSRGYGYVDFEDKSYAEKAIKEM 257

Query: 194 QGHELNGRPLRINWAS 209
            G E++GRP+  + ++
Sbjct: 258 HGKEIDGRPINCDMST 273

>TPHA0K01910 Chr11 complement(401616..402866) [1251 bp, 416 aa] {ON}
           Anc_4.61 YGR159C
          Length = 416

 Score = 78.2 bits (191), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 99/179 (55%), Gaps = 14/179 (7%)

Query: 45  VLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNAN-YAFVEYFQSHDANIALQT 103
            ++VG L  SI++E LK  F   G +   ++M+++    +  Y +V++     A  A++ 
Sbjct: 158 TIFVGRLSWSIDDEWLKNEFDHIGGVIGARVMLERGTDRSRGYGYVDFSDKSYAEKAIKE 217

Query: 104 LNGKQIENNVVKI-----------NWAFQSQQVS--PDEATFNLFVGDLNVDVDDETLRN 150
           ++GK+I+   +             N A ++++    P E +  LF+G+L+ + D +++  
Sbjct: 218 MHGKEIDGREINCDMSTSKPAGSNNGADRAKKFGDIPSEPSETLFLGNLSFNADRDSIWE 277

Query: 151 AFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
            F +F   +   +    +T   +G+G+V +G+ ++A+KA++A+QG  ++ RP+R+++++
Sbjct: 278 MFSKFGEIVSVRLPTHPETEQPKGFGYVQYGNIDDAKKALEALQGEYIDNRPVRLDYST 336

>Kwal_56.23486 s56 complement(561558..563321) [1764 bp, 587 aa] {ON}
           YER165W (PAB1) - Poly(A) binding protein, cytoplasmic
           and nuclear [contig 176] FULL
          Length = 587

 Score = 79.0 bits (193), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 92/175 (52%), Gaps = 5/175 (2%)

Query: 27  PSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDK-NNSNAN 85
           P+   + + KG  E S   LYVG LD S+ E +L   F   G ++++++  D    ++  
Sbjct: 25  PTSTDSESTKG--EASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLG 82

Query: 86  YAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDD 145
           YA+V +   +    A++ LN   I+    +I W+ Q       + + N+F+ +L+  +D+
Sbjct: 83  YAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWS-QRDPSLRKKGSGNVFIKNLHPAIDN 141

Query: 146 ETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNG 200
           + L + F  F   L   +  D +TG SR +GFV F  +E A++A+DA+ G  LNG
Sbjct: 142 KALHDTFSVFGNILSCKIATD-ETGKSRKFGFVHFEEEEAAKEAIDAINGMLLNG 195

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 78/180 (43%), Gaps = 16/180 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           +YV N+D    ++  ++ F   G I +  +  D       + FV +   + A  A++ LN
Sbjct: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELN 282

Query: 106 GKQIENNVVKINWA-------------FQSQQVSP--DEATFNLFVGDLNVDVDDETLRN 150
                   + +  A             ++S ++         NLFV +L+  +DDE L+ 
Sbjct: 283 DTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQE 342

Query: 151 AFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
            F  F T     VM D   G S+G+GFV F + EEA KA+       + G+PL +  A +
Sbjct: 343 EFAPFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 42/89 (47%)

Query: 122 SQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFG 181
           S+    + ++ +L+VG+L+  V +  L + F    +     V  D  T  S GY +V+F 
Sbjct: 30  SESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFH 89

Query: 182 SQEEAQKAMDAMQGHELNGRPLRINWASK 210
                  A++ +    + GRP RI W+ +
Sbjct: 90  DHNAGTTAIEKLNYTPIKGRPCRIMWSQR 118

>TDEL0F02910 Chr6 complement(525879..527189) [1311 bp, 436 aa] {ON}
           Anc_4.61 YGR159C
          Length = 436

 Score = 78.2 bits (191), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 95/178 (53%), Gaps = 13/178 (7%)

Query: 45  VLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNAN-YAFVEYFQSHDANIALQT 103
            ++VG L  SI++E LK  F   G + + +++ ++    +  Y +V++     A  A++ 
Sbjct: 188 TIFVGRLSWSIDDEWLKNEFDHIGGVVSARVIYERGTDRSRGYGYVDFEDKSYAEKAVKE 247

Query: 104 LNGKQIENNVVKINWAFQSQQVSP------------DEATFNLFVGDLNVDVDDETLRNA 151
           ++GK+I+   +  + +      +P             E +  LF+G+L+ + D + +   
Sbjct: 248 MHGKEIDGRPINCDLSTSKPAGNPRDDRAKKFGDLPSEPSETLFLGNLSFNADRDNIYEM 307

Query: 152 FKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
           F +F   +   +    +T   +G+G+V +G+ ++A+KA+DA+QG  ++ RP+R+++++
Sbjct: 308 FSKFGEIVSVRIPTHPETEQPKGFGYVQYGNVDDAKKALDALQGEYIDNRPVRLDYST 365

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 53/89 (59%), Gaps = 2/89 (2%)

Query: 121 QSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSF 180
           Q  ++S + AT  +FVG L+  +DDE L+N F      +   V+++  T  SRGYG+V F
Sbjct: 178 QKVELSGEPAT--IFVGRLSWSIDDEWLKNEFDHIGGVVSARVIYERGTDRSRGYGYVDF 235

Query: 181 GSQEEAQKAMDAMQGHELNGRPLRINWAS 209
             +  A+KA+  M G E++GRP+  + ++
Sbjct: 236 EDKSYAEKAVKEMHGKEIDGRPINCDLST 264

>YGR159C Chr7 complement(806412..807656) [1245 bp, 414 aa] {ON}
           NSR1Nucleolar protein that binds nuclear localization
           sequences, required for pre-rRNA processing and ribosome
           biogenesis
          Length = 414

 Score = 77.8 bits (190), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 92/176 (52%), Gaps = 11/176 (6%)

Query: 45  VLYVGNLDTSINEEILKQYFQ-VGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQT 103
            ++VG L  SI++E LK+ F+ +GG I    I     + +  Y +V++     A  A+Q 
Sbjct: 169 TIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQE 228

Query: 104 LNGKQIENNVVKINWAFQSQQV----------SPDEATFNLFVGDLNVDVDDETLRNAFK 153
           + GK+I+   +  + +                +P E +  LF+G+L+ + D + +   F 
Sbjct: 229 MQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELFA 288

Query: 154 EFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
           +    +   +    +T   +G+G+V F + E+A+KA+DA+QG  ++ RP+R++++S
Sbjct: 289 KHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDFSS 344

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 52/89 (58%)

Query: 121 QSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSF 180
           + Q+    E    +FVG L+  +DDE L+  F+     +   V+++  T  SRGYG+V F
Sbjct: 157 KKQKNEETEEPATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDF 216

Query: 181 GSQEEAQKAMDAMQGHELNGRPLRINWAS 209
            ++  A+KA+  MQG E++GRP+  + ++
Sbjct: 217 ENKSYAEKAIQEMQGKEIDGRPINCDMST 245

>Smik_6.264 Chr6 complement(425625..426812) [1188 bp, 395 aa] {ON}
           YGR159C (REAL)
          Length = 395

 Score = 77.4 bits (189), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 93/178 (52%), Gaps = 13/178 (7%)

Query: 45  VLYVGNLDTSINEEILKQYFQ-VGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQT 103
            ++VG L  SI++E LK+ F+ +GG I+   I     + +  Y +V++     A  A+Q 
Sbjct: 148 TIFVGRLSWSIDDEWLKKEFEHIGGVISARVIYERGTDRSRGYGYVDFENKSYAEKAIQE 207

Query: 104 LNGKQIENNVVKINWAFQSQQV------------SPDEATFNLFVGDLNVDVDDETLRNA 151
           + GK+I+   +  + +                  +P E +  LF+G+L+ + D + +   
Sbjct: 208 MQGKEIDGRPINCDMSTSKPASNNNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDVIFEL 267

Query: 152 FKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
           F +    +   +    +T   +G+G+V F + E+A+KA+DA+QG  ++ RP+R++++S
Sbjct: 268 FAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDFSS 325

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 52/89 (58%)

Query: 121 QSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSF 180
           + Q+    E    +FVG L+  +DDE L+  F+     +   V+++  T  SRGYG+V F
Sbjct: 136 KKQKNEESEEPATIFVGRLSWSIDDEWLKKEFEHIGGVISARVIYERGTDRSRGYGYVDF 195

Query: 181 GSQEEAQKAMDAMQGHELNGRPLRINWAS 209
            ++  A+KA+  MQG E++GRP+  + ++
Sbjct: 196 ENKSYAEKAIQEMQGKEIDGRPINCDMST 224

>NCAS0A05890 Chr1 (1156718..1157965) [1248 bp, 415 aa] {ON} 
          Length = 415

 Score = 77.4 bits (189), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 94/177 (53%), Gaps = 12/177 (6%)

Query: 45  VLYVGNLDTSINEEILKQYFQ-VGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQT 103
            ++VG L  SI++E LK+ F+ +GG ++   IM    + +  Y +V++     A  A++ 
Sbjct: 163 TIFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTDRSRGYGYVDFEDKSYAEKAIKE 222

Query: 104 LNGKQIENNVVKINWAFQSQQVS-----------PDEATFNLFVGDLNVDVDDETLRNAF 152
           + GK+I+   + ++ +                  P E +  LF+G+L+ + D + +   F
Sbjct: 223 MQGKEIDGREINVDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNLSFNADRDAISELF 282

Query: 153 KEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
            ++   +   +    +T   +G+G+V + + E+A+KA++ +QG  ++ RP+R+++++
Sbjct: 283 SKYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGLQGEYIDNRPVRLDYST 339

>SAKL0H23562g Chr8 complement(2037551..2038816) [1266 bp, 421 aa]
           {ON} some similarities with uniprot|Q754G3 Ashbya
           gossypii AFR107W AFR107Wp and some similarites with
           YGR159C uniprot|P27476 Saccharomyces cerevisiae YGR159C
           NSR1 Nucleolar protein that binds nuclear localization
           sequences required for pre-rRNA processing and ribosome
           biogenesis
          Length = 421

 Score = 77.4 bits (189), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 94/177 (53%), Gaps = 13/177 (7%)

Query: 45  VLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNAN-YAFVEYFQSHDANIALQT 103
            ++VG L  SI++E LK  F   G + + +++ ++ +  +  Y +V++   H A  A++ 
Sbjct: 174 TIFVGRLSWSIDDEWLKTEFDHIGGVVSARVIYERGSDRSRGYGYVDFEDKHYAEKAVKE 233

Query: 104 LNGKQIENNVVKINWAFQSQQVSP------------DEATFNLFVGDLNVDVDDETLRNA 151
           ++GK+I+   +  + +      +P             + +  LF+G+L+ + D + L   
Sbjct: 234 MHGKEIDGRPINCDMSTSKPAAAPRDDRAKKFGDVPSQPSDTLFLGNLSFNADRDNLFEI 293

Query: 152 FKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWA 208
           F +    +   +    +T   +G+G+V +GS ++A+KA +A+QG  ++ RP+R++++
Sbjct: 294 FSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEALQGEYIDNRPVRLDYS 350

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 45/76 (59%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           +FVG L+  +DDE L+  F      +   V+++  +  SRGYG+V F  +  A+KA+  M
Sbjct: 175 IFVGRLSWSIDDEWLKTEFDHIGGVVSARVIYERGSDRSRGYGYVDFEDKHYAEKAVKEM 234

Query: 194 QGHELNGRPLRINWAS 209
            G E++GRP+  + ++
Sbjct: 235 HGKEIDGRPINCDMST 250

 Score = 37.4 bits (85), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 40/80 (50%), Gaps = 1/80 (1%)

Query: 45  VLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSN-ANYAFVEYFQSHDANIALQT 103
            L++GNL  + + + L + F   G + +V+I           + +V+Y    DA  A + 
Sbjct: 275 TLFLGNLSFNADRDNLFEIFSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEA 334

Query: 104 LNGKQIENNVVKINWAFQSQ 123
           L G+ I+N  V+++++   Q
Sbjct: 335 LQGEYIDNRPVRLDYSIPRQ 354

>KAFR0F03120 Chr6 (620250..621488) [1239 bp, 412 aa] {ON} Anc_4.61
           YGR159C
          Length = 412

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 92/177 (51%), Gaps = 12/177 (6%)

Query: 45  VLYVGNLDTSINEEILKQYFQ-VGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQT 103
            ++VG L  SI++E LK  F+ +GG I    I     + +  Y +V++     A  A++ 
Sbjct: 166 TIFVGRLSWSIDDEWLKNEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKEYAEKAVKE 225

Query: 104 LNGKQIENNVVKINWAFQSQQVS-----------PDEATFNLFVGDLNVDVDDETLRNAF 152
           ++GK+I+   +  + +                  P E +  LF+G+L+ + D + +   F
Sbjct: 226 MHGKEIDGREINCDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNLSFNADRDNISEMF 285

Query: 153 KEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
            +F   +   +    +T   +G+G+V + + E+A+KA+DA+QG  ++ RP+R+++++
Sbjct: 286 SKFGEIVSVRIPTHPETEQPKGFGYVQYTNVEDAKKALDALQGEYIDNRPVRLDFST 342

>KNAG0B04440 Chr2 complement(849093..850286) [1194 bp, 397 aa] {ON}
           Anc_5.382 YHR086W
          Length = 397

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/181 (30%), Positives = 95/181 (52%), Gaps = 17/181 (9%)

Query: 46  LYVGNLDTSINEEILKQ-YFQVGGPIANVKIMVDKNN--------SNANYAFVEYFQSHD 96
           LY+G+L+ S +E ++K+ +  +G    +VK+M   NN         N  Y F+++    +
Sbjct: 56  LYMGDLEPSWDENVIKRIWSSIGEDNISVKMMWQNNNYMGNESGPRNQGYCFIDFPTHFN 115

Query: 97  ANIAL--QTLNGKQIENNVVKINWAFQSQQVSPDEAT-----FNLFVGDLNVDVDDETLR 149
           A+ AL    ++     +  +K+NWA  S   +   +T     F++FVGDL  +V +  L 
Sbjct: 116 ASNALLKNKMSIPGHPHKKLKLNWASSSAPSTAGVSTTGGNNFSIFVGDLAPNVTEAQLF 175

Query: 150 NAF-KEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWA 208
           + F   +P+     V+ D+ TG S+GYGF+ F    + Q A+  MQG  LNGR L++  +
Sbjct: 176 DLFISRYPSTEHAKVVIDLSTGVSKGYGFIRFRDPADQQTALAEMQGVFLNGRALKVGMS 235

Query: 209 S 209
           S
Sbjct: 236 S 236

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 42/82 (51%), Gaps = 5/82 (6%)

Query: 43  DKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQ 102
           +  +++G L   + EE L+QYFQ  G I  VKI V K        FV+Y     A  A+ 
Sbjct: 293 NTTVFIGGLSPLVKEEELRQYFQPFGEIVYVKIPVGK-----GCGFVQYIDRISAETAIS 347

Query: 103 TLNGKQIENNVVKINWAFQSQQ 124
            + G  I N+ V+++W   ++Q
Sbjct: 348 QMQGFPISNSRVRLSWGRSAKQ 369

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%)

Query: 290 PRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALA 349
           P  TT +IG +     E +L    Q FG I+  K    KGC F++Y     A   I  + 
Sbjct: 291 PNNTTVFIGGLSPLVKEEELRQYFQPFGEIVYVKIPVGKGCGFVQYIDRISAETAISQMQ 350

Query: 350 NFPFQGRNLRTGWGKE 365
            FP     +R  WG+ 
Sbjct: 351 GFPISNSRVRLSWGRS 366

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 44/82 (53%), Gaps = 8/82 (9%)

Query: 127 PDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEA 186
           P+  T  +F+G L+  V +E LR  F+ F     G +++ ++    +G GFV +  +  A
Sbjct: 291 PNNTT--VFIGGLSPLVKEEELRQYFQPF-----GEIVY-VKIPVGKGCGFVQYIDRISA 342

Query: 187 QKAMDAMQGHELNGRPLRINWA 208
           + A+  MQG  ++   +R++W 
Sbjct: 343 ETAISQMQGFPISNSRVRLSWG 364

>Smik_8.164 Chr8 (254903..256477) [1575 bp, 524 aa] {ON} YHR086W
           (REAL)
          Length = 524

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 96/195 (49%), Gaps = 32/195 (16%)

Query: 38  GRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNS-------------NA 84
           G  T+   LY+G+LD + ++  ++Q +   G  AN+ + +  NNS             N 
Sbjct: 48  GSGTTGNQLYMGDLDPTWDKNTVRQIWASLGE-ANINVRMMWNNSLNNGSRSPMGSKNNQ 106

Query: 85  NYAFVEYFQS-HDANIALQTLNGKQIEN---NVVKINWAFQSQQVSPDEATFN------- 133
            Y FV++  S H AN  L+  NG  I N     +K+NWA  S   S   +TFN       
Sbjct: 107 GYCFVDFPSSTHAANALLK--NGMLIPNFPNRKLKLNWATSS--YSSGNSTFNNVKSSNN 162

Query: 134 --LFVGDLNVDVDDETLRNAF-KEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAM 190
             +FVGDL  +V +  L   F   + +     V+ D  TG S+GYGFV F + +E Q A+
Sbjct: 163 CSVFVGDLAPNVTESQLFELFINRYASVAHAKVVHDQVTGISKGYGFVKFANSDEQQSAL 222

Query: 191 DAMQGHELNGRPLRI 205
             MQG  LNGR +++
Sbjct: 223 LEMQGVFLNGRAIKV 237

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%)

Query: 290 PRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALA 349
           P  TT +IG +     E +L    Q FG I+  K    KGC F++Y     A   I  + 
Sbjct: 310 PNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKGCGFVQYVDRLSAETAIARMQ 369

Query: 350 NFPFQGRNLRTGWGKE 365
            FP     +R  WG+ 
Sbjct: 370 GFPIANSRVRLSWGRS 385

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 5/84 (5%)

Query: 43  DKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQ 102
           +  +++G L + + E+ L+ YFQ  G I  VKI V K        FV+Y     A  A+ 
Sbjct: 312 NTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGK-----GCGFVQYVDRLSAETAIA 366

Query: 103 TLNGKQIENNVVKINWAFQSQQVS 126
            + G  I N+ V+++W   ++Q +
Sbjct: 367 RMQGFPIANSRVRLSWGRSAKQTA 390

 Score = 34.3 bits (77), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 8/82 (9%)

Query: 127 PDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEA 186
           P+  T  +F+G L+  V ++ LR  F+ F T     V   +  G  +G GFV +  +  A
Sbjct: 310 PNNTT--VFIGGLSSLVTEDELRAYFQPFGTI----VYVKIPVG--KGCGFVQYVDRLSA 361

Query: 187 QKAMDAMQGHELNGRPLRINWA 208
           + A+  MQG  +    +R++W 
Sbjct: 362 ETAIARMQGFPIANSRVRLSWG 383

>Suva_7.450 Chr7 complement(775898..777073) [1176 bp, 391 aa] {ON}
           YGR159C (REAL)
          Length = 391

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 95/179 (53%), Gaps = 14/179 (7%)

Query: 45  VLYVGNLDTSINEEILKQYFQ-VGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQT 103
            ++VG L  SI++E LK+ F+ +GG I+   I+    + +  Y +V++     A  A+Q 
Sbjct: 138 TIFVGRLSWSIDDEWLKKEFEHIGGVISARVILERGTDRSRGYGYVDFENQSYAEKAIQE 197

Query: 104 LNGKQIENNVVKINWAFQSQQV-------------SPDEATFNLFVGDLNVDVDDETLRN 150
           + GK+I+   +  + +                   +P E +  LF+G+L+ + D +T+  
Sbjct: 198 MQGKEIDGRPINCDISTSKPAGNNNNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDTIFE 257

Query: 151 AFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
            F +    +   +    +T   +G+G+V + + ++A+KA+DA+QG  ++ RP+R++++S
Sbjct: 258 MFAKHGEVVSVRIPTHPETEQPKGFGYVQYTNLDDAKKALDALQGEYIDNRPVRLDYSS 316

>Skud_7.483 Chr7 complement(790010..791191) [1182 bp, 393 aa] {ON}
           YGR159C (REAL)
          Length = 393

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 94/178 (52%), Gaps = 13/178 (7%)

Query: 45  VLYVGNLDTSINEEILKQYFQ-VGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQT 103
            ++VG L  SI++E LK+ F+ +GG I+   I     + +  Y +V++     A  A+Q 
Sbjct: 142 TIFVGRLSWSIDDEWLKKEFEHIGGVISARVINERGTDRSRGYGYVDFENKSYAEKAIQE 201

Query: 104 LNGKQIENNVVKINWAFQSQQV------------SPDEATFNLFVGDLNVDVDDETLRNA 151
           + GK+I+   +  + +                  +P E +  LF+G+L+ + D +T+   
Sbjct: 202 MQGKEIDGRPINCDLSTSKPAGNNTNDRAKKFGDTPSEPSDTLFLGNLSFNADRDTIFEL 261

Query: 152 FKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
           F +    +   +    +T   +G+G+V F S E+++KA++++QG  ++ RP+R++++S
Sbjct: 262 FAKHGEVVSVRIPTHPETEQPKGFGYVQFSSLEDSKKALESLQGEYIDNRPVRLDYSS 319

>NDAI0C01820 Chr3 complement(398027..399523) [1497 bp, 498 aa] {ON}
           Anc_5.382
          Length = 498

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 54/175 (30%), Positives = 88/175 (50%), Gaps = 15/175 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQ-VGGPIANVKIMVDKN-NSNANYAFVEY-FQSHDANIALQ 102
           +Y+G LD +  E  +K  ++ +G  + NVK++ +KN   N  Y F+E+  + H +N  L+
Sbjct: 72  IYMGELDPTWTEATIKSIWKSLGEELINVKLIWNKNLGLNQGYCFIEFPSEQHASNALLK 131

Query: 103 T-LNGKQIENNVVKINWAF----------QSQQVSPDEATFNLFVGDLNVDVDDETLRNA 151
             +N  +     VK+NW             S QV      +++FVGDL  +V +  L + 
Sbjct: 132 NGINIPEFPRKKVKLNWTSSSSASLQGSSNSGQVPSTSTNYSVFVGDLAANVTEGQLFDL 191

Query: 152 F-KEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRI 205
           F   F +     ++ D  T  S+ YGFV F    + Q+A+  MQG  LNGR ++I
Sbjct: 192 FISRFQSTCHAKIVHDPVTRASKCYGFVKFNDLRDQQRALVEMQGIFLNGRAIKI 246

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%)

Query: 290 PRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALA 349
           P  TT ++G +     E  L    Q FG II  K    KGC F++Y     A   I+ + 
Sbjct: 323 PNNTTVFVGGLSSMVTEEQLRHCFQPFGTIIYVKIPIGKGCGFVQYFDRISAETAILRMQ 382

Query: 350 NFPFQGRNLRTGWGKE 365
            FP     +R  WG+ 
Sbjct: 383 GFPIGNSRIRLSWGRS 398

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 43/83 (51%), Gaps = 5/83 (6%)

Query: 42  SDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIAL 101
           ++  ++VG L + + EE L+  FQ  G I  VKI + K        FV+YF    A  A+
Sbjct: 324 NNTTVFVGGLSSMVTEEQLRHCFQPFGTIIYVKIPIGK-----GCGFVQYFDRISAETAI 378

Query: 102 QTLNGKQIENNVVKINWAFQSQQ 124
             + G  I N+ ++++W   S+Q
Sbjct: 379 LRMQGFPIGNSRIRLSWGRSSRQ 401

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 42/82 (51%), Gaps = 8/82 (9%)

Query: 127 PDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEA 186
           P+  T  +FVG L+  V +E LR+ F+ F T +       ++    +G GFV +  +  A
Sbjct: 323 PNNTT--VFVGGLSSMVTEEQLRHCFQPFGTIIY------VKIPIGKGCGFVQYFDRISA 374

Query: 187 QKAMDAMQGHELNGRPLRINWA 208
           + A+  MQG  +    +R++W 
Sbjct: 375 ETAILRMQGFPIGNSRIRLSWG 396

>KLTH0G14344g Chr7 (1248269..1250032) [1764 bp, 587 aa] {ON} highly
           similar to uniprot|P04147 Saccharomyces cerevisiae
           YER165W PAB1 Poly(A) binding protein part of the 3'-end
           RNA-processing complex mediates interactions between the
           5' cap structure and the 3' mRNA poly(A) tail involved
           in control of poly(A) tail length interacts with
           translation factor eIF-4G
          Length = 587

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 48/156 (30%), Positives = 84/156 (53%), Gaps = 3/156 (1%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDK-NNSNANYAFVEYFQSHDANIALQTL 104
           LYVG LD S+ E +L   F   G ++++++  D    ++  YA+V +   +    A++ L
Sbjct: 42  LYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGRTAIEKL 101

Query: 105 NGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVM 164
           N   I+    +I W+ Q       + + N+F+ +L+  +D++ L + F  F   L   + 
Sbjct: 102 NYTPIKGRPCRIMWS-QRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIA 160

Query: 165 WDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNG 200
            D +TG SR +GFV F  +E A++A+DA+ G  LNG
Sbjct: 161 TD-ETGKSRKFGFVHFEEEEAAKEAIDAINGMLLNG 195

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 82/181 (45%), Gaps = 18/181 (9%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANI-ALQTL 104
           +YV N+D+   +E  ++ F   G I +  +  D       + FV  F+ H+A + A + L
Sbjct: 223 VYVKNIDSETTQEEFEKMFSNYGAITSAVLERDNEGKLRGFGFVN-FEDHNAALKACEEL 281

Query: 105 NGKQIENNVVKINWA-------------FQSQQVSP--DEATFNLFVGDLNVDVDDETLR 149
           N    +   + +  A             ++S ++         NLFV +L+  VDD+ L 
Sbjct: 282 NDTDFKGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSVDDQKLE 341

Query: 150 NAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
             F  F T     VM D + G S+G+GFV F + EEA KA+       + G+PL +  A 
Sbjct: 342 EEFAPFGTITSVKVMRD-EAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 400

Query: 210 K 210
           +
Sbjct: 401 R 401

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 37/77 (48%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           L+VG+L+  V +  L + F    +     V  D  T  S GY +V+F      + A++ +
Sbjct: 42  LYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGRTAIEKL 101

Query: 194 QGHELNGRPLRINWASK 210
               + GRP RI W+ +
Sbjct: 102 NYTPIKGRPCRIMWSQR 118

>NDAI0D02840 Chr4 complement(656261..657541) [1281 bp, 426 aa] {ON} 
          Length = 426

 Score = 74.3 bits (181), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 39/176 (22%), Positives = 92/176 (52%), Gaps = 11/176 (6%)

Query: 45  VLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNA-NYAFVEYFQSHDANIALQT 103
            ++VG L  SI++E LK+ F+  G +   +++ ++    +  Y +V++     A  A+Q 
Sbjct: 172 TIFVGRLSWSIDDEWLKKEFEHIGGVVGARVIYERGTDRSRGYGYVDFEDKSYAEKAIQE 231

Query: 104 LNGKQIENNVVKINWAFQSQQVS----------PDEATFNLFVGDLNVDVDDETLRNAFK 153
           + GK+I+   + ++ +                 P E +  LF+G+L+ + D + +   F 
Sbjct: 232 MQGKEIDGRPINVDMSTSKPAGGNDRAKKFGDVPSEPSDTLFLGNLSFNADKDNIYETFS 291

Query: 154 EFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
           ++   +   +    +T   +G+G+V F + E+A+KA++ +QG  ++ R +R+++++
Sbjct: 292 KYGEIISVRIPTHPETEQPKGFGYVQFSNIEDAKKALEGLQGEYIDNRAVRLDYST 347

>ZYRO0A07018g Chr1 complement(573135..574811) [1677 bp, 558 aa] {ON}
           some similarities with uniprot|Q00539 Saccharomyces
           cerevisiae YHR086W NAM8 RNA binding protein component of
           the U1 snRNP protein mutants are defective in meiotic
           recombination and in formation of viable spores involved
           in the formation of DSBs through meiosis-specific
           splicing of MER2 pre-mRNA
          Length = 558

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/193 (32%), Positives = 101/193 (52%), Gaps = 21/193 (10%)

Query: 31  PANAIKGGRETSDKVLYVGNLDTSINEEILKQYF-QVGGPIANVKIMVDKNNS------- 82
           P NA+ G R +    LY+G+LD S +E  ++Q +  +G     +++M+  N S       
Sbjct: 36  PVNAV-GNRGSQ---LYMGDLDPSWDENTIRQIWGSLGESNVVIRLMLHNNVSGSGTMGP 91

Query: 83  --NANYAFVEYFQS-HDANIALQTLNGKQIENNV---VKINWAFQSQQVSPDEATFNLFV 136
             N  Y F+E+  + H +N  L+  NG QI N V   +K+NWA  S   +     +++FV
Sbjct: 92  RNNLGYCFLEFPSTVHASNALLK--NGMQIPNFVHKRLKLNWASSSHSSAGAFNEYSVFV 149

Query: 137 GDLNVDVDDETLRNAF-KEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQG 195
           GDL  +V +  L   F   F +     +++D  TG S+GY FV F +    Q+A+  MQG
Sbjct: 150 GDLAPNVTESQLFELFISRFNSTSHVKIVYDQLTGVSKGYAFVKFTNPAHQQRALLEMQG 209

Query: 196 HELNGRPLRINWA 208
             L+GR +R++ A
Sbjct: 210 IFLSGRAIRVSNA 222

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 33/76 (43%)

Query: 290 PRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALA 349
           P  TT ++G +     E +L    Q FG I+  K    KGC F++Y     A   I  + 
Sbjct: 280 PNNTTVFVGGLSSLVAEDELRAYFQPFGTIVYVKIPVGKGCGFVQYVDRISAETAIAKMQ 339

Query: 350 NFPFQGRNLRTGWGKE 365
            FP     +R  WG+ 
Sbjct: 340 GFPIGNSRVRLSWGRS 355

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 49/98 (50%), Gaps = 5/98 (5%)

Query: 29  VVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAF 88
           V P  A+    + ++  ++VG L + + E+ L+ YFQ  G I  VKI V K        F
Sbjct: 268 VQPQPALNSFTDPNNTTVFVGGLSSLVAEDELRAYFQPFGTIVYVKIPVGK-----GCGF 322

Query: 89  VEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVS 126
           V+Y     A  A+  + G  I N+ V+++W   ++Q +
Sbjct: 323 VQYVDRISAETAIAKMQGFPIGNSRVRLSWGRSAKQAA 360

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 41/82 (50%), Gaps = 8/82 (9%)

Query: 127 PDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEA 186
           P+  T  +FVG L+  V ++ LR  F+ F T     V   +  G  +G GFV +  +  A
Sbjct: 280 PNNTT--VFVGGLSSLVAEDELRAYFQPFGTI----VYVKIPVG--KGCGFVQYVDRISA 331

Query: 187 QKAMDAMQGHELNGRPLRINWA 208
           + A+  MQG  +    +R++W 
Sbjct: 332 ETAIAKMQGFPIGNSRVRLSWG 353

>TBLA0H01790 Chr8 complement(415969..417993) [2025 bp, 674 aa] {ON}
           Anc_5.382 YHR086W
          Length = 674

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 61/214 (28%), Positives = 103/214 (48%), Gaps = 37/214 (17%)

Query: 17  VPASETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYF-QVGGPIANVKI 75
           +P+S   S  PSV                LY+G+LD   +E  +KQ +  +G     VKI
Sbjct: 46  LPSSMNRSSNPSV-----------NKTTQLYMGDLDPMWDESTIKQIWNSLGENNIVVKI 94

Query: 76  MVDKN-----NSNANYAFVEYFQSHDANIALQTLNGKQI---ENNVVKINWAFQSQQVSP 127
           + + N      +N  Y F+E+   ++A+ AL   NG  I    + V+K+NWA    + + 
Sbjct: 95  ITNSNMTSMGRNNPGYCFIEFSNYNNASNALLK-NGLVIPGYNSKVLKLNWASMHTRSNG 153

Query: 128 DEAT---------------FNLFVGDLNVDVDDETLRNAF-KEFPTYLQGHVMWDMQTGG 171
           +                  F++FVGDL  +V +  L + F   + + +   +++D  T  
Sbjct: 154 NTNCTANNNTSSNNSTNNDFSVFVGDLAPNVTEAQLFDLFINRYSSTIHAKIVYDQMTNV 213

Query: 172 SRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRI 205
           S+GYGFV F +  + Q++++ MQG  LNGR +R+
Sbjct: 214 SKGYGFVRFNNSADQQRSLNEMQGVFLNGRSIRV 247

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 33/75 (44%)

Query: 290 PRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALA 349
           P  TT +IG +     E +L    Q FG I+  K    KGC F++Y     A   I  + 
Sbjct: 337 PNNTTVFIGGLSSLVSEGELRSYFQPFGTIVYVKIPVGKGCGFVQYVDRSAAETAISKMQ 396

Query: 350 NFPFQGRNLRTGWGK 364
            FP     +R  WG+
Sbjct: 397 GFPIGNSRIRLSWGR 411

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 44/86 (51%), Gaps = 8/86 (9%)

Query: 43  DKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQ 102
           +  +++G L + ++E  L+ YFQ  G I  VKI V K        FV+Y     A  A+ 
Sbjct: 339 NTTVFIGGLSSLVSEGELRSYFQPFGTIVYVKIPVGK-----GCGFVQYVDRSAAETAIS 393

Query: 103 TLNGKQIENNVVKINW---AFQSQQV 125
            + G  I N+ ++++W   A QS QV
Sbjct: 394 KMQGFPIGNSRIRLSWGRFAKQSAQV 419

 Score = 37.0 bits (84), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 42/86 (48%), Gaps = 8/86 (9%)

Query: 123 QQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGS 182
           Q   P+  T  +F+G L+  V +  LR+ F+ F T     V   +  G  +G GFV +  
Sbjct: 333 QFTDPNNTT--VFIGGLSSLVSEGELRSYFQPFGTI----VYVKIPVG--KGCGFVQYVD 384

Query: 183 QEEAQKAMDAMQGHELNGRPLRINWA 208
           +  A+ A+  MQG  +    +R++W 
Sbjct: 385 RSAAETAISKMQGFPIGNSRIRLSWG 410

>Skud_8.147 Chr8 (252154..253695) [1542 bp, 513 aa] {ON} YHR086W
           (REAL)
          Length = 513

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 96/189 (50%), Gaps = 27/189 (14%)

Query: 41  TSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNN-------------SNANYA 87
           T+   LY+G+LD + ++  ++Q +   G  ANV + +  NN             +N  Y 
Sbjct: 41  TTGNQLYMGDLDPTWDKNTIRQIWTSLGE-ANVNVRMMWNNPSNSGSRPSVGPKNNQGYC 99

Query: 88  FVEYFQS-HDANIALQTLNGKQIEN---NVVKINWAFQSQQVSPDEA------TFNLFVG 137
           F+++  S H AN  L+  NG  I N     +K+NWA  S   + + A      ++++FVG
Sbjct: 100 FIDFPSSTHAANALLK--NGMLIPNFPNRKLKLNWATSSYSNNINGANMKSGNSYSIFVG 157

Query: 138 DLNVDVDDETLRNAF-KEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGH 196
           DL  +V +  L   F   + +     ++ D  TG S+GYGFV F + +E Q A+  MQG 
Sbjct: 158 DLAPNVTESQLFELFINRYASASHAKIVHDQVTGMSKGYGFVKFTNADEEQLALSEMQGV 217

Query: 197 ELNGRPLRI 205
            LNGR +++
Sbjct: 218 FLNGRAIKV 226

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%)

Query: 290 PRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALA 349
           P  TT +IG +     E +L    Q FG I+  K    KGC F++Y     A   I  + 
Sbjct: 302 PNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKGCGFVQYVDRLSAEAAIAGMQ 361

Query: 350 NFPFQGRNLRTGWGKE 365
            FP     +R  WG+ 
Sbjct: 362 GFPIANSRVRLSWGRS 377

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 5/84 (5%)

Query: 43  DKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQ 102
           +  +++G L + + E+ L+ YFQ  G I  VKI V K        FV+Y     A  A+ 
Sbjct: 304 NTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGK-----GCGFVQYVDRLSAEAAIA 358

Query: 103 TLNGKQIENNVVKINWAFQSQQVS 126
            + G  I N+ V+++W   ++Q +
Sbjct: 359 GMQGFPIANSRVRLSWGRSAKQTA 382

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 65/153 (42%), Gaps = 16/153 (10%)

Query: 61  KQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAF 120
           +Q   V G I   +     NN N +  F    QS   N+A    N     NNV +  +  
Sbjct: 234 QQNVHVNGNIDQGRSSSSLNNENFDPRFHSKNQSLLGNVAN---NMSSKGNNVSQFIYPV 290

Query: 121 QSQQ-----VSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGY 175
           Q Q        P+  T  +F+G L+  V ++ LR  F+ F T     V   +  G  +G 
Sbjct: 291 QQQPSLNHFTDPNNTT--VFIGGLSSLVTEDELRAYFQPFGTI----VYVKIPVG--KGC 342

Query: 176 GFVSFGSQEEAQKAMDAMQGHELNGRPLRINWA 208
           GFV +  +  A+ A+  MQG  +    +R++W 
Sbjct: 343 GFVQYVDRLSAEAAIAGMQGFPIANSRVRLSWG 375

>Kpol_224.1 s224 complement(931..1584) [654 bp, 217 aa] {ON}
           complement(931..1584) [654 nt, 218 aa]
          Length = 217

 Score = 70.1 bits (170), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 53/184 (28%), Positives = 91/184 (49%), Gaps = 12/184 (6%)

Query: 38  GRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKN-NSNANYAFVEYFQSHD 96
           G +  D  +YVGN+D SI +E+L + F    PIA +    DK   ++  YAF++++   D
Sbjct: 7   GFKNPDLSVYVGNIDPSITKELLYELFVQISPIAKINYPKDKVLQTHQGYAFIDFYTEED 66

Query: 97  ANIALQTLNGK-QIENNVVKI----NWAFQSQQVSPDEAT-----FNLFVGDLNVDVDDE 146
           AN A+Q  N   Q+ N V+K+    N        +  +AT       +FV +L+  VD  
Sbjct: 67  ANYAIQAFNNNVQLNNRVLKVRKTNNNISSKSSTNLSQATSVTPYAKIFVKNLDSSVDVA 126

Query: 147 TLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRIN 206
            L   FK+F +  +   ++ +  G  R   +V F   E+A +A+ ++ G  +  + + I 
Sbjct: 127 YLSKLFKKFGSLARESEIFHLSNGELRC-AYVYFKDYEKADEAIKSLDGQLVTNKRINIE 185

Query: 207 WASK 210
           +A K
Sbjct: 186 YAFK 189

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 54/105 (51%), Gaps = 13/105 (12%)

Query: 18  PASETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMV 77
            +S  +S+  SV P   I           +V NLD+S++   L + F+  G +A    + 
Sbjct: 97  KSSTNLSQATSVTPYAKI-----------FVKNLDSSVDVAYLSKLFKKFGSLARESEIF 145

Query: 78  DKNNSNANYAFVEYFQSHD-ANIALQTLNGKQIENNVVKINWAFQ 121
             +N     A+V YF+ ++ A+ A+++L+G+ + N  + I +AF+
Sbjct: 146 HLSNGELRCAYV-YFKDYEKADEAIKSLDGQLVTNKRINIEYAFK 189

>TDEL0G03670 Chr7 complement(675820..677673) [1854 bp, 617 aa] {ON}
           Anc_6.104 YBR212W
          Length = 617

 Score = 72.0 bits (175), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 49/145 (33%), Positives = 73/145 (50%), Gaps = 19/145 (13%)

Query: 83  NANYAFVEYFQSHDANIALQTLNGKQIENNV---------------VKINWAFQS--QQV 125
           +A Y FVE+    DA  AL +LN   + N +                ++NWA  +  Q  
Sbjct: 138 HAGYCFVEFESQQDAQFAL-SLNSGPLPNIISRSTNLPTNPSGQRNFRLNWASGATLQSS 196

Query: 126 SPDEATFNLFVGDLNVDVDDETLRNAFKE-FPTYLQGHVMWDMQTGGSRGYGFVSFGSQE 184
            P    F+LFVGDL+    +  L + F++ F +     VM D  TG SR +GFV FG++E
Sbjct: 197 IPSRPEFSLFVGDLSPTATEADLLSLFQQKFRSVKTVRVMTDPITGASRCFGFVRFGNEE 256

Query: 185 EAQKAMDAMQGHELNGRPLRINWAS 209
           E ++A+  M G    GR LR+ +A+
Sbjct: 257 ERRRALVEMNGVWCQGRCLRVAYAT 281

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 34/77 (44%)

Query: 288 APPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVA 347
            PP  TT +IG +     EA L  L   FG I+  K    K C F+KY+    A   I  
Sbjct: 381 TPPNNTTVFIGGLTPKINEAQLQALFSPFGNILTVKIPQGKNCGFVKYENRIDAEAAIQG 440

Query: 348 LANFPFQGRNLRTGWGK 364
           +  F   G  +R  WG+
Sbjct: 441 MQGFIVGGNPVRLSWGR 457

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 43  DKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQ 102
           +  +++G L   INE  L+  F   G I  VKI   KN       FV+Y    DA  A+Q
Sbjct: 385 NTTVFIGGLTPKINEAQLQALFSPFGNILTVKIPQGKN-----CGFVKYENRIDAEAAIQ 439

Query: 103 TLNGKQIENNVVKINWA 119
            + G  +  N V+++W 
Sbjct: 440 GMQGFIVGGNPVRLSWG 456

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 46/88 (52%), Gaps = 8/88 (9%)

Query: 121 QSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSF 180
           Q+    P+  T  +F+G L   +++  L+  F  F     G+++  ++    +  GFV +
Sbjct: 377 QAYTTPPNNTT--VFIGGLTPKINEAQLQALFSPF-----GNIL-TVKIPQGKNCGFVKY 428

Query: 181 GSQEEAQKAMDAMQGHELNGRPLRINWA 208
            ++ +A+ A+  MQG  + G P+R++W 
Sbjct: 429 ENRIDAEAAIQGMQGFIVGGNPVRLSWG 456

>Skud_2.345 Chr2 (616731..618725) [1995 bp, 664 aa] {ON} YBR212W
           (REAL)
          Length = 664

 Score = 71.6 bits (174), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 70/144 (48%), Gaps = 19/144 (13%)

Query: 84  ANYAFVEYFQSHDANIALQTLNGKQIEN---------------NVVKINWAFQS--QQVS 126
           A Y FVE+    DA  AL +LN   + N                  ++NWA  +  Q   
Sbjct: 127 AGYCFVEFETQKDAQFAL-SLNATPLPNFYSPTTNAQTNPTFKRTFRLNWASGATLQSSI 185

Query: 127 PDEATFNLFVGDLNVDVDDETLRNAFK-EFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEE 185
           P    F+LFVGDL+    +  L + F+  F +     VM D  TG SR +GFV FG+++E
Sbjct: 186 PSTPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGNEDE 245

Query: 186 AQKAMDAMQGHELNGRPLRINWAS 209
            ++A+  M G    GR LR+ +A+
Sbjct: 246 RRRALIEMSGKWFQGRALRVAYAT 269

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 36/79 (45%)

Query: 290 PRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALA 349
           P  TT ++G +     E  L  L + FG I++ +    K C F+K++    A   I  L 
Sbjct: 356 PTNTTVFVGGLVPKTAEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQGLQ 415

Query: 350 NFPFQGRNLRTGWGKERTS 368
            F   G  +R  WG+  +S
Sbjct: 416 GFIVGGSPIRLSWGRPSSS 434

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 50/102 (49%), Gaps = 6/102 (5%)

Query: 107 KQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWD 166
           K+  N+ V+ N    S   + D     +FVG L     +  LR+ FK F     G ++ +
Sbjct: 334 KEGGNSNVRANEFLPSNTYNSDPTNTTVFVGGLVPKTAEFQLRSLFKPF-----GPIL-N 387

Query: 167 MQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWA 208
           ++    +  GFV F  + +A+ ++  +QG  + G P+R++W 
Sbjct: 388 VRIPNGKNCGFVKFEKRIDAEASIQGLQGFIVGGSPIRLSWG 429

 Score = 37.4 bits (85), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 45/90 (50%), Gaps = 7/90 (7%)

Query: 30  VPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFV 89
           +P+N      + ++  ++VG L     E  L+  F+  GPI NV+I   K     N  FV
Sbjct: 347 LPSNTYNS--DPTNTTVFVGGLVPKTAEFQLRSLFKPFGPILNVRIPNGK-----NCGFV 399

Query: 90  EYFQSHDANIALQTLNGKQIENNVVKINWA 119
           ++ +  DA  ++Q L G  +  + ++++W 
Sbjct: 400 KFEKRIDAEASIQGLQGFIVGGSPIRLSWG 429

>Kpol_1026.21 s1026 complement(46606..47919) [1314 bp, 437 aa] {ON}
           complement(46606..47919) [1314 nt, 438 aa]
          Length = 437

 Score = 71.2 bits (173), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 40/178 (22%), Positives = 94/178 (52%), Gaps = 13/178 (7%)

Query: 45  VLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNA-NYAFVEYFQSHDANIALQT 103
            ++VG L  S+++E LK  F+  G +   +++ ++    +  Y +V++     A  A++ 
Sbjct: 179 TIFVGRLSWSVDDEWLKNEFEHIGDVIGARVIYERGTDRSRGYGYVDFSSKSAAERAVKE 238

Query: 104 LNGKQIENNVVKI----------NWAFQSQQVS--PDEATFNLFVGDLNVDVDDETLRNA 151
           ++GKQI+   +            N   ++++    P + +  LF+G+L+ + D + +   
Sbjct: 239 MHGKQIDGREINCDMSTSKPAGGNGGDRAKKFGDVPSQPSDTLFLGNLSFNADRDQIYEL 298

Query: 152 FKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
           F +    +   +    +T   +G+G+V +G+  +AQ A+DA+QG  ++ RP+R+++++
Sbjct: 299 FSKHGEIISVRLPTHPETEQPKGFGYVQYGNVNDAQSALDALQGEYIDNRPVRLDFST 356

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 50/84 (59%)

Query: 126 SPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEE 185
           S D  T  +FVG L+  VDDE L+N F+     +   V+++  T  SRGYG+V F S+  
Sbjct: 172 SNDGETATIFVGRLSWSVDDEWLKNEFEHIGDVIGARVIYERGTDRSRGYGYVDFSSKSA 231

Query: 186 AQKAMDAMQGHELNGRPLRINWAS 209
           A++A+  M G +++GR +  + ++
Sbjct: 232 AERAVKEMHGKQIDGREINCDMST 255

>SAKL0A07370g Chr1 complement(652628..654100) [1473 bp, 490 aa] {ON}
           weakly similar to uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 490

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 93/227 (40%), Gaps = 62/227 (27%)

Query: 44  KVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNN---------------------- 81
           + L++G+LD + +E  ++Q +   G   +VK++  K N                      
Sbjct: 29  RTLWMGDLDPAFDESSIQQIWAALGKSVSVKLIRAKKNLLIPCSTSSTFNAGEDASTAQL 88

Query: 82  ---------------------SNANYAFVEYFQSHDANIALQTLNGKQIEN--------- 111
                                 +A Y FVE+ +  DA  AL TLN   + N         
Sbjct: 89  TDPQKIKINGVSFIDPNTTQLHHAGYCFVEFQKLEDAQWAL-TLNSTPLPNILSNSTHSQ 147

Query: 112 ------NVVKINWAFQS--QQVSPDEATFNLFVGDLNVDVDDETLRNAF-KEFPTYLQGH 162
                    ++NWA  +  Q   P    F+LFVGDL+    +  L + F K F +     
Sbjct: 148 TNPTLQRSFRLNWASGATLQSAIPSTPEFSLFVGDLSPSATEAHLLSLFQKNFKSVKTVR 207

Query: 163 VMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
           VM D  TG SR +GFV F  ++E ++A+  M G    GR LR+ +A+
Sbjct: 208 VMTDPITGASRCFGFVRFADEQERRRALVEMNGVWCQGRCLRVAYAT 254

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 35/76 (46%)

Query: 290 PRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALA 349
           P+ TT +IG +     E  L  L   FG I + +    KGC F+K+++   A   I  + 
Sbjct: 364 PKNTTVFIGGLASQISEPQLYSLFLPFGSITNVRIPQGKGCGFVKFESRIDAEAAIQGMQ 423

Query: 350 NFPFQGRNLRTGWGKE 365
            F   G  +R  WG+ 
Sbjct: 424 GFIVGGNPIRLSWGRS 439

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 40/75 (53%), Gaps = 6/75 (8%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           +F+G L   + +  L + F  F     G +  +++    +G GFV F S+ +A+ A+  M
Sbjct: 369 VFIGGLASQISEPQLYSLFLPF-----GSIT-NVRIPQGKGCGFVKFESRIDAEAAIQGM 422

Query: 194 QGHELNGRPLRINWA 208
           QG  + G P+R++W 
Sbjct: 423 QGFIVGGNPIRLSWG 437

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 50/103 (48%), Gaps = 8/103 (7%)

Query: 27  PSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANY 86
           P+ +P N+    + T+   +++G L + I+E  L   F   G I NV+I   K       
Sbjct: 353 PTSIPKNSYTNPKNTT---VFIGGLASQISEPQLYSLFLPFGSITNVRIPQGKG-----C 404

Query: 87  AFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVSPDE 129
            FV++    DA  A+Q + G  +  N ++++W   S + +P +
Sbjct: 405 GFVKFESRIDAEAAIQGMQGFIVGGNPIRLSWGRSSGEKTPTQ 447

>YBR212W Chr2 (647886..649904) [2019 bp, 672 aa] {ON}  NGR1RNA
           binding protein that negatively regulates growth rate;
           interacts with the 3' UTR of the mitochondrial porin
           (POR1) mRNA and enhances its degradation; overexpression
           impairs mitochondrial function; interacts with Dhh1p to
           mediate POR1 mRNA decay; expressed in stationary phase
          Length = 672

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 69/144 (47%), Gaps = 19/144 (13%)

Query: 84  ANYAFVEYFQSHDANIALQTLNGKQIEN---------------NVVKINWAFQS--QQVS 126
           A Y FVE+    DA  AL +LN   + N                  ++NWA  +  Q   
Sbjct: 128 AGYCFVEFETQKDAKFAL-SLNATPLPNFYSPTTNSQTNPTFKRTFRLNWASGATLQSSI 186

Query: 127 PDEATFNLFVGDLNVDVDDETLRNAFK-EFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEE 185
           P    F+LFVGDL+    +  L + F+  F +     VM D  TG SR +GFV FG ++E
Sbjct: 187 PSTPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGDEDE 246

Query: 186 AQKAMDAMQGHELNGRPLRINWAS 209
            ++A+  M G    GR LR+ +A+
Sbjct: 247 RRRALIEMSGKWFQGRALRVAYAT 270

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 36/79 (45%)

Query: 290 PRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALA 349
           P  TT ++G +     E  L  L + FG I++ +    K C F+K++    A   I  L 
Sbjct: 357 PTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQGLQ 416

Query: 350 NFPFQGRNLRTGWGKERTS 368
            F   G  +R  WG+  +S
Sbjct: 417 GFIVGGSPIRLSWGRPSSS 435

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 50/105 (47%), Gaps = 8/105 (7%)

Query: 104 LNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHV 163
           LN   I N  +++N +  S   + D     +FVG L     +  LR+ FK F   L    
Sbjct: 334 LNEGGISN--MRVNDSLPSNTYNTDPTNTTVFVGGLVPKTTEFQLRSLFKPFGPIL---- 387

Query: 164 MWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWA 208
             +++    +  GFV F  + +A+ ++  +QG  + G P+R++W 
Sbjct: 388 --NVRIPNGKNCGFVKFEKRIDAEASIQGLQGFIVGGSPIRLSWG 430

 Score = 37.7 bits (86), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 45/93 (48%), Gaps = 5/93 (5%)

Query: 40  ETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANI 99
           + ++  ++VG L     E  L+  F+  GPI NV+I   K     N  FV++ +  DA  
Sbjct: 356 DPTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGK-----NCGFVKFEKRIDAEA 410

Query: 100 ALQTLNGKQIENNVVKINWAFQSQQVSPDEATF 132
           ++Q L G  +  + ++++W   S   +   +T 
Sbjct: 411 SIQGLQGFIVGGSPIRLSWGRPSSSNAKTNSTI 443

>Kpol_530.46 s530 complement(104488..106251) [1764 bp, 587 aa] {ON}
           complement(104488..106251) [1764 nt, 588 aa]
          Length = 587

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 50/144 (34%), Positives = 73/144 (50%), Gaps = 19/144 (13%)

Query: 84  ANYAFVEYFQSHDANIALQTLNGKQI------ENNV---------VKINWAFQS--QQVS 126
           A Y FVE+    DA  AL +LN   I       NN+          ++NWA  +  Q   
Sbjct: 164 AGYCFVEFQNQEDAQYAL-SLNSNPIPNILSDSNNLYTNPTGKRNFRLNWASGATLQSSI 222

Query: 127 PDEATFNLFVGDLNVDVDDETLRNAFKE-FPTYLQGHVMWDMQTGGSRGYGFVSFGSQEE 185
           P    F+LFVGDL+    +  L + F++ + +     VM D  TG SR +GF+ FG Q+E
Sbjct: 223 PVTPEFSLFVGDLSPTATEADLLSLFQQQYRSVKTVRVMTDPITGASRCFGFIRFGDQDE 282

Query: 186 AQKAMDAMQGHELNGRPLRINWAS 209
            ++A+  M G    GRPLR+ +A+
Sbjct: 283 RKRALSEMNGVWCQGRPLRVAYAT 306

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 36/73 (49%)

Query: 292 VTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANF 351
           V+T +IG +     E+ +  L + FG I++ K  P K C F+K++    A   I  L  F
Sbjct: 379 VSTVFIGGLSPKINESQVRSLFKPFGNIVNVKLPPGKNCGFVKFENRIDAEAAIQGLQGF 438

Query: 352 PFQGRNLRTGWGK 364
              G  +R  WGK
Sbjct: 439 IVAGNPIRLSWGK 451

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 50/87 (57%), Gaps = 6/87 (6%)

Query: 122 SQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFG 181
           S+  S +E    +F+G L+  +++  +R+ FK F     G+++ +++    +  GFV F 
Sbjct: 370 SKSNSQNELVSTVFIGGLSPKINESQVRSLFKPF-----GNIV-NVKLPPGKNCGFVKFE 423

Query: 182 SQEEAQKAMDAMQGHELNGRPLRINWA 208
           ++ +A+ A+  +QG  + G P+R++W 
Sbjct: 424 NRIDAEAAIQGLQGFIVAGNPIRLSWG 450

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 5/82 (6%)

Query: 45  VLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTL 104
            +++G L   INE  ++  F+  G I NVK+   K     N  FV++    DA  A+Q L
Sbjct: 381 TVFIGGLSPKINESQVRSLFKPFGNIVNVKLPPGK-----NCGFVKFENRIDAEAAIQGL 435

Query: 105 NGKQIENNVVKINWAFQSQQVS 126
            G  +  N ++++W   S   S
Sbjct: 436 QGFIVAGNPIRLSWGKASSMTS 457

>Smik_2.355 Chr2 (633903..636113) [2211 bp, 736 aa] {ON} YBR212W
           (REAL)
          Length = 736

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 70/144 (48%), Gaps = 19/144 (13%)

Query: 84  ANYAFVEYFQSHDANIALQTLNGKQIEN---------------NVVKINWAFQS--QQVS 126
           A Y FVE+    DA  AL +LN   + N                  ++NWA  +  Q   
Sbjct: 127 AGYCFVEFETQTDAQFAL-SLNATPLPNFYSPTTNSQTNPTFKRTFRLNWASGATLQSSI 185

Query: 127 PDEATFNLFVGDLNVDVDDETLRNAFK-EFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEE 185
           P    F+LFVGDL+    +  L + F+  F +     VM D  TG SR +GFV FG+++E
Sbjct: 186 PSTPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGNEDE 245

Query: 186 AQKAMDAMQGHELNGRPLRINWAS 209
            ++A+  M G    GR LR+ +A+
Sbjct: 246 RRRALIEMSGKWFQGRALRVAYAT 269

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 53/112 (47%), Gaps = 9/112 (8%)

Query: 100 ALQTLNGKQI---ENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFP 156
           ALQ ++   +    N+ ++ N +  S   + D     +FVG L     +  LR+ FK F 
Sbjct: 324 ALQNVHSVHLNESSNSNMRQNESLPSNTFNTDPTNTTVFVGGLGPKTTEFQLRSLFKPFG 383

Query: 157 TYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWA 208
             L      +++    +  GFV F  + +A+ ++  +QG  + G P+R++W 
Sbjct: 384 PIL------NVRIPNGKNCGFVKFEKRIDAEASIQGLQGFIVGGSPIRLSWG 429

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 36/79 (45%)

Query: 290 PRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALA 349
           P  TT ++G +     E  L  L + FG I++ +    K C F+K++    A   I  L 
Sbjct: 356 PTNTTVFVGGLGPKTTEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQGLQ 415

Query: 350 NFPFQGRNLRTGWGKERTS 368
            F   G  +R  WG+  +S
Sbjct: 416 GFIVGGSPIRLSWGRPSSS 434

 Score = 38.5 bits (88), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 45/90 (50%), Gaps = 7/90 (7%)

Query: 30  VPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFV 89
           +P+N      + ++  ++VG L     E  L+  F+  GPI NV+I   K     N  FV
Sbjct: 347 LPSNTFN--TDPTNTTVFVGGLGPKTTEFQLRSLFKPFGPILNVRIPNGK-----NCGFV 399

Query: 90  EYFQSHDANIALQTLNGKQIENNVVKINWA 119
           ++ +  DA  ++Q L G  +  + ++++W 
Sbjct: 400 KFEKRIDAEASIQGLQGFIVGGSPIRLSWG 429

>Suva_4.470 Chr4 (818188..820179) [1992 bp, 663 aa] {ON} YBR212W
           (REAL)
          Length = 663

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 70/144 (48%), Gaps = 19/144 (13%)

Query: 84  ANYAFVEYFQSHDANIALQTLNGKQIEN---------------NVVKINWAFQS--QQVS 126
           A Y FVE+    DA  AL +LN   + N                  ++NWA  +  Q   
Sbjct: 127 AGYCFVEFETQKDAQFAL-SLNATPLPNFYSPTTNSQTNSTFKRTFRLNWASGATLQSSI 185

Query: 127 PDEATFNLFVGDLNVDVDDETLRNAFK-EFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEE 185
           P    F+LFVGDL+    +  L + F+  F +     VM D  TG SR +GFV FG+++E
Sbjct: 186 PSTPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGNEDE 245

Query: 186 AQKAMDAMQGHELNGRPLRINWAS 209
            ++A+  M G    GR LR+ +A+
Sbjct: 246 RRRALIEMSGKWFQGRALRVAYAT 269

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 36/79 (45%)

Query: 290 PRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALA 349
           P  TT ++G +     E  L  L + FG I++ +    K C F+K++    A   I  L 
Sbjct: 353 PTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQGLQ 412

Query: 350 NFPFQGRNLRTGWGKERTS 368
            F   G  +R  WG+  +S
Sbjct: 413 GFIVGGSPIRLSWGRPSSS 431

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 41/87 (47%), Gaps = 6/87 (6%)

Query: 122 SQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFG 181
           S   + D     +FVG L     +  LR+ FK F   L      +++    +  GFV F 
Sbjct: 346 SHTYNTDPTNTTVFVGGLVPKTTEFQLRSLFKPFGPIL------NVRIPNGKNCGFVKFE 399

Query: 182 SQEEAQKAMDAMQGHELNGRPLRINWA 208
            + +A+ ++  +QG  + G P+R++W 
Sbjct: 400 KRIDAEASIQGLQGFIVGGSPIRLSWG 426

 Score = 37.7 bits (86), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 41/80 (51%), Gaps = 5/80 (6%)

Query: 40  ETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANI 99
           + ++  ++VG L     E  L+  F+  GPI NV+I   K     N  FV++ +  DA  
Sbjct: 352 DPTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGK-----NCGFVKFEKRIDAEA 406

Query: 100 ALQTLNGKQIENNVVKINWA 119
           ++Q L G  +  + ++++W 
Sbjct: 407 SIQGLQGFIVGGSPIRLSWG 426

>ZYRO0C05060g Chr3 complement(397083..399233) [2151 bp, 716 aa] {ON}
           similar to uniprot|Q75EC3 Ashbya gossypii AAR151W
           AAR151Wp and weakly similar to YBR212W uniprot|P32831
           Saccharomyces cerevisiae YBR212W NGR1 negative growth
           regulatory protein
          Length = 716

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 72/145 (49%), Gaps = 19/145 (13%)

Query: 83  NANYAFVEYFQSHDANIALQTLNGKQIENNV---------------VKINWAFQS--QQV 125
           +A Y FVE+    DA   L +LN   + N +                ++NWA  +  Q  
Sbjct: 157 HAGYCFVEFETQQDAQFGL-SLNSTPLPNFISQSSGLATNPTGQRNFRLNWASGATLQSS 215

Query: 126 SPDEATFNLFVGDLNVDVDDETLRNAFKE-FPTYLQGHVMWDMQTGGSRGYGFVSFGSQE 184
            P    F+LFVGDL+    +  L + F++ F +     VM D  TG SR +GFV FG++E
Sbjct: 216 IPSRPEFSLFVGDLSPTATEADLLSLFQQKFKSVKTVRVMTDPITGASRCFGFVRFGNEE 275

Query: 185 EAQKAMDAMQGHELNGRPLRINWAS 209
           E ++A+  M G    GR LR+ +A+
Sbjct: 276 ERRRALVEMNGVWCQGRCLRVAYAT 300

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 44/87 (50%), Gaps = 6/87 (6%)

Query: 122 SQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFG 181
           +Q  + D     +F+G L   +++  L+  F  F     G+++  ++    +  GFV F 
Sbjct: 411 AQAYTTDPNNTTVFIGGLTPKINENQLQTLFSPF-----GNIL-TVKIPQGKNCGFVKFE 464

Query: 182 SQEEAQKAMDAMQGHELNGRPLRINWA 208
            + +A+ A+  MQG  + G P+R++W 
Sbjct: 465 KRIDAEAAIQGMQGFVVGGCPIRLSWG 491

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 33/79 (41%)

Query: 290 PRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALA 349
           P  TT +IG +     E  L  L   FG I+  K    K C F+K++    A   I  + 
Sbjct: 418 PNNTTVFIGGLTPKINENQLQTLFSPFGNILTVKIPQGKNCGFVKFEKRIDAEAAIQGMQ 477

Query: 350 NFPFQGRNLRTGWGKERTS 368
            F   G  +R  WG+   S
Sbjct: 478 GFVVGGCPIRLSWGRNTVS 496

 Score = 37.7 bits (86), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 43  DKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQ 102
           +  +++G L   INE  L+  F   G I  VKI   K     N  FV++ +  DA  A+Q
Sbjct: 420 NTTVFIGGLTPKINENQLQTLFSPFGNILTVKIPQGK-----NCGFVKFEKRIDAEAAIQ 474

Query: 103 TLNGKQIENNVVKINWA 119
            + G  +    ++++W 
Sbjct: 475 GMQGFVVGGCPIRLSWG 491

>ZYRO0G07326g Chr7 complement(577044..578450) [1407 bp, 468 aa] {ON}
           some similarities with uniprot|P27476 Saccharomyces
           cerevisiae YGR159C NSR1 Nucleolar protein that binds
           nuclear localization sequences required for pre-rRNA
           processing and ribosome biogenesis
          Length = 468

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/178 (20%), Positives = 94/178 (52%), Gaps = 13/178 (7%)

Query: 45  VLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNAN-YAFVEYFQSHDANIALQT 103
            ++VG L  +I+++ LK  F+  G + + +++ ++ ++ +  Y +V++     A  A++ 
Sbjct: 237 TIFVGRLSWNIDDQWLKNEFEHIGGVQSARVIYERGSTRSRGYGYVDFTDKSYAEKAVKE 296

Query: 104 LNGKQIENNVVKINWAFQSQQVSP------------DEATFNLFVGDLNVDVDDETLRNA 151
           ++GK+++   +  + +     V+P             E +  LF+G+L+ + D + +   
Sbjct: 297 MHGKELDGRPINCDMSTSKPTVNPREDRAKRFGDMPSEPSDTLFLGNLSFNADRDQIYEL 356

Query: 152 FKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
           F      +   +    +T   +G+G+V + S + AQKA++ +QG  ++ RP+R+++++
Sbjct: 357 FSPHGEVISVRIPTHPETEQPKGFGYVQYASVDSAQKALETLQGEYIDNRPVRLDFST 414

>Ecym_3082 Chr3 complement(152514..154274) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii AAR151W
          Length = 586

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 96/228 (42%), Gaps = 59/228 (25%)

Query: 40  ETSD---KVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNN--------------- 81
           +TSD   + L++G+LD S +E  ++Q +   G    VK++  K N               
Sbjct: 15  QTSDEPPRTLWMGDLDPSFDETTIQQIWMTLGHQVQVKLIRAKKNLLIPCSTSSTLASSQ 74

Query: 82  ----------------------SNANYAFVEYFQSHDANIALQTLNGKQIENNV------ 113
                                  +A Y FV++    +A   LQ LN   + N +      
Sbjct: 75  HVEDERIQINGVSFIDPNTTQLHHAGYCFVQFPSLQEAQAGLQ-LNSTPLPNLISSTTHN 133

Query: 114 ---------VKINWAFQS--QQVSPDEATFNLFVGDLNVDVDDETLRNAFK-EFPTYLQG 161
                     ++NWA  +  Q   P    F+LFVGDL+    +  L + F+ +F +    
Sbjct: 134 PTNPTAKRNFRLNWASGATLQSDIPTTPEFSLFVGDLSPTATEAHLLSLFQTKFKSVKTV 193

Query: 162 HVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
            VM D  TG SR +GFV F  ++E ++A+  M G    GR LR+ +A+
Sbjct: 194 RVMTDPITGASRCFGFVRFADEQERRRALVEMNGIWCQGRQLRVAYAT 241

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 35/75 (46%)

Query: 290 PRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALA 349
           P  TT +IG + +   E+ L  L   FG I+  K  P KGC F+K++    A   I  + 
Sbjct: 395 PSNTTVFIGGLNNQITESQLQSLFMPFGNILSVKVPPGKGCGFVKFEHRLDAEAAIQGMQ 454

Query: 350 NFPFQGRNLRTGWGK 364
            F      +R  WG+
Sbjct: 455 GFIVGNSAIRLSWGR 469

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 42/81 (51%), Gaps = 6/81 (7%)

Query: 128 DEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQ 187
           D +   +F+G LN  + +  L++ F  F     G+++  ++    +G GFV F  + +A+
Sbjct: 394 DPSNTTVFIGGLNNQITESQLQSLFMPF-----GNIL-SVKVPPGKGCGFVKFEHRLDAE 447

Query: 188 KAMDAMQGHELNGRPLRINWA 208
            A+  MQG  +    +R++W 
Sbjct: 448 AAIQGMQGFIVGNSAIRLSWG 468

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 42/85 (49%), Gaps = 5/85 (5%)

Query: 35  IKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQS 94
           + G  + S+  +++G L+  I E  L+  F   G I +VK+   K        FV++   
Sbjct: 389 VPGYTDPSNTTVFIGGLNNQITESQLQSLFMPFGNILSVKVPPGK-----GCGFVKFEHR 443

Query: 95  HDANIALQTLNGKQIENNVVKINWA 119
            DA  A+Q + G  + N+ ++++W 
Sbjct: 444 LDAEAAIQGMQGFIVGNSAIRLSWG 468

>NCAS0B07240 Chr2 (1369481..1371313) [1833 bp, 610 aa] {ON}
           Anc_1.357
          Length = 610

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 48/72 (66%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           LF+GDLN DV  ETL + F  +P+++   V +D QT  S G+G+++FG +E+A+KA+D  
Sbjct: 103 LFIGDLNEDVTKETLESIFGVYPSFVSAKVCYDFQTNVSLGHGYLNFGDKEDAEKAIDDF 162

Query: 194 QGHELNGRPLRI 205
              +L  + +RI
Sbjct: 163 NCMKLGDKVIRI 174

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/143 (21%), Positives = 68/143 (47%), Gaps = 4/143 (2%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVD-KNNSNANYAFVEYFQSHDANIALQTL 104
           L++G+L+  + +E L+  F V     + K+  D + N +  + ++ +    DA  A+   
Sbjct: 103 LFIGDLNEDVTKETLESIFGVYPSFVSAKVCYDFQTNVSLGHGYLNFGDKEDAEKAIDDF 162

Query: 105 NGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVM 164
           N  ++ + V++I  + + +       T N+F    N+  +D  L ++ K F  + Q   +
Sbjct: 163 NCMKLGDKVIRIMPSLRGKNTKKSIGT-NVFFT--NLPDEDNRLFHSRKFFEIFRQFGKI 219

Query: 165 WDMQTGGSRGYGFVSFGSQEEAQ 187
              +   ++  GF+SF  +E A+
Sbjct: 220 LSCRLDPNKNIGFISFEHEEVAK 242

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 43  DKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQ 102
           +  ++V NL TSI  E ++ +F   G I N+  + DK +SNA +AFV+Y  +  A  A++
Sbjct: 310 ENTVFVSNLPTSITVEEIRNHFNKIGNIMNL-FISDKISSNALWAFVKYSTAACAIRAIK 368

Query: 103 TLNGKQIENNVVKINWAFQ 121
            LN   I    + ++ AF+
Sbjct: 369 ELNNTFIRKKQIVVSQAFR 387

>TBLA0A09920 Chr1 (2434186..2435970) [1785 bp, 594 aa] {ON}
           Anc_6.104 YBR212W
          Length = 594

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 75/155 (48%), Gaps = 22/155 (14%)

Query: 76  MVDKNNS---NANYAFVEYFQSHDANIALQTLNGKQI---------------ENNVVKIN 117
            +D N +   +A Y FVE+    DA  AL +LN   I                N   ++N
Sbjct: 118 FIDPNTTQLHHAGYCFVEFANQVDAKFAL-SLNSSPIPNFYSSSISLHTNPNNNRNFRLN 176

Query: 118 WAFQSQQVS--PDEATFNLFVGDLNVDVDDETLRNAF-KEFPTYLQGHVMWDMQTGGSRG 174
           WA  +   S  P    F+LFVGDL+  V +  L + F K+F +     VM D  TG SR 
Sbjct: 177 WASGATLNSSIPLTPEFSLFVGDLSPLVTEADLLSLFQKKFKSVKTVRVMTDPITGTSRC 236

Query: 175 YGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
           +GF+ F  + E + A+  M G   NGRPLR+ +A+
Sbjct: 237 FGFIRFTDELERKNALIEMNGIWCNGRPLRVAYAT 271

>Kwal_14.1851 s14 complement(494548..496155) [1608 bp, 535 aa] {ON}
           YBR212W (NGR1) - negative growth regulatory protein
           [contig 235] FULL
          Length = 535

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 80/165 (48%), Gaps = 24/165 (14%)

Query: 68  GPIANVK--IMVDKNNS---NANYAFVEYFQSHDANIALQTLNGKQIENNVV-------- 114
           GP  N+     +D N +   +A Y FVE+    DA  AL TLN   + +           
Sbjct: 89  GPKININGVSFIDPNTTQLHHAGYCFVEFESLADAQWAL-TLNSSPLPDITCGNGHVSTN 147

Query: 115 -------KINWAFQSQQVS--PDEATFNLFVGDLNVDVDDETLRNAF-KEFPTYLQGHVM 164
                  ++NWA  +  +S  P    F+LFVGDL+    +  L + F K+F +     VM
Sbjct: 148 PSGLRNFRLNWASGATLLSAIPSTPEFSLFVGDLSPTATEAHLLSLFQKKFKSVKTVRVM 207

Query: 165 WDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
            D  TG SR +GFV FG ++E ++A+  M G    GR LR+ +A+
Sbjct: 208 TDPITGASRCFGFVRFGDEQERRRALVEMNGVWCQGRNLRVAYAT 252

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 34/75 (45%)

Query: 290 PRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALA 349
           P  TT +IG +     E  L  L   FG II+ K  P KGC F+KY     A   I  + 
Sbjct: 393 PNNTTVFIGGLTSQISERQLHSLFSPFGAIINVKIPPGKGCGFVKYAYRIDAEAAIQGMQ 452

Query: 350 NFPFQGRNLRTGWGK 364
            F   G  +R  WG+
Sbjct: 453 GFIVGGNPIRLSWGR 467

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 46/95 (48%), Gaps = 11/95 (11%)

Query: 119 AFQSQQVSPDEATFN-----LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSR 173
           AF +Q  +P  A  N     +F+G L   + +  L + F  F   +      +++    +
Sbjct: 378 AFMAQPTAPRSAFTNPNNTTVFIGGLTSQISERQLHSLFSPFGAII------NVKIPPGK 431

Query: 174 GYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWA 208
           G GFV +  + +A+ A+  MQG  + G P+R++W 
Sbjct: 432 GCGFVKYAYRIDAEAAIQGMQGFIVGGNPIRLSWG 466

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 38/80 (47%), Gaps = 5/80 (6%)

Query: 43  DKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQ 102
           +  +++G L + I+E  L   F   G I NVKI   K        FV+Y    DA  A+Q
Sbjct: 395 NTTVFIGGLTSQISERQLHSLFSPFGAIINVKIPPGK-----GCGFVKYAYRIDAEAAIQ 449

Query: 103 TLNGKQIENNVVKINWAFQS 122
            + G  +  N ++++W   S
Sbjct: 450 GMQGFIVGGNPIRLSWGRTS 469

>Skud_6.107 Chr6 (195514..197349) [1836 bp, 611 aa] {ON} YFR023W
           (REAL)
          Length = 611

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 56/87 (64%), Gaps = 6/87 (6%)

Query: 119 AFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFV 178
            F+S+++ P      LF+GDL+  V +ETL+  F +FP+++   V  D  T  S G+G++
Sbjct: 84  VFESKKLIP------LFIGDLHETVTEETLKGIFGKFPSFVSAKVCLDSVTKKSLGHGYL 137

Query: 179 SFGSQEEAQKAMDAMQGHELNGRPLRI 205
           +F  +EEA++AM+ +   ++NGR +RI
Sbjct: 138 NFEDKEEAERAMEELNYTDVNGREIRI 164

>YHR086W Chr8 (278153..279724) [1572 bp, 523 aa] {ON}  NAM8RNA
           binding protein, component of the U1 snRNP protein;
           mutants are defective in meiotic recombination and in
           formation of viable spores, involved in the formation of
           DSBs through meiosis-specific splicing of REC107
           pre-mRNA; Nam8p regulon embraces the meiotic pre-mRNAs
           of REC107, HFM1, AMA1 SPO22 and PCH2; the putative RNA
           binding domains RRM2 and RRM3 are required for Nam8p
           meiotic function
          Length = 523

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 93/190 (48%), Gaps = 28/190 (14%)

Query: 41  TSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNS-------------NANYA 87
           T+   LY+G+LD + ++  ++Q +   G  AN+ + +  NN+             N  Y 
Sbjct: 51  TTGNQLYMGDLDPTWDKNTVRQIWASLGE-ANINVRMMWNNTLNNGSRSSMGPKNNQGYC 109

Query: 88  FVEYFQS-HDANIALQTLNGKQIEN---NVVKINWAFQSQQVSPDEA-------TFNLFV 136
           FV++  S H AN  L+  NG  I N     +K+NWA  S   S +           ++FV
Sbjct: 110 FVDFPSSTHAANALLK--NGMLIPNFPNKKLKLNWATSSYSNSNNSLNNVKSGNNCSIFV 167

Query: 137 GDLNVDVDDETLRNAF-KEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQG 195
           GDL  +V +  L   F   + +     ++ D  TG S+GYGFV F + +E Q A+  MQG
Sbjct: 168 GDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSEMQG 227

Query: 196 HELNGRPLRI 205
             LNGR +++
Sbjct: 228 VFLNGRAIKV 237

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 32/76 (42%)

Query: 290 PRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALA 349
           P  TT +IG +     E +L    Q FG I+  K    K C F++Y     A   I  + 
Sbjct: 310 PNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKCCGFVQYVDRLSAEAAIAGMQ 369

Query: 350 NFPFQGRNLRTGWGKE 365
            FP     +R  WG+ 
Sbjct: 370 GFPIANSRVRLSWGRS 385

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 5/84 (5%)

Query: 43  DKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQ 102
           +  +++G L + + E+ L+ YFQ  G I  VKI V K        FV+Y     A  A+ 
Sbjct: 312 NTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGK-----CCGFVQYVDRLSAEAAIA 366

Query: 103 TLNGKQIENNVVKINWAFQSQQVS 126
            + G  I N+ V+++W   ++Q +
Sbjct: 367 GMQGFPIANSRVRLSWGRSAKQTA 390

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 40/82 (48%), Gaps = 8/82 (9%)

Query: 127 PDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEA 186
           P+  T  +F+G L+  V ++ LR  F+ F T     V   +  G  +  GFV +  +  A
Sbjct: 310 PNNTT--VFIGGLSSLVTEDELRAYFQPFGTI----VYVKIPVG--KCCGFVQYVDRLSA 361

Query: 187 QKAMDAMQGHELNGRPLRINWA 208
           + A+  MQG  +    +R++W 
Sbjct: 362 EAAIAGMQGFPIANSRVRLSWG 383

>Kwal_26.7493 s26 (387735..388400) [666 bp, 222 aa] {OFF} YGR159C
           (NSR1) - nuclear localization sequence binding protein
           [contig 667] PARTIAL
          Length = 222

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 77/136 (56%), Gaps = 12/136 (8%)

Query: 86  YAFVEYFQSHDANIALQTLNGKQIENNVVKINWAF----------QSQQV--SPDEATFN 133
           Y +V++     A  A++ ++GK+I+   + ++ +           +++Q   +P + +  
Sbjct: 11  YGYVDFEDKSYAEKAVKEMHGKEIDGRPINVDMSTSKPAGNPRNDRAKQYGDTPSQPSDT 70

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           LF+G+L+ + + + +   F E+   +   +    +T   +G+G+V + S E AQKA+DA+
Sbjct: 71  LFLGNLSFNTERDNVFEIFSEYGDVVSVRLPTHPETNQPKGFGYVQYSSVENAQKALDAL 130

Query: 194 QGHELNGRPLRINWAS 209
           QGH ++ RP+R+++++
Sbjct: 131 QGHYIDNRPVRLDFST 146

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 28/41 (68%)

Query: 169 TGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
           T  SRGYG+V F  +  A+KA+  M G E++GRP+ ++ ++
Sbjct: 5   TDRSRGYGYVDFEDKSYAEKAVKEMHGKEIDGRPINVDMST 45

 Score = 33.9 bits (76), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 39/76 (51%), Gaps = 1/76 (1%)

Query: 45  VLYVGNLDTSINEEILKQYFQVGGPIANVKIMVD-KNNSNANYAFVEYFQSHDANIALQT 103
            L++GNL  +   + + + F   G + +V++    + N    + +V+Y    +A  AL  
Sbjct: 70  TLFLGNLSFNTERDNVFEIFSEYGDVVSVRLPTHPETNQPKGFGYVQYSSVENAQKALDA 129

Query: 104 LNGKQIENNVVKINWA 119
           L G  I+N  V+++++
Sbjct: 130 LQGHYIDNRPVRLDFS 145

>AAR151W Chr1 (617434..618879) [1446 bp, 481 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR212W (NGR1)
          Length = 481

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/220 (26%), Positives = 92/220 (41%), Gaps = 55/220 (25%)

Query: 44  KVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNN---------------------- 81
           + L++G+LD S +E  ++  +   G    VK++  K N                      
Sbjct: 22  RTLWMGDLDPSFDEATIQHVWLTVGHQVQVKLIRAKKNLLIPCSTSSTLSASHVDEERIQ 81

Query: 82  --------------SNANYAFVEYFQSHDANIALQTLNGKQIENNV-------------- 113
                          +A Y FV++    +A   LQ LN   + N V              
Sbjct: 82  INGVSFIDPNTTQLHHAGYCFVQFANLQEAQAGLQ-LNATPLPNVVSPTTRNPTNPTGKR 140

Query: 114 -VKINWAFQSQQVSPDEAT--FNLFVGDLNVDVDDETLRNAFK-EFPTYLQGHVMWDMQT 169
             ++NWA  +   S   AT  F+LFVGDL+    +  L + F+ +F +     VM D  T
Sbjct: 141 NFRLNWASGATLQSDIPATPEFSLFVGDLSPTATEAHLLSLFQTKFKSVKTVRVMTDPIT 200

Query: 170 GGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
           G SR +GFV F  ++E ++A+  M G    GR LR+ +A+
Sbjct: 201 GASRCFGFVRFADEKERRRALAEMNGVWCQGRQLRVAYAT 240

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 34/72 (47%)

Query: 293 TTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 352
           TT +IG + +   E  L  L   FG I+  K  P +GC F++++    A   I  +  F 
Sbjct: 326 TTVFIGGLSNMISEGQLHALFMPFGNILSVKVPPGRGCGFVRFENRMDAEAAIQGMQGFI 385

Query: 353 FQGRNLRTGWGK 364
             G  +R  WG+
Sbjct: 386 VGGNAIRLSWGR 397

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 45/86 (52%), Gaps = 6/86 (6%)

Query: 123 QQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGS 182
           +Q+  D A   +F+G L+  + +  L   F  F     G+++  ++    RG GFV F +
Sbjct: 317 RQLPADTANTTVFIGGLSNMISEGQLHALFMPF-----GNIL-SVKVPPGRGCGFVRFEN 370

Query: 183 QEEAQKAMDAMQGHELNGRPLRINWA 208
           + +A+ A+  MQG  + G  +R++W 
Sbjct: 371 RMDAEAAIQGMQGFIVGGNAIRLSWG 396

 Score = 37.7 bits (86), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 38/80 (47%), Gaps = 5/80 (6%)

Query: 40  ETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANI 99
           +T++  +++G L   I+E  L   F   G I +VK+   +        FV +    DA  
Sbjct: 322 DTANTTVFIGGLSNMISEGQLHALFMPFGNILSVKVPPGRG-----CGFVRFENRMDAEA 376

Query: 100 ALQTLNGKQIENNVVKINWA 119
           A+Q + G  +  N ++++W 
Sbjct: 377 AIQGMQGFIVGGNAIRLSWG 396

>Suva_6.95 Chr6 (165163..167004) [1842 bp, 613 aa] {ON} YFR023W
           (REAL)
          Length = 613

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 56/87 (64%), Gaps = 6/87 (6%)

Query: 119 AFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFV 178
            F+S+++ P      LF+GDL+  V +ETL++ F ++P+++   V  D  +  S G+G++
Sbjct: 84  VFESKKLVP------LFIGDLHETVTEETLKDVFGKYPSFVSAKVCLDSVSKKSLGHGYL 137

Query: 179 SFGSQEEAQKAMDAMQGHELNGRPLRI 205
           +F  +EEA KAM+ +   E+NG+ +RI
Sbjct: 138 NFEDKEEAGKAMEELNYTEVNGKEIRI 164

>CAGL0K06655g Chr11 (648911..651319) [2409 bp, 802 aa] {ON} similar
           to uniprot|P32831 Saccharomyces cerevisiae YBR212w
           Negative growth regulatory protein
          Length = 802

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 69/143 (48%), Gaps = 17/143 (11%)

Query: 84  ANYAFVEYFQSHDANIAL-----------QTLNGKQIE---NNVVKINWAFQS--QQVSP 127
           A Y FVE+    DA   L            T  G+ I        ++NWA  +  Q   P
Sbjct: 170 AGYCFVEFESQKDAQEGLALNSTPLPNFVSTTTGQDINPTGQRTFRLNWASGATLQSSIP 229

Query: 128 DEATFNLFVGDLNVDVDDETLRNAFK-EFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEA 186
               ++LFVGDL+    +  L + F+ +F +     VM D  TG SR +GFV FG++EE 
Sbjct: 230 TTPEYSLFVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFGNEEER 289

Query: 187 QKAMDAMQGHELNGRPLRINWAS 209
           ++A+  M G    GR LR+ +A+
Sbjct: 290 RRALIEMNGVHFQGRTLRVAYAT 312

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 33/75 (44%)

Query: 290 PRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALA 349
           P  TT ++G +     E  L  + Q FG I+  K  P K C F+K++    A   I  L 
Sbjct: 464 PTNTTVFVGGLGPTVQEQQLRKIFQPFGNILSIKIPPGKNCGFVKFEHKIDAEAAIQGLQ 523

Query: 350 NFPFQGRNLRTGWGK 364
            F      +R  WG+
Sbjct: 524 GFVLVENPIRLSWGR 538

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 49/102 (48%), Gaps = 15/102 (14%)

Query: 116 INWAFQSQQVS---------PDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWD 166
           IN +F + QVS          D     +FVG L   V ++ LR  F+ F     G+++  
Sbjct: 442 INTSFVNTQVSEAALNDFFATDPTNTTVFVGGLGPTVQEQQLRKIFQPF-----GNIL-S 495

Query: 167 MQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWA 208
           ++    +  GFV F  + +A+ A+  +QG  L   P+R++W 
Sbjct: 496 IKIPPGKNCGFVKFEHKIDAEAAIQGLQGFVLVENPIRLSWG 537

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 42  SDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIAL 101
           ++  ++VG L  ++ E+ L++ FQ  G I ++KI   K     N  FV++    DA  A+
Sbjct: 465 TNTTVFVGGLGPTVQEQQLRKIFQPFGNILSIKIPPGK-----NCGFVKFEHKIDAEAAI 519

Query: 102 QTLNGKQIENNVVKINWA 119
           Q L G  +  N ++++W 
Sbjct: 520 QGLQGFVLVENPIRLSWG 537

>KAFR0G02320 Chr7 complement(483040..484902) [1863 bp, 620 aa] {ON}
           Anc_6.104 YBR212W
          Length = 620

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 99/242 (40%), Gaps = 60/242 (24%)

Query: 26  EPSV-VPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDK----- 79
           EP V +P  A     +   + L++G+LD + +E  +K+ ++  G   ++K++  K     
Sbjct: 18  EPEVPLPPFATVSTSDEPPRTLWMGDLDPTFDELTIKEIWKRLGKNVSIKLVRAKKNLLI 77

Query: 80  ------NNSNAN-----------------------------YAFVEYFQSHDANIALQTL 104
                 NNS  N                             Y F+E+    DA   L +L
Sbjct: 78  PCSSFTNNSGGNSKNETEESSITINGISFIDPMTTQLHHAGYCFIEFDSLKDAQFGL-SL 136

Query: 105 NGKQIEN---------------NVVKINWAFQS--QQVSPDEATFNLFVGDLNVDVDDET 147
           N K I N                  ++NWA  +  Q   P    ++LFVGDL+    +  
Sbjct: 137 NSKPIPNFKSISTELETNPSGQRTFRLNWASGATLQSSIPTTPEYSLFVGDLSPMTTEAD 196

Query: 148 LRNAF-KEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRIN 206
           L   F K F +     VM D  TG SR +GF+    + E ++A+D M G  L+GR LR+ 
Sbjct: 197 LLKLFQKTFKSVKTVRVMTDPITGESRCFGFIRLSDEFEREEALDKMNGTLLHGRQLRVA 256

Query: 207 WA 208
            A
Sbjct: 257 LA 258

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 43/80 (53%), Gaps = 6/80 (7%)

Query: 128 DEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQ 187
           D     +FVG+LN  + ++ L+  F+ F        +  ++    +  GFV F ++ +A+
Sbjct: 318 DPTNTTVFVGNLNCKITEDELQKVFEPF------GAIEKVKIPPGKKCGFVKFCNKIDAE 371

Query: 188 KAMDAMQGHELNGRPLRINW 207
            +M  +QG+ + G P+RI+W
Sbjct: 372 ASMYGLQGYFVAGSPIRISW 391

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 44/89 (49%), Gaps = 5/89 (5%)

Query: 30  VPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFV 89
           V +N      + ++  ++VGNL+  I E+ L++ F+  G I  VKI   K        FV
Sbjct: 308 VKSNEDHSDNDPTNTTVFVGNLNCKITEDELQKVFEPFGAIEKVKIPPGK-----KCGFV 362

Query: 90  EYFQSHDANIALQTLNGKQIENNVVKINW 118
           ++    DA  ++  L G  +  + ++I+W
Sbjct: 363 KFCNKIDAEASMYGLQGYFVAGSPIRISW 391

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 33/74 (44%)

Query: 290 PRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALA 349
           P  TT ++GN+     E +L  + + FG I   K  P K C F+K+     A   +  L 
Sbjct: 319 PTNTTVFVGNLNCKITEDELQKVFEPFGAIEKVKIPPGKKCGFVKFCNKIDAEASMYGLQ 378

Query: 350 NFPFQGRNLRTGWG 363
            +   G  +R  WG
Sbjct: 379 GYFVAGSPIRISWG 392

>Suva_15.280 Chr15 (480600..482225) [1626 bp, 541 aa] {ON} YHR086W
           (REAL)
          Length = 541

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 57/193 (29%), Positives = 93/193 (48%), Gaps = 30/193 (15%)

Query: 41  TSDKVLYVGNLDTSINEEILKQYF-QVGGPIANVKIMVDKN-----------NSNANYAF 88
           T+   LY+G+LD + ++  + Q +  +G    NV++M +              +N  Y F
Sbjct: 54  TAGNQLYMGDLDPTWDKNTISQIWGSLGEANINVRMMWNNPSNSSSRPSMGPKNNQGYCF 113

Query: 89  VEYFQS-HDANIALQTLNGKQIE---NNVVKINWAFQSQQVSPDEA-----------TFN 133
           V++  S H AN  L+  NG  I    N  +K+NWA  S     +              ++
Sbjct: 114 VDFPSSTHAANALLK--NGMIIPSFPNKKLKLNWATSSYSNGNNGGNNSISNSKSGNNYS 171

Query: 134 LFVGDLNVDVDDETLRNAF-KEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDA 192
           +FVGDL  +V +  L + F   + +     ++ D  TG S+GYGFV F + +E Q A+  
Sbjct: 172 IFVGDLAPNVTESQLFDLFITRYASAFHAKIVHDQVTGMSKGYGFVKFSNADEQQLALSE 231

Query: 193 MQGHELNGRPLRI 205
           MQG  LNGR +++
Sbjct: 232 MQGVFLNGRAIKV 244

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%)

Query: 290 PRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALA 349
           P  TT +IG +     E +L    Q FG I+  K    KGC F++Y     A   I  + 
Sbjct: 320 PNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKGCGFVQYVDRLSAETAIAGMQ 379

Query: 350 NFPFQGRNLRTGWGKE 365
            FP     +R  WG+ 
Sbjct: 380 GFPIANSRVRLSWGRS 395

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 44/85 (51%), Gaps = 5/85 (5%)

Query: 42  SDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIAL 101
           ++  +++G L + + E+ L+ YFQ  G I  VKI V K        FV+Y     A  A+
Sbjct: 321 NNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGK-----GCGFVQYVDRLSAETAI 375

Query: 102 QTLNGKQIENNVVKINWAFQSQQVS 126
             + G  I N+ V+++W   ++Q +
Sbjct: 376 AGMQGFPIANSRVRLSWGRSAKQTA 400

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 8/82 (9%)

Query: 127 PDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEA 186
           P+  T  +F+G L+  V ++ LR  F+ F T     V   +  G  +G GFV +  +  A
Sbjct: 320 PNNTT--VFIGGLSSLVTEDELRAYFQPFGTI----VYVKIPVG--KGCGFVQYVDRLSA 371

Query: 187 QKAMDAMQGHELNGRPLRINWA 208
           + A+  MQG  +    +R++W 
Sbjct: 372 ETAIAGMQGFPIANSRVRLSWG 393

>KLLA0C05522g Chr3 (494240..495862) [1623 bp, 540 aa] {ON} some
           similarities with uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 540

 Score = 65.5 bits (158), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 92/219 (42%), Gaps = 54/219 (24%)

Query: 44  KVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNS--------------------- 82
           + L++G+LD   +E I+   +Q  G    VK++  K N+                     
Sbjct: 20  RTLWMGDLDPGFDELIIASIWQSLGKSVKVKLIKSKTNALVPINSTSIPNNASSNALEIN 79

Query: 83  -------------NANYAFVEYFQSHDANIALQTLNGKQIEN----------------NV 113
                        +A Y FVE+    DA  AL TLN   I N                  
Sbjct: 80  GVSFIDPNKTNLHHAGYCFVEFESFEDAQQAL-TLNATPIPNISCNTTASKRTNDDGKRK 138

Query: 114 VKINWAFQSQQVSPDEAT--FNLFVGDLNVDVDDETLRNAFK-EFPTYLQGHVMWDMQTG 170
            ++NWA  +   S    T  F+LFVGDL+    +  L + F+ ++ +     VM D  TG
Sbjct: 139 FRLNWANGATLHSTILPTPEFSLFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITG 198

Query: 171 GSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
            SR +GFV F ++ E + A+  M G +  GR LR+ +A+
Sbjct: 199 ASRCFGFVRFANETERRNALIEMNGVQFQGRQLRVAYAT 237

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 34/72 (47%)

Query: 293 TTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 352
           TT ++G +     E  L  L + FG I D K  P K C F+KY+   +A   I  L  F 
Sbjct: 445 TTVFVGGLNPNINELQLFELFKPFGTITDVKIPPGKQCGFVKYNERLEAEAAINGLQGFI 504

Query: 353 FQGRNLRTGWGK 364
             G  +R  WG+
Sbjct: 505 IMGSPIRLSWGR 516

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 42/75 (56%), Gaps = 6/75 (8%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           +FVG LN ++++  L   FK F T      + D++    +  GFV +  + EA+ A++ +
Sbjct: 447 VFVGGLNPNINELQLFELFKPFGT------ITDVKIPPGKQCGFVKYNERLEAEAAINGL 500

Query: 194 QGHELNGRPLRINWA 208
           QG  + G P+R++W 
Sbjct: 501 QGFIIMGSPIRLSWG 515

 Score = 37.7 bits (86), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 44/87 (50%), Gaps = 7/87 (8%)

Query: 33  NAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYF 92
           NA+  G   S   ++VG L+ +INE  L + F+  G I +VKI   K        FV+Y 
Sbjct: 436 NAMNAG--VSSTTVFVGGLNPNINELQLFELFKPFGTITDVKIPPGK-----QCGFVKYN 488

Query: 93  QSHDANIALQTLNGKQIENNVVKINWA 119
           +  +A  A+  L G  I  + ++++W 
Sbjct: 489 ERLEAEAAINGLQGFIIMGSPIRLSWG 515

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 7/80 (8%)

Query: 294 TAYIGNIPHFAIEADLIPLLQ---NFGFIIDFKHYPEKGC--C--FIKYDTHEQAAVCIV 346
           + ++G++  FA EADL+ L Q   N    +     P  G   C  F+++    +    ++
Sbjct: 160 SLFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITGASRCFGFVRFANETERRNALI 219

Query: 347 ALANFPFQGRNLRTGWGKER 366
            +    FQGR LR  +   R
Sbjct: 220 EMNGVQFQGRQLRVAYATPR 239

>KLTH0H06842g Chr8 complement(600623..602266) [1644 bp, 547 aa] {ON}
           some similarities with uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 547

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/117 (36%), Positives = 65/117 (55%), Gaps = 6/117 (5%)

Query: 96  DANIALQTLNGKQIENNVVKINWAFQSQQVS--PDEATFNLFVGDLNVDVDDETLRNAF- 152
           DA+  L+T N   + N   ++NWA  +  +S  P    F+LFVGDL+    +  L + F 
Sbjct: 140 DASSPLRT-NPTGLRN--FRLNWASGATLLSAIPSTPEFSLFVGDLSPTATEAHLLSLFQ 196

Query: 153 KEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
           K+F +     VM D  TG SR +GFV FG ++E ++A+  M G    GR LR+ +A+
Sbjct: 197 KKFKSVKTVRVMTDPITGASRCFGFVRFGDEQERRRALVEMNGVWCQGRNLRVAYAT 253

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 35/78 (44%)

Query: 290 PRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALA 349
           P  TT +IG +     E  L  L   FG II+ K  P KGC F+KY     A   I  + 
Sbjct: 403 PNNTTVFIGGLTSHTSERQLHSLFAPFGTIINVKIPPGKGCGFVKYAYRIDAEAAIQGMQ 462

Query: 350 NFPFQGRNLRTGWGKERT 367
            F   G  +R  WG+  T
Sbjct: 463 GFIVGGNPIRLSWGRTST 480

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 38/76 (50%), Gaps = 6/76 (7%)

Query: 133 NLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDA 192
            +F+G L     +  L + F  F T +      +++    +G GFV +  + +A+ A+  
Sbjct: 407 TVFIGGLTSHTSERQLHSLFAPFGTII------NVKIPPGKGCGFVKYAYRIDAEAAIQG 460

Query: 193 MQGHELNGRPLRINWA 208
           MQG  + G P+R++W 
Sbjct: 461 MQGFIVGGNPIRLSWG 476

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 38/84 (45%), Gaps = 5/84 (5%)

Query: 43  DKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQ 102
           +  +++G L +  +E  L   F   G I NVKI   K        FV+Y    DA  A+Q
Sbjct: 405 NTTVFIGGLTSHTSERQLHSLFAPFGTIINVKIPPGKG-----CGFVKYAYRIDAEAAIQ 459

Query: 103 TLNGKQIENNVVKINWAFQSQQVS 126
            + G  +  N ++++W   S   S
Sbjct: 460 GMQGFIVGGNPIRLSWGRTSTDTS 483

>CAGL0M03795g Chr13 complement(428607..430148) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q99383 Saccharomyces
           cerevisiae YOL123w HRP1
          Length = 513

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 97/209 (46%), Gaps = 18/209 (8%)

Query: 6   NLEQNPTVESEVPASETISEEPSVVPANA--IKGGRETSDKVLYVGNLDTSINEEILKQY 63
           N+   P V ++   SE   +  S+  AN   +K      +  +++G L+    E+ L++Y
Sbjct: 93  NVSSEPQVSNQTQNSE---QRESIEEANRRQVKADLSRENCKMFIGGLNWETTEDGLREY 149

Query: 64  FQVGGPIANVKIMVDKNNSNA-NYAFVEYFQSHDANIALQT---LNGKQIENNVVKINWA 119
           F   G +  +KIM D N   +  + F+ +      +  ++T   L+GK     V+    A
Sbjct: 150 FSKYGNVVELKIMKDPNTGRSRGFGFLSFDAPSSVDEVVKTQHILDGK-----VIDPKRA 204

Query: 120 FQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVS 179
              ++    + T  +FVG L  DV  +     F ++ T +   +M D  TG SRG+GFV+
Sbjct: 205 IPREE---QDKTGKIFVGGLGTDVRPKEFEEYFSQWGTIIDAQLMLDKDTGRSRGFGFVT 261

Query: 180 FGSQEEAQKAMDAMQGHELNGRPLRINWA 208
           + S + A+K  ++    E  G+ + I  A
Sbjct: 262 YDSPDAAEKVCESRY-REFKGKQIEIKRA 289

>ABL059W Chr2 (287618..288232) [615 bp, 204 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR319W (HSH49)
          Length = 204

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 89/174 (51%), Gaps = 4/174 (2%)

Query: 40  ETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDK-NNSNANYAFVEYFQSHDAN 98
           + ++  +YVGNLD  +++E+L + F    P++ ++   DK    +  +AFVE F   D +
Sbjct: 3   QNTECTVYVGNLDPQVSKELLYELFVQVAPVSRIRYPKDKVKQEHQGFAFVELFSEADCD 62

Query: 99  IALQTLNGK-QIENNVVKINWAFQ-SQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFP 156
            A+++LN    +   V+K+    + ++  +P  A   LFV +L+  +D   L+  F +F 
Sbjct: 63  FAIKSLNNTVSLFGKVLKVRRTLENAKNSAPVFARAKLFVKNLDSTIDAVQLQKLFGKFG 122

Query: 157 TYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
              +   ++ ++ G  R   +V F +   + +A++ +    +  + + I++A K
Sbjct: 123 PLAKPPQLFTLKDGALRC-AYVYFTTFRHSDEALEKLNNQIVANQIISIDYAFK 175

>ZYRO0C02574g Chr3 complement(203808..205439) [1632 bp, 543 aa] {ON}
           weakly similar to uniprot|Q99383 Saccharomyces
           cerevisiae YOL123W HRP1 Subunit of cleavage factor I a
           five-subunit complex required for the cleavage and
           polyadenylation of pre-mRNA 3' ends RRM-containing
           heteronuclear RNA binding protein and hnRNPA/B family
           member that binds to poly (A) signal sequences
          Length = 543

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 79/164 (48%), Gaps = 12/164 (7%)

Query: 23  ISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNS 82
           +SE  ++   NA+K         +++G L+    E+ L+ YF   G + ++KIM D N  
Sbjct: 138 MSENSALAANNAVKADLSRDICKMFIGGLNWETTEDTLRDYFSKYGRVIDLKIMKDTNTG 197

Query: 83  NA-NYAFVEYFQSHDANIALQT---LNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGD 138
            +  + F+ +  S   +  ++T   L+GK     V+    A   ++    + T  +FVG 
Sbjct: 198 RSRGFGFLTFDSSSSVDEVVKTQHILDGK-----VIDPKRAIPREE---QDKTGKIFVGG 249

Query: 139 LNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGS 182
           +  DV  +     F ++ T +   +M D  TG SRG+GFV++ S
Sbjct: 250 IGADVRPKEFEEFFAQWGTIIDAQLMLDKDTGRSRGFGFVTYDS 293

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 39/68 (57%), Gaps = 2/68 (2%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           +F+G LN +  ++TLR+ F ++   +   +M D  TG SRG+GF++F S     + +   
Sbjct: 161 MFIGGLNWETTEDTLRDYFSKYGRVIDLKIMKDTNTGRSRGFGFLTFDSSSSVDEVVKTQ 220

Query: 194 QGHELNGR 201
             H L+G+
Sbjct: 221 --HILDGK 226

>SAKL0D08558g Chr4 (712000..713394) [1395 bp, 464 aa] {ON} similar
           to uniprot|P38922 Saccharomyces cerevisiae YNL004W
          Length = 464

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 82/178 (46%), Gaps = 24/178 (13%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           ++VGNL      E LK+YF   G +    I+  + +       VE+  + D + A++  +
Sbjct: 164 IFVGNLTYDCQPEDLKEYFSQIGEVVRADIITSRGHHRG-MGTVEFTNADDVDEAIRRFD 222

Query: 106 GKQIENNVVKINWAFQSQQVSPDEAT-----------------FNLFVGDLNVDVDDETL 148
           G  + +  +     F  Q   P E+                  + +F+ +L   V+ + L
Sbjct: 223 GSTLLDREI-----FVRQDNPPPESMRAPPRERRPRIQASAPGYEVFIANLPYSVNWQAL 277

Query: 149 RNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRIN 206
           ++ FKE    L+  V  D + G SRGYG V + ++EE Q A++   G+EL GR L ++
Sbjct: 278 KDMFKECGDVLRADVKLD-RDGYSRGYGVVYYKTKEEVQVAIERYNGYELEGRVLDVH 334

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 37/75 (49%), Gaps = 5/75 (6%)

Query: 293 TTAYIGNIPHFAIEADLIPLLQNFGFI----IDFKHYPE-KGCCFIKYDTHEQAAVCIVA 347
           +T ++ N+P    ++DL  L +  G +    + F +  +  G   ++YD    A VCI  
Sbjct: 386 STIFVDNLPWSTAQSDLFDLFETIGKVNRAELKFAYNGKPSGAAVVEYDNPADAEVCISR 445

Query: 348 LANFPFQGRNLRTGW 362
           L ++ + GR+L   +
Sbjct: 446 LNSYNYGGRDLDISY 460

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 33/71 (46%), Gaps = 2/71 (2%)

Query: 133 NLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDA 192
           ++FVG+L  D   E L+  F +    ++  ++     G  RG G V F + ++  +A+  
Sbjct: 163 SIFVGNLTYDCQPEDLKEYFSQIGEVVRADII--TSRGHHRGMGTVEFTNADDVDEAIRR 220

Query: 193 MQGHELNGRPL 203
             G  L  R +
Sbjct: 221 FDGSTLLDREI 231

>TBLA0A07810 Chr1 (1923979..1925397) [1419 bp, 472 aa] {ON} Anc_3.49
           YOL123W
          Length = 472

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 75/147 (51%), Gaps = 12/147 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNAN-YAFVEYFQSHDANIALQT- 103
           +++G L+    E++L+QYF   G + +VKIM D +N  +  + F+ +  S   +  ++T 
Sbjct: 152 MFIGGLNWDTTEDVLRQYFNKYGNVIDVKIMTDGHNGKSRGFGFLTFENSSSVDEVVKTQ 211

Query: 104 --LNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQG 161
             L+GK     V+    A   ++    + T  +FVG +  DV  +     F ++ + +  
Sbjct: 212 HILDGK-----VIDPKRAIPREEQ---DKTGKIFVGGIGPDVRPKEFEEFFSQWGSIIDA 263

Query: 162 HVMWDMQTGGSRGYGFVSFGSQEEAQK 188
            +M D  TG SRG+GFV++ S +   K
Sbjct: 264 QLMLDKDTGRSRGFGFVTYDSPDAVDK 290

>KLTH0E14036g Chr5 complement(1240971..1241600) [630 bp, 209 aa]
           {ON} similar to uniprot|Q99181 Saccharomyces cerevisiae
           YOR319W
          Length = 209

 Score = 60.1 bits (144), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 92/189 (48%), Gaps = 18/189 (9%)

Query: 28  SVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKN-NSNANY 86
           S VPAN +           YVGN+D  +++E+L + F   GP+A ++   DK   ++  +
Sbjct: 5   STVPANTV-----------YVGNVDPKVSKELLYELFLQIGPVAKIRYPKDKVLQTHQGF 53

Query: 87  AFVEYFQSHDANIALQTLNGK-QIENNVVKINWAFQSQQVSPDEATFN----LFVGDLNV 141
           AFVE+    DA  A + LN   ++ +  +K+  A  +      +   +    LF+ +++ 
Sbjct: 54  AFVEFNSPQDAEYASKCLNNTVRLYDRTLKVRKANGASSSPTSQNALDVGAKLFIKNIDE 113

Query: 142 DVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGR 201
            VD E L   F +F + ++   ++ ++ G  R   ++ + + E +  A++ +    +  +
Sbjct: 114 LVDSEMLTKIFGKFGSLVRPPEIFTLKQGLLRC-AYICYSTFEHSDAALEKLNNQMVMNK 172

Query: 202 PLRINWASK 210
            + I++A K
Sbjct: 173 CISIDYAYK 181

>Kpol_1076.11 s1076 complement(24646..26226) [1581 bp, 526 aa] {ON}
           complement(24646..26226) [1581 nt, 527 aa]
          Length = 526

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 70/141 (49%), Gaps = 12/141 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNA-NYAFVEYFQSHDANIALQT- 103
           +++G L+    EE L+ YF   G +  +KIM D N   +  + F+ +  +   +  ++T 
Sbjct: 158 MFIGGLNWETTEETLRDYFNKYGKVVELKIMKDNNTGRSRGFGFLTFEDATSVDEVVKTQ 217

Query: 104 --LNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQG 161
             L+GK     V+    A   ++    + T  +FVG +  DV  +   + F ++ T +  
Sbjct: 218 HILDGK-----VIDPKRAIPREE---QDKTGKIFVGGIGADVRPKEFEDFFAQYGTIIDA 269

Query: 162 HVMWDMQTGGSRGYGFVSFGS 182
            +M D  TG SRG+GFV++ S
Sbjct: 270 QLMLDKDTGRSRGFGFVTYDS 290

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 49/109 (44%), Gaps = 9/109 (8%)

Query: 9   QNPTVESEVPASETISEEPSVVPANAIKGGRETSDKV--LYVGNLDTSINEEILKQYFQV 66
           ++ T   EV  ++ I +   + P  AI   RE  DK   ++VG +   +  +  + +F  
Sbjct: 205 EDATSVDEVVKTQHILDGKVIDPKRAIP--REEQDKTGKIFVGGIGADVRPKEFEDFFAQ 262

Query: 67  GGPIANVKIMVDKNNSNA-NYAFVEYFQSHDANIALQT----LNGKQIE 110
            G I + ++M+DK+   +  + FV Y      +   Q       GKQIE
Sbjct: 263 YGTIIDAQLMLDKDTGRSRGFGFVTYDSPDAVDRVCQNKFIEFKGKQIE 311

>NDAI0A06170 Chr1 complement(1403026..1404684) [1659 bp, 552 aa]
           {ON} Anc_3.49
          Length = 552

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 71/142 (50%), Gaps = 10/142 (7%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNAN-YAFV--EYFQSHDANIALQ 102
           L++G L+    EE LK YF   G + ++KIM D N+  +  + F+  E+  S D  +  Q
Sbjct: 231 LFIGGLNWETTEEKLKDYFSKYGNVVDLKIMKDANSGRSRGFGFLSFEHPSSVDEVVKSQ 290

Query: 103 TLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGH 162
            +    ++  V+    A   ++    + T  +FVG +  DV  +     F ++ T +   
Sbjct: 291 HI----LDGKVIDPKRAIPREE---QDKTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQ 343

Query: 163 VMWDMQTGGSRGYGFVSFGSQE 184
           +M D  TG SRG+GF+++ S E
Sbjct: 344 LMLDKDTGRSRGFGFITYDSGE 365

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 44/86 (51%), Gaps = 5/86 (5%)

Query: 9   QNPTVESEVPASETISEEPSVVPANAIKGGRETSDKV--LYVGNLDTSINEEILKQYFQV 66
           ++P+   EV  S+ I +   + P  AI   RE  DK   ++VG +   +  +  +++F  
Sbjct: 278 EHPSSVDEVVKSQHILDGKVIDPKRAIP--REEQDKTGKIFVGGIGPDVRPKEFEEFFAQ 335

Query: 67  GGPIANVKIMVDKNNSNAN-YAFVEY 91
            G I + ++M+DK+   +  + F+ Y
Sbjct: 336 WGTIIDAQLMLDKDTGRSRGFGFITY 361

>KNAG0A01370 Chr1 (41785..43422) [1638 bp, 545 aa] {ON} Anc_3.49
           YOL123W
          Length = 545

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 74/143 (51%), Gaps = 12/143 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNA-NYAFVEYFQSHDANIALQT- 103
           +++G L+    E+ L++YF   G + ++KIM D N+  +  + F+ + +    +  ++T 
Sbjct: 159 MFIGGLNWETTEDGLREYFNKYGHVIDLKIMKDPNSGRSRGFGFLTFEEPSSVDEVVKTQ 218

Query: 104 --LNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQG 161
             L+GK I+    K +   + Q     + T  +FVG +  DV  +     F ++ T +  
Sbjct: 219 HILDGKVID---PKRSIPREEQ-----DKTGKIFVGGIGADVRPKEFEEFFSQYGTIIDA 270

Query: 162 HVMWDMQTGGSRGYGFVSFGSQE 184
            +M D  TG SRG+GFV++ S E
Sbjct: 271 QLMLDKDTGRSRGFGFVTYDSPE 293

>NCAS0C04830 Chr3 (984086..985219) [1134 bp, 377 aa] {ON} Anc_1.408
          Length = 377

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 79/169 (46%), Gaps = 13/169 (7%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           +++GNL     EE L+ +F   G + N ++M  +  S      VE+    DA  A++  N
Sbjct: 80  IFIGNLSFDATEEDLRDFFSQVGEVVNAEVMSYRGRSKG-MGTVEFTNPADAEEAIRQYN 138

Query: 106 GKQIENNVVKINW---------AFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFP 156
           G       + +            F+S +  P +  +  FV +L   +  + L++ F+E  
Sbjct: 139 GVPFMGRDIFVKQDQPPPGSRQEFKSSE--PTQQGYEAFVVNLPYSITWQNLKDIFRECG 196

Query: 157 TYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRI 205
             ++  V  D   G SRG+G V + ++E+  KA+D+  G EL GR L +
Sbjct: 197 DVIRADVELDY-NGYSRGFGSVIYANEEDMFKAIDSFNGAELEGRILEV 244

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 40/203 (19%), Positives = 74/203 (36%), Gaps = 40/203 (19%)

Query: 47  YVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLNG 106
           +V NL  SI  + LK  F+  G +    + +D N  +  +  V Y    D   A+ + NG
Sbjct: 175 FVVNLPYSITWQNLKDIFRECGDVIRADVELDYNGYSRGFGSVIYANEEDMFKAIDSFNG 234

Query: 107 KQIENNVVKI---------------------------------------NWAFQSQQVSP 127
            ++E  ++++                                       N +F       
Sbjct: 235 AELEGRILEVREGKFNHPRDTFDDRRDFDDRRDFDDVPKEEEPVLPPAHNPSFTEGVSGD 294

Query: 128 DEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQ 187
            E    ++  +L +      L + F          +++D +TG S G   V + SQ+ A 
Sbjct: 295 GERNNTVYCNNLPLSTTVPDLYDLFGSVGEIAMAELVYD-ETGTSTGAAVVEYASQDAAD 353

Query: 188 KAMDAMQGHELNGRPLRINWASK 210
             ++ + G+   GR L I +AS+
Sbjct: 354 VCINKLNGYNYGGRDLHITYASR 376

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 44/101 (43%), Gaps = 7/101 (6%)

Query: 25  EEPSVVPAN------AIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVD 78
           EEP + PA+       + G  E ++ V Y  NL  S     L   F   G IA  +++ D
Sbjct: 275 EEPVLPPAHNPSFTEGVSGDGERNNTV-YCNNLPLSTTVPDLYDLFGSVGEIAMAELVYD 333

Query: 79  KNNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWA 119
           +  ++   A VEY     A++ +  LNG       + I +A
Sbjct: 334 ETGTSTGAAVVEYASQDAADVCINKLNGYNYGGRDLHITYA 374

>TBLA0D04940 Chr4 (1214344..1216341) [1998 bp, 665 aa] {ON}
           Anc_1.357 YHR015W
          Length = 665

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 44/75 (58%)

Query: 128 DEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQ 187
           D+ +F LF+G LN  V  E L+  FK+FP+++   V  DM+T  S GYG+++F +Q +  
Sbjct: 90  DKNSFALFIGGLNQRVTKEMLKEEFKDFPSFISAKVCVDMKTKKSLGYGYLNFSNQNDIL 149

Query: 188 KAMDAMQGHELNGRP 202
           + ++      L G P
Sbjct: 150 RLVEKYNYRSLFGCP 164

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 32/147 (21%), Positives = 67/147 (45%), Gaps = 6/147 (4%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVD-KNNSNANYAFVEYFQSHDANIALQTL 104
           L++G L+  + +E+LK+ F+      + K+ VD K   +  Y ++ +   +D    ++  
Sbjct: 96  LFIGGLNQRVTKEMLKEEFKDFPSFISAKVCVDMKTKKSLGYGYLNFSNQNDILRLVEKY 155

Query: 105 NGKQIENN-VVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHV 163
           N + +     +KI  + ++     +  T N+F  +L +     T R  +  F  Y  G +
Sbjct: 156 NYRSLFGCPEIKIMPSLRNTFYRKNIGT-NVFFSNLPLHNPQLTTRYFYDTFKVY--GRI 212

Query: 164 MWDMQTGGSRGYGFVSFGSQEEAQKAM 190
           +   +    +  GFV F + E A+K +
Sbjct: 213 L-SCKLDYRKNIGFVYFDNNESAKKVI 238

>KAFR0C01680 Chr3 complement(342688..344127) [1440 bp, 479 aa] {ON}
           Anc_3.49 YOL123W
          Length = 479

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 69/141 (48%), Gaps = 12/141 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNA-NYAFVEYFQSHDANIALQT- 103
           +++G L+    EE L+ YF   G + ++KIM D N   +  + F+ +      +  ++T 
Sbjct: 96  MFIGGLNWETTEETLRDYFNKYGHVTDLKIMKDSNTGRSRGFGFLTFEHPSSVDEVVKTQ 155

Query: 104 --LNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQG 161
             L+GK I+    K +   + Q     + T  +FVG +  DV  +     F ++   +  
Sbjct: 156 HILDGKVID---PKRSIPREEQ-----DKTGKIFVGGIGADVRPKEFEEFFSQYGNIIDA 207

Query: 162 HVMWDMQTGGSRGYGFVSFGS 182
            +M D  TG SRG+GFV++ S
Sbjct: 208 QLMLDKDTGRSRGFGFVTYDS 228

>Kpol_1008.23 s1008 (47628..49610) [1983 bp, 660 aa] {ON}
           (47628..49610) [1983 nt, 661 aa]
          Length = 660

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 47/72 (65%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           LF+G+L++DV++E L+  FK+FP+ +   +  +  T  S GYG+++FG +E+A+KA +  
Sbjct: 80  LFIGNLSLDVNEEKLKQVFKKFPSLVSVKICTNSTTKESLGYGYLNFGDKEDAEKATEEF 139

Query: 194 QGHELNGRPLRI 205
               L G  ++I
Sbjct: 140 NYINLFGNEVKI 151

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 72/159 (45%), Gaps = 5/159 (3%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNA-NYAFVEYFQSHDANIALQTL 104
           L++GNL   +NEE LKQ F+    + +VKI  +     +  Y ++ +    DA  A +  
Sbjct: 80  LFIGNLSLDVNEEKLKQVFKKFPSLVSVKICTNSTTKESLGYGYLNFGDKEDAEKATEEF 139

Query: 105 NGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVM 164
           N   +  N VKI  + ++     +  T NLF  +L +D  + T R  +  F  Y  G ++
Sbjct: 140 NYINLFGNEVKIMPSLRNSFYRKNIGT-NLFFCNLPLDNKELTTRRFYDTFKKY--GKIL 196

Query: 165 WDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPL 203
              +    +  GFV F + + A++ +      E  G  +
Sbjct: 197 -SCKLDKRKNIGFVYFDNDKSAKEVIKDFNNKEFFGTKI 234

 Score = 37.0 bits (84), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 55/107 (51%), Gaps = 5/107 (4%)

Query: 29  VVPANAI--KGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANV-KIMVDKNNSNAN 85
           V+ +N+I  +  ++T    ++V NL  +  +E +  YF V GPI +V    V K NS   
Sbjct: 315 VIDSNSIIDETNKKTYPNSVFVKNLPINTTDEEILDYFSVAGPIKSVFSSKVPKFNS--L 372

Query: 86  YAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVSPDEATF 132
           ++ + Y +S D+  A+QT + K  +  V+ +  A      S + +T+
Sbjct: 373 WSIITYKKSSDSIKAIQTYDNKTFKEKVISVTKAHSKLHESQNYSTY 419

>NDAI0B04570 Chr2 (1137147..1138541) [1395 bp, 464 aa] {ON}
           Anc_1.357
          Length = 464

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 47/75 (62%)

Query: 131 TFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAM 190
           TF+LF+GDL+  V  E L N F ++P++L   V +D +T  S G+G+++F S+ ++++A+
Sbjct: 50  TFSLFIGDLHPKVTQEILENIFGKYPSFLSAKVCYDFKTKVSLGHGYLNFSSERDSKQAI 109

Query: 191 DAMQGHELNGRPLRI 205
           D      L    +R+
Sbjct: 110 DDFNCTRLFDSVIRL 124

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 33/167 (19%), Positives = 78/167 (46%), Gaps = 7/167 (4%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVD-KNNSNANYAFVEYFQSHDANIALQTL 104
           L++G+L   + +EIL+  F       + K+  D K   +  + ++ +    D+  A+   
Sbjct: 53  LFIGDLHPKVTQEILENIFGKYPSFLSAKVCYDFKTKVSLGHGYLNFSSERDSKQAIDDF 112

Query: 105 NGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQ--GH 162
           N  ++ ++V+++  +F+ + +   ++ +NLF  +L  +VDD       + F    +  G 
Sbjct: 113 NCTRLFDSVIRLMPSFRGKNIK--KSNYNLFFSNL-PEVDDTGQSFTPRRFYELFRECGE 169

Query: 163 VMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
           ++   +   ++  GF+SF S+  A++ +       L G+ +     S
Sbjct: 170 II-SCKFEENKNIGFISFQSENVAREVIINYNNKFLFGKQITCKLLS 215

>TDEL0E00600 Chr5 (129602..131245) [1644 bp, 547 aa] {ON} Anc_3.49
           YOL123W
          Length = 547

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 70/141 (49%), Gaps = 12/141 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNA-NYAFVEYFQSHDANIALQT- 103
           +++G L+    E+ L+ YF   G + ++KIM D N   +  + F+ + +    +  ++T 
Sbjct: 159 MFIGGLNWETTEDTLRDYFSKYGKVIDLKIMKDTNTGRSRGFGFLTFDEPSSVDEVVKTQ 218

Query: 104 --LNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQG 161
             L+GK     V+    A   ++    + T  +FVG +  DV  +     F ++ T +  
Sbjct: 219 HILDGK-----VIDPKRAIPREE---QDKTGKIFVGGIGADVRPKEFEEFFAQWGTIIDA 270

Query: 162 HVMWDMQTGGSRGYGFVSFGS 182
            +M D  TG SRG+GFV++ S
Sbjct: 271 QLMLDKDTGRSRGFGFVTYDS 291

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 49/107 (45%), Gaps = 9/107 (8%)

Query: 11  PTVESEVPASETISEEPSVVPANAIKGGRETSDKV--LYVGNLDTSINEEILKQYFQVGG 68
           P+   EV  ++ I +   + P  AI   RE  DK   ++VG +   +  +  +++F   G
Sbjct: 208 PSSVDEVVKTQHILDGKVIDPKRAIP--REEQDKTGKIFVGGIGADVRPKEFEEFFAQWG 265

Query: 69  PIANVKIMVDKNNSNA-NYAFVEYFQSHDANIALQT----LNGKQIE 110
            I + ++M+DK+   +  + FV Y      +   Q       GK+IE
Sbjct: 266 TIIDAQLMLDKDTGRSRGFGFVTYDSPDAVDRVCQNKFIDFKGKKIE 312

>TPHA0P01310 Chr16 complement(265254..266810) [1557 bp, 518 aa] {ON}
           Anc_3.49 YOL123W
          Length = 518

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 69/141 (48%), Gaps = 12/141 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNA-NYAFVEYFQSHDANIALQT- 103
           +++G L+    E+ L+ YF   G +  +KIM D N   +  + F+ +  +   +  ++T 
Sbjct: 166 MFIGGLNWETTEDTLRDYFNKYGSVVELKIMKDNNTGRSRGFGFLTFENASSVDEVVKTQ 225

Query: 104 --LNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQG 161
             L+GK     V+    A   ++    + T  +FVG +  DV  +     F ++ T +  
Sbjct: 226 HILDGK-----VIDPKRAIPREE---QDKTGKIFVGGIGADVRPKEFEEFFAQYGTIIDA 277

Query: 162 HVMWDMQTGGSRGYGFVSFGS 182
            +M D  TG SRG+GFV++ S
Sbjct: 278 QLMLDKDTGRSRGFGFVTYDS 298

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 51/109 (46%), Gaps = 9/109 (8%)

Query: 9   QNPTVESEVPASETISEEPSVVPANAIKGGRETSDKV--LYVGNLDTSINEEILKQYFQV 66
           +N +   EV  ++ I +   + P  AI   RE  DK   ++VG +   +  +  +++F  
Sbjct: 213 ENASSVDEVVKTQHILDGKVIDPKRAIP--REEQDKTGKIFVGGIGADVRPKEFEEFFAQ 270

Query: 67  GGPIANVKIMVDKNNSNA-NYAFVEYFQSHDANIALQT----LNGKQIE 110
            G I + ++M+DK+   +  + FV Y      +   Q+      GKQIE
Sbjct: 271 YGTIIDAQLMLDKDTGRSRGFGFVTYDSPDAVDRVCQSKYIEFKGKQIE 319

>NCAS0A10010 Chr1 complement(2003039..2004559) [1521 bp, 506 aa]
           {ON} Anc_3.49
          Length = 506

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 70/143 (48%), Gaps = 12/143 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNAN-YAFVEYFQSHDANIALQT- 103
           L++G L+    E+ LK YF   G + ++KIM D     +  + F+ +  S   +  ++T 
Sbjct: 195 LFIGGLNWETTEDKLKDYFSKYGNVVDLKIMKDNATGRSRGFGFLTFELSSSVDEVVKTQ 254

Query: 104 --LNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQG 161
             L+GK     V+    A   ++    + T  +FVG +  DV  +     F ++ T +  
Sbjct: 255 HILDGK-----VIDPKRAIPREE---QDKTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDA 306

Query: 162 HVMWDMQTGGSRGYGFVSFGSQE 184
            +M D  TG SRG+GF+++ S E
Sbjct: 307 QLMLDKDTGRSRGFGFITYDSSE 329

>Kwal_27.12337 s27 complement(1185308..1185937) [630 bp, 209 aa]
           {ON} YOR319W (HSH49) - homolog of mammalian splicing
           factor/U2 snRNP protein [contig 20] FULL
          Length = 209

 Score = 57.0 bits (136), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 85/174 (48%), Gaps = 7/174 (4%)

Query: 43  DKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDK-NNSNANYAFVEYFQSHDANIAL 101
           D  +YVGN+D  +  EIL + F    P+A ++   DK   ++  +AFVE++ + D   A 
Sbjct: 9   DNTVYVGNVDPKVTREILYELFLQICPVAKIRYPKDKILQTHQGFAFVEFYNAQDCEYAT 68

Query: 102 QTLNGK-QIENNVVKINWAFQSQQVSPDEATFN----LFVGDLNVDVDDETLRNAFKEFP 156
           + LN   ++ +  +K+  A  +     ++   +    LFV +++  VD   L   F +F 
Sbjct: 69  KCLNNSLRLYDRTLKVRKANGAGHAPANQNALDVGAKLFVKNIDELVDATALTRIFSKFG 128

Query: 157 TYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
              +   ++ ++ G  +   +VS+ + E + KA+  +    +  + + +++A K
Sbjct: 129 PLAKAPEIFYLKQGVLKC-AYVSYTTFEHSDKALAKLNNQMVMNKCISLDYALK 181

>SAKL0C12672g Chr3 complement(1130702..1132357) [1656 bp, 551 aa]
           {ON} weakly similar to uniprot|Q99383 Saccharomyces
           cerevisiae YOL123W HRP1 Subunit of cleavage factor I a
           five-subunit complex required for the cleavage and
           polyadenylation of pre-mRNA 3' ends RRM-containing
           heteronuclear RNA binding protein and hnRNPA/B family
           member that binds to poly (A) signal sequences
          Length = 551

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 69/139 (49%), Gaps = 12/139 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNAN-YAFVEYFQSHDANIALQT- 103
           +++G L+    E+ L+ YF   G + ++KIM D     +  + F+ + +S   +  ++T 
Sbjct: 184 MFIGGLNWETTEDNLRDYFSKYGAVTDLKIMRDNATGRSRGFGFLTFAESSSVDEVVKTQ 243

Query: 104 --LNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQG 161
             L+GK     V+    A   ++    + T  +FVG +  DV  +     F ++ T +  
Sbjct: 244 HILDGK-----VIDPKRAIPREE---QDKTGKIFVGGIGPDVRPKEFEEFFSQYGTIIDA 295

Query: 162 HVMWDMQTGGSRGYGFVSF 180
            +M D  TG SRG+GF+++
Sbjct: 296 QLMLDKDTGRSRGFGFITY 314

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 36/68 (52%), Gaps = 2/68 (2%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           +F+G LN +  ++ LR+ F ++       +M D  TG SRG+GF++F       + +   
Sbjct: 184 MFIGGLNWETTEDNLRDYFSKYGAVTDLKIMRDNATGRSRGFGFLTFAESSSVDEVVKTQ 243

Query: 194 QGHELNGR 201
             H L+G+
Sbjct: 244 --HILDGK 249

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 40/79 (50%), Gaps = 5/79 (6%)

Query: 16  EVPASETISEEPSVVPANAIKGGRETSDKV--LYVGNLDTSINEEILKQYFQVGGPIANV 73
           EV  ++ I +   + P  AI   RE  DK   ++VG +   +  +  +++F   G I + 
Sbjct: 238 EVVKTQHILDGKVIDPKRAIP--REEQDKTGKIFVGGIGPDVRPKEFEEFFSQYGTIIDA 295

Query: 74  KIMVDKNNSNAN-YAFVEY 91
           ++M+DK+   +  + F+ Y
Sbjct: 296 QLMLDKDTGRSRGFGFITY 314

>Ecym_7420 Chr7 complement(859857..860471) [615 bp, 204 aa] {ON}
           similar to Ashbya gossypii ABL059W
          Length = 204

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 84/168 (50%), Gaps = 4/168 (2%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDK-NNSNANYAFVEYFQSHDANIALQTL 104
           +YVGNLD  + +E L + F   GP+  ++   DK       +AFVE++ + D   A+++L
Sbjct: 9   IYVGNLDGQVTKEHLYELFVQMGPVYRIRYRKDKITQEYQGFAFVEFYTNSDCEFAIKSL 68

Query: 105 NGK-QIENNVVKINWAFQSQQV-SPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGH 162
           N    +   ++K+    ++     P  +   LFV +L+  VD + L+  F +F   ++  
Sbjct: 69  NNSVSLFGKILKVRRTLENTHYGGPLISGAKLFVKNLDDSVDFQQLQKLFGKFGPLVKQP 128

Query: 163 VMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
            ++ ++ G  +   ++ + + + + +A+  +    L  R + I++A K
Sbjct: 129 EIFTLKNGTLKC-AYIYYSTFKHSDEALQKLNKQILANRVISIDYAFK 175

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 45/89 (50%)

Query: 33  NAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYF 92
           N   GG   S   L+V NLD S++ + L++ F   GP+     +    N     A++ Y 
Sbjct: 87  NTHYGGPLISGAKLFVKNLDDSVDFQQLQKLFGKFGPLVKQPEIFTLKNGTLKCAYIYYS 146

Query: 93  QSHDANIALQTLNGKQIENNVVKINWAFQ 121
               ++ ALQ LN + + N V+ I++AF+
Sbjct: 147 TFKHSDEALQKLNKQILANRVISIDYAFK 175

>KLLA0C14388g Chr3 complement(1251548..1252159) [612 bp, 203 aa]
           {ON} similar to uniprot|Q99181 Saccharomyces cerevisiae
           YOR319W
          Length = 203

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 87/171 (50%), Gaps = 7/171 (4%)

Query: 45  VLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDK----NNSNANYAFVEYFQSHDANIA 100
            +YVGNLD+ +N+ +L + F   GPI+ +K   +K    ++ ++ YAF++ F + D +  
Sbjct: 4   TVYVGNLDSRVNKSLLYELFVQAGPISYIKFPKEKQDEDDSQHSKYAFIK-FVNDDVDYV 62

Query: 101 LQTLNGK-QIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYL 159
            +  + +  +    +K+  + +  + +  +    LFV +L+  +D   L N FK F   L
Sbjct: 63  CKLFDNRVSLYGKPLKVRRSNKQPETTDFDVGAKLFVKNLDESIDVPQLSNIFKIFGKLL 122

Query: 160 QGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
           +   ++ +Q G  R   +V F + + + +A+  +    L  + + I++A K
Sbjct: 123 RKPEVFYLQNGTLRC-AYVWFTTFKHSDEALQQLNETNLANKLIYIDYAYK 172

>Kwal_0.370 s0 (177067..178749) [1683 bp, 560 aa] {ON} YFR023W
           (PES4) - poly(A) binding protein; related to PES4
           protein homolog YHR015w [contig 89] FULL
          Length = 560

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 53/89 (59%), Gaps = 6/89 (6%)

Query: 117 NWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYG 176
           N    SQ+VS      +LF+GDL+ +V ++ L + F+ FP+ +   +  D +TG S GYG
Sbjct: 6   NPCVTSQKVS------SLFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETGISLGYG 59

Query: 177 FVSFGSQEEAQKAMDAMQGHELNGRPLRI 205
           +++F S ++A+ A++      L GR +RI
Sbjct: 60  YLNFYSSKDAETAIETFSYVNLFGREVRI 88

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 81/163 (49%), Gaps = 7/163 (4%)

Query: 41  TSDKV--LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNS-NANYAFVEYFQSHDA 97
           TS KV  L++G+LD ++ E++L   F+V   + +VKI VD     +  Y ++ ++ S DA
Sbjct: 10  TSQKVSSLFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETGISLGYGYLNFYSSKDA 69

Query: 98  NIALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPT 157
             A++T +   +    V+I  + ++     +  T N+F  +L ++    T R  ++ F  
Sbjct: 70  ETAIETFSYVNLFGREVRIMPSMRNSYFRKNIGT-NVFFSNLPLEQPALTTRVFYETFRE 128

Query: 158 YLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNG 200
           Y  G V+   +    +  GFV F S   A+KA+ +    E  G
Sbjct: 129 Y--GKVL-SCKLDRRKNIGFVYFESDAAARKAIASYNNKEYYG 168

 Score = 34.7 bits (78), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 47/218 (21%), Positives = 85/218 (38%), Gaps = 30/218 (13%)

Query: 19  ASETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVD 78
           A E +  E +V   N  +  ++     ++V NL  +I  E L  YF   GP+ +V     
Sbjct: 200 AKENLLSENNVELENHDQNSKDPHPNSIHVKNLPFNICNEDLLNYFSRIGPVKSV-FTSK 258

Query: 79  KNNSNANYAFVEYFQSHDANIALQTLNG-----------KQIENN-------VVKINWAF 120
                +++ FV Y +  D   AL +LNG           K ++NN       V K   A+
Sbjct: 259 LEAYRSSWGFVTYKKGCDTRKALDSLNGAIFMDRRLEVNKALKNNGDRRDGTVSKNRRAY 318

Query: 121 QSQQV-SPDEATFN----------LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQT 169
             Q   S DE + +          LF+ DL++  +D+ L    +         V+     
Sbjct: 319 NDQNFRSSDENSISSLLSNGYRQTLFLSDLSLVCNDKFLGELCRAEKINYHKIVVDHYDE 378

Query: 170 GGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINW 207
                 G++   S+ +A +  + +    +    +R++W
Sbjct: 379 ECLTYSGYIVCKSRPDANRLFEVLNNKLIGDSIVRVSW 416

>Kwal_55.21960 s55 complement(1055849..1057642) [1794 bp, 597 aa]
           {ON} YOL123W (HRP1) - putative
           polyadenylated-RNA-binding protein [contig 124] FULL
          Length = 597

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 69/139 (49%), Gaps = 12/139 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNA-NYAFVEYFQSHDANIALQT- 103
           +++G L+    E+ LK YF   G + ++KIM D     +  + F+ + ++   +  ++T 
Sbjct: 211 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVVKTQ 270

Query: 104 --LNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQG 161
             L+GK     V+    A   ++    + T  +FVG +  DV  +     F ++ T +  
Sbjct: 271 HILDGK-----VIDPKRAIPREE---QDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDA 322

Query: 162 HVMWDMQTGGSRGYGFVSF 180
            +M D  TG SRG+GF+++
Sbjct: 323 QLMLDKDTGRSRGFGFITY 341

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 40/79 (50%), Gaps = 5/79 (6%)

Query: 16  EVPASETISEEPSVVPANAIKGGRETSDKV--LYVGNLDTSINEEILKQYFQVGGPIANV 73
           EV  ++ I +   + P  AI   RE  DK   ++VG +   +  +  +++F   G I + 
Sbjct: 265 EVVKTQHILDGKVIDPKRAIP--REEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDA 322

Query: 74  KIMVDKNNSNA-NYAFVEY 91
           ++M+DK+   +  + F+ Y
Sbjct: 323 QLMLDKDTGRSRGFGFITY 341

>Ecym_2050 Chr2 (79607..81232) [1626 bp, 541 aa] {ON} similar to
           Ashbya gossypii ADL160W
          Length = 541

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 69/141 (48%), Gaps = 12/141 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNAN-YAFVEYFQSHDANIALQT- 103
           +++G L+    E+ L++YF   G +  VKIM D     +  + F+ +  +   +  ++T 
Sbjct: 173 MFIGGLNWETTEDNLREYFSKYGTVTEVKIMRDGTTGRSRGFGFLSFADASSVDEVVKTQ 232

Query: 104 --LNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQG 161
             L+GK     V+    A   ++    + T  +FVG +  DV  +     F E+ + +  
Sbjct: 233 HILDGK-----VIDPKRAIPREE---QDKTGKIFVGGIGPDVRPKEFEEFFSEWGSIIDA 284

Query: 162 HVMWDMQTGGSRGYGFVSFGS 182
            +M D  TG SRG+GF+++ S
Sbjct: 285 QLMLDKDTGRSRGFGFITYDS 305

>KAFR0C04410 Chr3 complement(870329..872098) [1770 bp, 589 aa] {ON}
           Anc_1.357 YHR015W
          Length = 589

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 46/72 (63%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           LF+G+L+ DV ++ L   F  +P+++   V ++  T  S G+G+++FGS+E+A+KA + M
Sbjct: 91  LFIGNLDKDVTEKQLETIFSVYPSFISAKVCYNSSTNLSLGHGYLNFGSKEDAEKACEEM 150

Query: 194 QGHELNGRPLRI 205
              ++    +RI
Sbjct: 151 NYSKVLNNEIRI 162

 Score = 37.4 bits (85), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 32/156 (20%), Positives = 68/156 (43%), Gaps = 5/156 (3%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKN-NSNANYAFVEYFQSHDANIALQTL 104
           L++GNLD  + E+ L+  F V     + K+  + + N +  + ++ +    DA  A + +
Sbjct: 91  LFIGNLDKDVTEKQLETIFSVYPSFISAKVCYNSSTNLSLGHGYLNFGSKEDAEKACEEM 150

Query: 105 NGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVM 164
           N  ++ NN ++I  + +         T N++  +L  + +  T R  +  F  Y  G ++
Sbjct: 151 NYSKVLNNEIRIMPSMRDPDYRKKVGT-NVYFRNLPTENNMLTTRYFYDSFRKY--GKIL 207

Query: 165 WDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNG 200
              +   S+  GF+ F  +  A + +         G
Sbjct: 208 -SCKIERSKKIGFIYFACEVTANEVIKKFNNSSFLG 242

>KLTH0F18766g Chr6 complement(1521018..1522784) [1767 bp, 588 aa]
           {ON} weakly similar to uniprot|Q99383 Saccharomyces
           cerevisiae YOL123W HRP1 Subunit of cleavage factor I a
           five-subunit complex required for the cleavage and
           polyadenylation of pre-mRNA 3' ends RRM-containing
           heteronuclear RNA binding protein and hnRNPA/B family
           member that binds to poly (A) signal sequences
          Length = 588

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 69/139 (49%), Gaps = 12/139 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNA-NYAFVEYFQSHDANIALQT- 103
           +++G L+    E+ LK YF   G + ++KIM D     +  + F+ + ++   +  ++T 
Sbjct: 210 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVVKTQ 269

Query: 104 --LNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQG 161
             L+GK     V+    A   ++    + T  +FVG +  DV  +     F ++ T +  
Sbjct: 270 HILDGK-----VIDPKRAIPREE---QDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDA 321

Query: 162 HVMWDMQTGGSRGYGFVSF 180
            +M D  TG SRG+GF+++
Sbjct: 322 QLMLDKDTGRSRGFGFITY 340

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 40/79 (50%), Gaps = 5/79 (6%)

Query: 16  EVPASETISEEPSVVPANAIKGGRETSDKV--LYVGNLDTSINEEILKQYFQVGGPIANV 73
           EV  ++ I +   + P  AI   RE  DK   ++VG +   +  +  +++F   G I + 
Sbjct: 264 EVVKTQHILDGKVIDPKRAIP--REEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDA 321

Query: 74  KIMVDKNNSNA-NYAFVEY 91
           ++M+DK+   +  + F+ Y
Sbjct: 322 QLMLDKDTGRSRGFGFITY 340

>Kpol_487.6 s487 (35743..36873) [1131 bp, 376 aa] {ON}
           (35743..36873) [1131 nt, 377 aa]
          Length = 376

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 81/186 (43%), Gaps = 33/186 (17%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           ++VGNL      E L+ +F   G +    I+  + +       VE+  + D N A+   +
Sbjct: 70  VFVGNLTYDCTPEDLRDHFSTIGEVVRADIITSRGHHRG-MGTVEFTNADDVNEAISQYD 128

Query: 106 GKQIENNVVKINWAFQSQQVSPDEAT--------------------------FNLFVGDL 139
           G  + +  +     F  Q   P EA+                          + +F+ +L
Sbjct: 129 GSYLLDRQI-----FVRQDNPPPEASHESEPPRERRERRTLGNDGSLHSHIGYEVFIANL 183

Query: 140 NVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELN 199
              ++ + L++ FKE  + ++  V  D + G SRG+G V  GSQE+ ++A+    G+EL 
Sbjct: 184 PYSINWQALKDMFKECGSVIRADVELD-RNGYSRGFGTVILGSQEDMERAISMYNGYELE 242

Query: 200 GRPLRI 205
           GR L +
Sbjct: 243 GRVLEV 248

 Score = 37.0 bits (84), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 7/75 (9%)

Query: 296 YIGNIPHFAIEADLIPLLQNFGFI------IDFKHYPEKGCCFIKYDTHEQAAVCIVALA 349
           Y  N+P    ++DL  L +  G +       D K  P  G   ++Y+  + A VC+  L 
Sbjct: 301 YCSNLPFSTAKSDLFDLFETIGKLKNAELKFDQKGNP-TGVAIVEYENVDDAQVCVDRLN 359

Query: 350 NFPFQGRNLRTGWGK 364
           N+ + G +L   +GK
Sbjct: 360 NYNYGGCDLDISYGK 374

 Score = 37.0 bits (84), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 23/101 (22%), Positives = 47/101 (46%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           +++ NL  SIN + LK  F+  G +    + +D+N  +  +  V      D   A+   N
Sbjct: 178 VFIANLPYSINWQALKDMFKECGSVIRADVELDRNGYSRGFGTVILGSQEDMERAISMYN 237

Query: 106 GKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDE 146
           G ++E  V+++     + Q      + ++ + D   D++DE
Sbjct: 238 GYELEGRVLEVREGRSNNQDEEMPISEDIEINDNGNDINDE 278

>TBLA0B08590 Chr2 complement(2052809..2054680) [1872 bp, 623 aa]
           {ON} Anc_3.49 YOL123W
          Length = 623

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 82/170 (48%), Gaps = 19/170 (11%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNA-NYAFVEYFQSHDANIALQT- 103
           +++G L+    E+ L+ YF   G + ++KIM D N   +  + F+ + +S   +  ++T 
Sbjct: 172 MFIGGLNWETTEDGLRDYFNKYGNVVDLKIMKDNNTGKSRGFGFLTFEKSSSVDEVVKTQ 231

Query: 104 --LNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQG 161
             L+GK     V+    A   ++    + T  +F+G +  DV  +     F ++   +  
Sbjct: 232 HILDGK-----VIDPKRAIPREEQ---DKTGKIFIGGIGADVRPKEFEEFFAKYGNIIDA 283

Query: 162 HVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGH---ELNGRPLRINWA 208
            +M D  TG SRG+GFV++ S +    A+D +  H   E  G+ + I  A
Sbjct: 284 QLMLDKDTGRSRGFGFVTYDSPD----AVDRVCQHKFIEFKGKQIEIKRA 329

>KAFR0B04420 Chr2 complement(918168..920045) [1878 bp, 625 aa] {ON}
           Anc_5.76 YGR250C
          Length = 625

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 60/195 (30%), Positives = 98/195 (50%), Gaps = 33/195 (16%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNAN----YAFVEY-FQSHDANIA 100
           L++G +D +I    L   F V GPI ++K++ D NN++ N    Y FV Y F S  AN  
Sbjct: 170 LFIGGIDKAITLSQLTTIFSVYGPIISIKLISDTNNNSKNNETNYGFVSYQFGSQAAN-C 228

Query: 101 LQTLNGKQIENNVVKINWAF------QSQQVSPDE----ATFN-LFVGDL-NVDVDDE-- 146
           +  LNGK+I ++ + IN+        + Q +  DE      F  +F+G+L  V V+ E  
Sbjct: 229 INDLNGKKIHDSNLFINYHVDVKERERIQWLDADENNNAKNFKCVFIGNLPKVAVNGEPI 288

Query: 147 -------TLRNAFKE-FPTY-LQGHVM----WDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
                  T+++  KE F  + +  H       D ++   +GYGFV   + EEA + +++ 
Sbjct: 289 TCGMILETIKDRLKEQFANFEILSHYFPEDTVDDRSELLKGYGFVKVATHEEAIEIINSF 348

Query: 194 QGHELNGRPLRINWA 208
            G+E +G  L +N A
Sbjct: 349 NGYEFHGSKLIVNRA 363

>ZYRO0G00814g Chr7 complement(63018..64982) [1965 bp, 654 aa] {ON}
           similar to uniprot|P39684 Saccharomyces cerevisiae or to
           YHR015W uniprot|P38760 Saccharomyces cerevisiae
          Length = 654

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 46/87 (52%)

Query: 119 AFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFV 178
              SQ V   + T  LF+GDL+  +D+E L   FK+F +     V  D +TG S GYG++
Sbjct: 90  GLDSQSVIESQPTIALFIGDLDEQIDEEILIQIFKKFKSLTSVKVCTDAETGKSLGYGYL 149

Query: 179 SFGSQEEAQKAMDAMQGHELNGRPLRI 205
           +F  +++   A +      + G+ +RI
Sbjct: 150 NFSRRQDTLAATEEFNYRPIFGKEVRI 176

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 74/159 (46%), Gaps = 5/159 (3%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVD-KNNSNANYAFVEYFQSHDANIALQTL 104
           L++G+LD  I+EEIL Q F+    + +VK+  D +   +  Y ++ + +  D   A +  
Sbjct: 105 LFIGDLDEQIDEEILIQIFKKFKSLTSVKVCTDAETGKSLGYGYLNFSRRQDTLAATEEF 164

Query: 105 NGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVM 164
           N + I    V+I  + ++     +  T N+F  +L ++  + T R  +  F  Y  G+++
Sbjct: 165 NYRPIFGKEVRIMPSLRNTFYRKNIGT-NIFFSNLPLENSNLTTRVFYDTFKVY--GNIL 221

Query: 165 WDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPL 203
              +    +  GF+ F +   A+  +    G E  G  +
Sbjct: 222 -SCKLDKRKNIGFIYFDNDHAARVVIKEFNGSEFFGNKI 259

 Score = 31.2 bits (69), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 33/171 (19%), Positives = 74/171 (43%), Gaps = 15/171 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           ++V NL  S  ++ +  YF   GP+ +V      +   +++AFV Y +  D N A++  +
Sbjct: 316 IFVKNLPPSCPDDEILDYFSNLGPVKSV-FSSTSHKYESSWAFVTYKKGSDTNKAVKIYH 374

Query: 106 GKQIENNVVKI-----------NWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKE 154
           G Q +   + +           ++  QS ++S       L++ +L+   +++ L     E
Sbjct: 375 GAQFKGRKLSVIKAESARNGHGSYNKQSSKISYRPI---LYLQNLSSVCNEQFLLQMCME 431

Query: 155 FPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRI 205
               ++   + D         G+V   S+++A K +  +    + G  ++I
Sbjct: 432 ERIKIENLGITDFFHDSFTYSGYVKCKSKKDADKILKLLNNRLIGGCEVKI 482

>SAKL0B06270g Chr2 complement(532445..533074) [630 bp, 209 aa] {ON}
           similar to uniprot|Q99181 Saccharomyces cerevisiae
           YOR319W
          Length = 209

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 87/171 (50%), Gaps = 7/171 (4%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDK-NNSNANYAFVEYFQSHDANIALQTL 104
           LY+GN+D ++ +++L + F    PI+ ++   DK  +++  YAF+E+F   DA+  ++ +
Sbjct: 12  LYIGNIDPNVTKDLLYELFIQVSPISKIRYPRDKILDTHQGYAFIEFFTKEDADYVVKVM 71

Query: 105 NGK-QIENNVVKINWA----FQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYL 159
           N   Q+ N  +K+  A      SQ     E    LFV +L+  VD   L   F +F  + 
Sbjct: 72  NNTVQLYNRTLKVRRANSNTAASQPSKHVEIGAKLFVKNLDDLVDVAALAKIFGKFGPFS 131

Query: 160 QGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
           +   ++ ++    +   ++ + + +++ +A+  +    +  R + +++A K
Sbjct: 132 KQPEIFHVKQADYKC-AYIYYTTFDDSDQALAKLNNQIVFNRSISVDYAFK 181

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 40/79 (50%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           L+V NLD  ++   L + F   GP +    +     ++   A++ Y    D++ AL  LN
Sbjct: 106 LFVKNLDDLVDVAALAKIFGKFGPFSKQPEIFHVKQADYKCAYIYYTTFDDSDQALAKLN 165

Query: 106 GKQIENNVVKINWAFQSQQ 124
            + + N  + +++AF+ ++
Sbjct: 166 NQIVFNRSISVDYAFKDEK 184

>TDEL0B06060 Chr2 complement(1071469..1072506) [1038 bp, 345 aa]
           {ON} Anc_1.408 YNL004W
          Length = 345

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 79/180 (43%), Gaps = 22/180 (12%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           +++GNL      E LK +F   G +    I+  + +       VE+  S D + A++  +
Sbjct: 48  IFIGNLTYDCTPEDLKDHFSEVGEVVRADIITSRGHHRG-MGTVEFTNSDDVDEAIRRYD 106

Query: 106 GKQIENNVVKINW----AFQSQQVSPDEA----------------TFNLFVGDLNVDVDD 145
                +  V +         +++  P EA                 + +FV +L   ++ 
Sbjct: 107 SSYFMDRQVFVRQDNPPPESARERPPREARERVKARDQYPQHQYPAYEVFVANLPYSINW 166

Query: 146 ETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRI 205
           + L++ FKE    ++  V  D + G SRG+G   FG+ EE Q A++   G+EL GR L +
Sbjct: 167 QALKDMFKEVGNVIRADVELD-RNGYSRGFGTAIFGTSEEMQAAIERYNGYELEGRVLDV 225

 Score = 36.6 bits (83), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 46/108 (42%), Gaps = 9/108 (8%)

Query: 12  TVESEVPASETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIA 71
             E+EVP     +E         + GG E ++ ++Y  NL  S     L   F+  G + 
Sbjct: 244 AAEAEVPQKSEFTE--------GVLGGGERNN-LIYCTNLPLSTATSDLYDLFETIGKVN 294

Query: 72  NVKIMVDKNNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWA 119
           N ++  D +      A VEY    DA++ ++ LN        + I++A
Sbjct: 295 NAELKYDADGQPLGIAVVEYANIEDADVCMERLNNYNYGGCDLDISYA 342

>TDEL0B01010 Chr2 complement(189048..189680) [633 bp, 210 aa] {ON}
           Anc_8.797 YOR319W
          Length = 210

 Score = 55.1 bits (131), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 83/172 (48%), Gaps = 8/172 (4%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKN-NSNANYAFVEYFQSHDANIALQTL 104
           +YVGN+D  + +E L + F    PIAN++   DK    +  +AFVE++   D    +Q L
Sbjct: 12  VYVGNIDPKVTKENLYELFVQVSPIANIRYPKDKVLQLHQGFAFVEFYTPEDCQYVVQLL 71

Query: 105 NGK-QIENNVVKINWA-FQSQQVSPDEATF----NLFVGDLNVDVDDETLRNAFKEFPTY 158
           N   Q+ +  +K+  A  QS      + T      +FV +L+  +D+  L   F +F   
Sbjct: 72  NNTVQLYDRFLKVRKANVQSSGSDTIDVTIQPIAKVFVKNLDPSIDEPHLSRLFGKFGPL 131

Query: 159 LQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
            +G  ++ +  G  R   ++ F + + +  A+  + G  +  + + +++A K
Sbjct: 132 AKGPEIFYLSDGQLRC-AYIYFKNYDHSDLALATLNGQLVVNKKVTVDYAFK 182

 Score = 45.1 bits (105), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 55/101 (54%), Gaps = 8/101 (7%)

Query: 28  SVVPANAIKGGRETSDKVL------YVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNN 81
            V  AN    G +T D  +      +V NLD SI+E  L + F   GP+A    +   ++
Sbjct: 83  KVRKANVQSSGSDTIDVTIQPIAKVFVKNLDPSIDEPHLSRLFGKFGPLAKGPEIFYLSD 142

Query: 82  SNANYAFVEYFQSHD-ANIALQTLNGKQIENNVVKINWAFQ 121
                A++ YF+++D +++AL TLNG+ + N  V +++AF+
Sbjct: 143 GQLRCAYI-YFKNYDHSDLALATLNGQLVVNKKVTVDYAFK 182

>NCAS0C04600 Chr3 (940040..941785) [1746 bp, 581 aa] {ON} Anc_3.49
          Length = 581

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 71/147 (48%), Gaps = 12/147 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNA-NYAFVEYFQSHDANIALQT- 103
           +++G L+    E+ LK YF   G +  +KIM D     +  + F+ +      +  ++T 
Sbjct: 198 MFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTFENPSSVDEVVKTQ 257

Query: 104 --LNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQG 161
             L+GK I+    K +   + Q     + T  +FVG +  DV  +   + F ++ T +  
Sbjct: 258 HILDGKVID---PKRSIPREEQ-----DKTGKIFVGGIGTDVRPKEFEDFFAQYGTIIDA 309

Query: 162 HVMWDMQTGGSRGYGFVSFGSQEEAQK 188
            +M D  TG SRG+GFV++ S +   +
Sbjct: 310 QLMLDKDTGRSRGFGFVTYDSGDAVDR 336

>Kpol_1018.122 s1018 (325215..327119) [1905 bp, 634 aa] {ON}
           (325215..327119) [1905 nt, 635 aa]
          Length = 634

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 78/154 (50%), Gaps = 5/154 (3%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNA-NYAFVEYFQSHDANIALQTL 104
           LY+G+L+  + E++LK +F +   + +VKI VD ++  +  Y ++      +A+  ++  
Sbjct: 101 LYIGDLEKFVTEDMLKNFFAMYKSLLSVKICVDSHSGESLGYGYLNLTTKEEADDLMERF 160

Query: 105 NGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVM 164
           N   I   VV+I  + ++ Q   +  T N+F  DL +     T R+ +  F  Y  G+++
Sbjct: 161 NYTPIFGKVVRIMPSLRNSQTRKNMGT-NVFFSDLPLSEKSITTRDFYNFFKAY--GNIL 217

Query: 165 WDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHEL 198
              +   S+  GF+ F ++  A++ +     +EL
Sbjct: 218 -SCKLNTSKNIGFIFFENESSAKEVISKFNANEL 250

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 40/72 (55%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           L++GDL   V ++ L+N F  + + L   +  D  +G S GYG+++  ++EEA   M+  
Sbjct: 101 LYIGDLEKFVTEDMLKNFFAMYKSLLSVKICVDSHSGESLGYGYLNLTTKEEADDLMERF 160

Query: 194 QGHELNGRPLRI 205
               + G+ +RI
Sbjct: 161 NYTPIFGKVVRI 172

>AEL016C Chr5 complement(605004..607040) [2037 bp, 678 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR023W
           (PES4) and YHR015W (MIP6)
          Length = 678

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 45/72 (62%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           LF+GDL+  V ++ LR+ F +F +++   +  D  T  S GYG+++F ++E+A++ ++  
Sbjct: 118 LFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDAERVIEEF 177

Query: 194 QGHELNGRPLRI 205
               + GR +RI
Sbjct: 178 NYIPIFGREVRI 189

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 73/166 (43%), Gaps = 13/166 (7%)

Query: 41  TSDKV--LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNA-NYAFVEYFQSHDA 97
           TS K+  L++G+LD  + E+ L+  F       + KI +D N   +  Y ++ +    DA
Sbjct: 111 TSKKLVALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDA 170

Query: 98  NIALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDL---NVDVDDETLRNAFKE 154
              ++  N   I    V+I  + ++     +  T N+F  +L   N+ +      +AFK+
Sbjct: 171 ERVIEEFNYIPIFGREVRIMPSLRNSFYRKNIGT-NVFFSNLPLENLALTTRVFYDAFKK 229

Query: 155 FPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNG 200
           F     G ++   +    +  GFV F     A++A+    G E  G
Sbjct: 230 F-----GKIL-SCKLDRRKNIGFVYFEKDSAAKQAIAEYNGKEFFG 269

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 23/39 (58%)

Query: 172 SRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
           S  + F++F    +AQ A+D +   +L GRP+ ++ A K
Sbjct: 363 SSAWAFITFQKGSDAQDAIDNLNHSQLLGRPIELSRAQK 401

 Score = 30.4 bits (67), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 19/85 (22%), Positives = 45/85 (52%), Gaps = 1/85 (1%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           +++ NL  + + ++L  YF   GP+ ++    + +  ++ +AF+ + +  DA  A+  LN
Sbjct: 327 VFIKNLPLNPDSDLLLDYFSQIGPVKSI-FTSNVSKLSSAWAFITFQKGSDAQDAIDNLN 385

Query: 106 GKQIENNVVKINWAFQSQQVSPDEA 130
             Q+    ++++ A ++ Q   D A
Sbjct: 386 HSQLLGRPIELSRAQKNFQTDIDAA 410

>KLLA0C12925g Chr3 (1094574..1096286) [1713 bp, 570 aa] {ON} weakly
           similar to uniprot|Q99383 Saccharomyces cerevisiae
           YOL123W HRP1 Subunit of cleavage factor I a five-subunit
           complex required for the cleavage and polyadenylation of
           pre-mRNA 3' ends RRM-containing heteronuclear RNA
           binding protein and hnRNPA/B family member that binds to
           poly (A) signal sequences
          Length = 570

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 71/151 (47%), Gaps = 12/151 (7%)

Query: 34  AIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNAN-YAFVEYF 92
           AIK         +++G L+    EE L+ YF   G +A VKIM D     +  + F+ + 
Sbjct: 176 AIKADLSRDINKMFIGGLNWETTEEGLRDYFSKYGAVAEVKIMKDTATGRSRGFGFLTFE 235

Query: 93  QSHDANIALQT---LNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLR 149
            +   +  ++T   L+GK     V+    A   ++    + T  +FVG +  DV  +   
Sbjct: 236 NASSVDEVVKTQHILDGK-----VIDPKRAIPREE---QDKTGKIFVGGIGPDVRPKEFE 287

Query: 150 NAFKEFPTYLQGHVMWDMQTGGSRGYGFVSF 180
             F ++ + +   +M D  TG SRG+GF+++
Sbjct: 288 EFFSQWGSIIDAQLMLDKDTGRSRGFGFITY 318

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 50/109 (45%), Gaps = 9/109 (8%)

Query: 9   QNPTVESEVPASETISEEPSVVPANAIKGGRETSDKV--LYVGNLDTSINEEILKQYFQV 66
           +N +   EV  ++ I +   + P  AI   RE  DK   ++VG +   +  +  +++F  
Sbjct: 235 ENASSVDEVVKTQHILDGKVIDPKRAIP--REEQDKTGKIFVGGIGPDVRPKEFEEFFSQ 292

Query: 67  GGPIANVKIMVDKNNSNAN-YAFVEYFQSHDANIALQT----LNGKQIE 110
            G I + ++M+DK+   +  + F+ Y      +   Q       GKQIE
Sbjct: 293 WGSIIDAQLMLDKDTGRSRGFGFITYDTPDAVDRVCQNKFIEFKGKQIE 341

>Ecym_2746 Chr2 (1447502..1449547) [2046 bp, 681 aa] {ON} similar to
           Ashbya gossypii AEL016C
          Length = 681

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 45/72 (62%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           LF+GDL+  V ++ LR+ F +F +++   +  D  T  S GYG+++F ++E+A++ ++  
Sbjct: 122 LFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDAERVIEEF 181

Query: 194 QGHELNGRPLRI 205
               + GR +RI
Sbjct: 182 NYIPIFGREVRI 193

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 73/166 (43%), Gaps = 13/166 (7%)

Query: 41  TSDKV--LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNA-NYAFVEYFQSHDA 97
           TS K+  L++G+LD  + E+ L+  F       + KI +D N   +  Y ++ +    DA
Sbjct: 115 TSKKLVALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDA 174

Query: 98  NIALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDL---NVDVDDETLRNAFKE 154
              ++  N   I    V+I  + ++     +  T N+F  +L   N+ +      +AFK+
Sbjct: 175 ERVIEEFNYIPIFGREVRIMPSLRNSFYRKNIGT-NVFFSNLPLENLALTTRVFYDAFKK 233

Query: 155 FPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNG 200
           +     G ++   +    +  GFV F     A++A+    G +  G
Sbjct: 234 Y-----GKIL-SCKLDRRKNIGFVYFEKDSSAKQAIAEYNGKQFYG 273

 Score = 34.7 bits (78), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 46/85 (54%), Gaps = 1/85 (1%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           +++ NL  + + ++L  YF   GP+ ++    + +  N+ +AF+ + +  DA  A+ +LN
Sbjct: 331 VFIKNLPLNSDSDLLLDYFSQIGPVKSI-FTSNVSKLNSAWAFITFKKGSDAQDAIDSLN 389

Query: 106 GKQIENNVVKINWAFQSQQVSPDEA 130
             Q+    ++++ A ++ Q   D A
Sbjct: 390 HSQLLGRTIELSRAQKNFQSDIDAA 414

>CAGL0I09900g Chr9 (946987..947622) [636 bp, 211 aa] {ON} similar to
           uniprot|Q99181 Saccharomyces cerevisiae YOR319w
           essential yeast splicing factor
          Length = 211

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 81/179 (45%), Gaps = 17/179 (9%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDK-NNSNANYAFVEYFQSHDANIALQTL 104
           +YVGN+DT + +E+L + F   G +  VK   DK +     +AF+E+F + DA+  L  +
Sbjct: 8   IYVGNIDTKVTKELLYELFTQVGQVKKVKYPKDKISQEYQGFAFIEFFSTADADYVLNVM 67

Query: 105 NGK-QIENNVVKINWAFQSQQVSPDEA------------TFNLFVGDLNVDVDDETLRNA 151
           N   ++   V+KI  +  +Q V  D+A               +FV D+   V+   L   
Sbjct: 68  NNNVKLYQKVLKIRRS--NQAVQKDDANKKHELDASLLPVAKVFVKDIADTVEVRHLTQL 125

Query: 152 FKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
           F +F    +   ++ +  G  R   F+ F   + A  A+  + G  +  +   + +A K
Sbjct: 126 FSKFGPLAKTPEVFTVSNGEVRC-AFIYFKFYDNADLAIQTLNGQFIMNKKASLEYAFK 183

>ABL134C Chr2 complement(140623..141750) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL175C
           (NOP13)
          Length = 375

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 100/228 (43%), Gaps = 41/228 (17%)

Query: 8   EQNPTVESE--VPASETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQY-- 63
           EQ  T E++   PA+E   EEP   P    K G       +++GN+     +E L+++  
Sbjct: 77  EQKETAENDDAEPAAE---EEPKPAPRKEKKFG-------VWIGNMAFDTTQEELRRFVV 126

Query: 64  -----FQVG----GPIANVKIMVDKNN----SNANYAFVEYFQSH--DANIALQ--TLNG 106
                 + G      I  V + + KN+     N  +A+V++  S   DA I L    LNG
Sbjct: 127 SKTAGMEAGEVTDADIVRVNMPLAKNDGKQIKNKGFAYVDFATSAQMDAVIGLSEAQLNG 186

Query: 107 KQIENNVVKINWAFQSQQVSPDEATFN-------LFVGDLNVDVDDETLRNAFKEFPTYL 159
           +   N ++K   ++  +    D  + +       LFVG+L+ D  DE L+  F+     +
Sbjct: 187 R---NLLIKNAKSYDGRPAKNDLISMSKNPPSRILFVGNLSFDTTDELLKKHFQHCGEIV 243

Query: 160 QGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINW 207
           +  +     +G  +G+ FV F  +  A  A+       + GRPLR+ +
Sbjct: 244 KIRMATFQDSGKCKGFAFVDFRDEAGATAALTDRSCRAIAGRPLRMEY 291

>YFR023W Chr6 (199874..201709) [1836 bp, 611 aa] {ON}  PES4Poly(A)
           binding protein, suppressor of DNA polymerase epsilon
           mutation, similar to Mip6p
          Length = 611

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 58/87 (66%), Gaps = 6/87 (6%)

Query: 119 AFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFV 178
           +F+S+++ P      LF+GDL+  V +ETL+  FK++P+++   V  D  T  S G+G++
Sbjct: 84  SFESKKLVP------LFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKKSLGHGYL 137

Query: 179 SFGSQEEAQKAMDAMQGHELNGRPLRI 205
           +F  +EEA+KAM+ +   ++NG+ +RI
Sbjct: 138 NFEDKEEAEKAMEELNYTKVNGKEIRI 164

>Smik_7.334 Chr7 (561338..563173) [1836 bp, 611 aa] {ON} YFR023W
           (REAL)
          Length = 611

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 57/87 (65%), Gaps = 6/87 (6%)

Query: 119 AFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFV 178
            F+S+++ P      LF+GDL+  V +ETL+  FK++P+++   V  D  T  S G+G++
Sbjct: 84  VFESKKLVP------LFIGDLDETVTEETLKEIFKKYPSFVSSKVCLDSVTKKSLGHGYL 137

Query: 179 SFGSQEEAQKAMDAMQGHELNGRPLRI 205
           +F  +EEA+KAM+ +   ++NG+ +RI
Sbjct: 138 NFEDKEEAEKAMEELNYTKVNGKEIRI 164

 Score = 33.5 bits (75), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 31/159 (19%), Positives = 72/159 (45%), Gaps = 5/159 (3%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDK-NNSNANYAFVEYFQSHDANIALQTL 104
           L++G+LD ++ EE LK+ F+      + K+ +D     +  + ++ +    +A  A++ L
Sbjct: 93  LFIGDLDETVTEETLKEIFKKYPSFVSSKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 105 NGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVM 164
           N  ++    ++I  + ++     +  T N+F  +L ++    T R  +  F  Y  G ++
Sbjct: 153 NYTKVNGKEIRIMPSLRNTTFRKNFGT-NVFFSNLPLNNPLLTTRVFYDTFSRY--GKIL 209

Query: 165 WDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPL 203
              +    +  GFV F  ++ A+  +         G+ +
Sbjct: 210 -SCKLDSRKDIGFVYFEDEKTARSVIKMYNNTNFFGKKI 247

 Score = 30.4 bits (67), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 37/80 (46%), Gaps = 3/80 (3%)

Query: 45  VLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDK--NNSNANYAFVEYFQSHDANIALQ 102
            L++ NL    N+E LK Y      I   KI +D+   NS+    ++++    DA     
Sbjct: 394 TLFLENLSAVCNKEFLK-YLCHQENIRPFKIQIDRYDENSSTYSGYIKFRNFEDATRIFN 452

Query: 103 TLNGKQIENNVVKINWAFQS 122
            LN + +  ++V  +W  QS
Sbjct: 453 FLNSRLVGGSIVMTSWERQS 472

>Smik_15.30 Chr15 (55895..57505) [1611 bp, 536 aa] {ON} YOL123W
           (REAL)
          Length = 536

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 70/143 (48%), Gaps = 16/143 (11%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVD-KNNSNANYAFVEYFQSHDANIALQT- 103
           +++G L+    E+ L++YF   G + ++KIM D     +  + F+ + +    +  ++T 
Sbjct: 161 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ 220

Query: 104 --LNGKQIENNVVKINWAFQSQQVSPDE--ATFNLFVGDLNVDVDDETLRNAFKEFPTYL 159
             L+GK I+            + +  DE   T  +FVG +  DV  +     F ++ T +
Sbjct: 221 HILDGKVID----------PKRAIPRDEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTII 270

Query: 160 QGHVMWDMQTGGSRGYGFVSFGS 182
              +M D  TG SRG+GFV++ S
Sbjct: 271 DAQLMLDKDTGQSRGFGFVTYDS 293

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 43/86 (50%), Gaps = 5/86 (5%)

Query: 9   QNPTVESEVPASETISEEPSVVPANAIKGGRETSDKV--LYVGNLDTSINEEILKQYFQV 66
           + P+   EV  ++ I +   + P  AI   R+  DK   ++VG +   +  +  +++F  
Sbjct: 208 EKPSSVDEVVKTQHILDGKVIDPKRAIP--RDEQDKTGKIFVGGIGPDVRPKEFEEFFSQ 265

Query: 67  GGPIANVKIMVDKNNSNA-NYAFVEY 91
            G I + ++M+DK+   +  + FV Y
Sbjct: 266 WGTIIDAQLMLDKDTGQSRGFGFVTY 291

>TDEL0D02250 Chr4 complement(432801..434669) [1869 bp, 622 aa] {ON}
           Anc_1.357 YHR015W
          Length = 622

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 75/156 (48%), Gaps = 5/156 (3%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNA-NYAFVEYFQSHDANIALQTL 104
           L++G+L+ S+ E +L+  F     + +VKI +D N+  +  Y ++ +  S DA  A +  
Sbjct: 99  LFIGDLEPSVTENMLRDIFGKFRSLTSVKICLDSNSGKSLGYGYLNFANSEDAEKATEEF 158

Query: 105 NGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVM 164
           N + IE   V+I  + ++     +  T N+F  +L ++    T R  +  F  Y  G ++
Sbjct: 159 NYRPIEGQEVRIMPSLRNSFYRKNVGT-NVFFSNLPLEDSRLTTRVFYDTFKKY--GKIL 215

Query: 165 WDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNG 200
              +    +  GF+ F + + A+K +    G E  G
Sbjct: 216 -SCKLDKRKDIGFIYFNNDQSARKVIKDYNGKEFFG 250

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 41/72 (56%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           LF+GDL   V +  LR+ F +F +     +  D  +G S GYG+++F + E+A+KA +  
Sbjct: 99  LFIGDLEPSVTENMLRDIFGKFRSLTSVKICLDSNSGKSLGYGYLNFANSEDAEKATEEF 158

Query: 194 QGHELNGRPLRI 205
               + G+ +RI
Sbjct: 159 NYRPIEGQEVRI 170

>TPHA0F02820 Chr6 (627799..629625) [1827 bp, 608 aa] {ON} Anc_6.104
           YBR212W
          Length = 608

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 68/144 (47%), Gaps = 19/144 (13%)

Query: 84  ANYAFVEYFQSHDANIALQTLNGKQIEN---------------NVVKINWAFQS--QQVS 126
           A Y FVE F+S    IA  +LN   I N                  ++NWA  +  Q + 
Sbjct: 119 AGYCFVE-FESQQDVIAALSLNKAVIPNIFSESINLYTNPNGRRTFRLNWASGATLQSLI 177

Query: 127 PDEATFNLFVGDLNVDVDDETLRNAF-KEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEE 185
           P    ++LF+GDL+    +  + + F K++ +     VM D   G SRG+GF+ F  ++E
Sbjct: 178 PATPEYSLFIGDLSPLTTEADILSIFQKKYKSVKTVRVMTDPINGSSRGFGFIRFSDEDE 237

Query: 186 AQKAMDAMQGHELNGRPLRINWAS 209
            + A++ M G   + R  R+  A+
Sbjct: 238 RKDALENMNGVMCHSRYFRLALAT 261

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 45/85 (52%), Gaps = 6/85 (7%)

Query: 124 QVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQ 183
            V+ D +   +F+G L+   ++  L+  F+ F     G+++  ++    +  GFV F  +
Sbjct: 334 HVNLDNSNTTVFIGGLSTSTNEYELQVLFEPF-----GNIL-SVKIPIGKNCGFVKFKRK 387

Query: 184 EEAQKAMDAMQGHELNGRPLRINWA 208
            EA  A+  MQG  +NG P+R++W 
Sbjct: 388 IEANAAIKGMQGFIINGNPIRLSWG 412

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 33/72 (45%)

Query: 293 TTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 352
           TT +IG +     E +L  L + FG I+  K    K C F+K+    +A   I  +  F 
Sbjct: 342 TTVFIGGLSTSTNEYELQVLFEPFGNILSVKIPIGKNCGFVKFKRKIEANAAIKGMQGFI 401

Query: 353 FQGRNLRTGWGK 364
             G  +R  WGK
Sbjct: 402 INGNPIRLSWGK 413

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 45/80 (56%), Gaps = 5/80 (6%)

Query: 40  ETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANI 99
           + S+  +++G L TS NE  L+  F+  G I +VKI + K     N  FV++ +  +AN 
Sbjct: 338 DNSNTTVFIGGLSTSTNEYELQVLFEPFGNILSVKIPIGK-----NCGFVKFKRKIEANA 392

Query: 100 ALQTLNGKQIENNVVKINWA 119
           A++ + G  I  N ++++W 
Sbjct: 393 AIKGMQGFIINGNPIRLSWG 412

>Suva_15.37 Chr15 (65421..67076) [1656 bp, 551 aa] {ON} YOL123W
           (REAL)
          Length = 551

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 70/143 (48%), Gaps = 16/143 (11%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVD-KNNSNANYAFVEYFQSHDANIALQT- 103
           +++G L+    E+ L++YF   G + ++KIM D     +  + F+ + +    +  ++T 
Sbjct: 163 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ 222

Query: 104 --LNGKQIENNVVKINWAFQSQQVSPDE--ATFNLFVGDLNVDVDDETLRNAFKEFPTYL 159
             L+GK I+            + +  DE   T  +FVG +  DV  +     F ++ T +
Sbjct: 223 HILDGKVID----------PKRAIPRDEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTII 272

Query: 160 QGHVMWDMQTGGSRGYGFVSFGS 182
              +M D  TG SRG+GFV++ S
Sbjct: 273 DAQLMLDKDTGQSRGFGFVTYDS 295

>YOL123W Chr15 (87844..89448) [1605 bp, 534 aa] {ON}  HRP1Subunit of
           cleavage factor I, a five-subunit complex required for
           the cleavage and polyadenylation of pre-mRNA 3' ends;
           RRM-containing heteronuclear RNA binding protein and
           hnRNPA/B family member that binds to poly (A) signal
           sequences
          Length = 534

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 70/143 (48%), Gaps = 16/143 (11%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVD-KNNSNANYAFVEYFQSHDANIALQT- 103
           +++G L+    E+ L++YF   G + ++KIM D     +  + F+ + +    +  ++T 
Sbjct: 161 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ 220

Query: 104 --LNGKQIENNVVKINWAFQSQQVSPDE--ATFNLFVGDLNVDVDDETLRNAFKEFPTYL 159
             L+GK I+            + +  DE   T  +FVG +  DV  +     F ++ T +
Sbjct: 221 HILDGKVID----------PKRAIPRDEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTII 270

Query: 160 QGHVMWDMQTGGSRGYGFVSFGS 182
              +M D  TG SRG+GFV++ S
Sbjct: 271 DAQLMLDKDTGQSRGFGFVTYDS 293

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 43/86 (50%), Gaps = 5/86 (5%)

Query: 9   QNPTVESEVPASETISEEPSVVPANAIKGGRETSDKV--LYVGNLDTSINEEILKQYFQV 66
           + P+   EV  ++ I +   + P  AI   R+  DK   ++VG +   +  +  +++F  
Sbjct: 208 EKPSSVDEVVKTQHILDGKVIDPKRAIP--RDEQDKTGKIFVGGIGPDVRPKEFEEFFSQ 265

Query: 67  GGPIANVKIMVDKNNSNA-NYAFVEY 91
            G I + ++M+DK+   +  + FV Y
Sbjct: 266 WGTIIDAQLMLDKDTGQSRGFGFVTY 291

>Skud_15.30 Chr15 (52950..54569) [1620 bp, 539 aa] {ON} YOL123W
           (REAL)
          Length = 539

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 70/143 (48%), Gaps = 16/143 (11%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVD-KNNSNANYAFVEYFQSHDANIALQT- 103
           +++G L+    E+ L++YF   G + ++KIM D     +  + F+ + +    +  ++T 
Sbjct: 164 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ 223

Query: 104 --LNGKQIENNVVKINWAFQSQQVSPDE--ATFNLFVGDLNVDVDDETLRNAFKEFPTYL 159
             L+GK I+            + +  DE   T  +FVG +  DV  +     F ++ T +
Sbjct: 224 HILDGKVID----------PKRAIPRDEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTII 273

Query: 160 QGHVMWDMQTGGSRGYGFVSFGS 182
              +M D  TG SRG+GFV++ S
Sbjct: 274 DAQLMLDKDTGQSRGFGFVTYDS 296

>TPHA0F02310 Chr6 (507306..508508) [1203 bp, 400 aa] {ON} Anc_2.80
           YNL175C
          Length = 400

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 68/137 (49%), Gaps = 14/137 (10%)

Query: 83  NANYAFVEY--FQSHDANIALQT--LNGKQIENNVVKINWAFQSQQVSPDEATFN----- 133
           N  + ++++   +  ++ IAL    LNG+++   ++K +  +  +    D  + +     
Sbjct: 176 NKGFCYIDFKTLEQMESAIALSETELNGRKL---LIKSSTDYAGRPDKSDLVSMSKNPPS 232

Query: 134 --LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMD 191
             LFVG+L+ D  DE LR  F+     ++  +     +G  +G+ FV F ++E A KA+ 
Sbjct: 233 RILFVGNLSFDTTDELLRKHFQHCGDIVKIRMATFQDSGKCKGFAFVDFKNEEGATKALS 292

Query: 192 AMQGHELNGRPLRINWA 208
                ++ GRPLR+ + 
Sbjct: 293 DKSCRKIAGRPLRMEFG 309

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 44  KVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNAN-YAFVEYFQSHDANIALQ 102
           ++L+VGNL     +E+L+++FQ  G I  +++   +++     +AFV++     A  AL 
Sbjct: 233 RILFVGNLSFDTTDELLRKHFQHCGDIVKIRMATFQDSGKCKGFAFVDFKNEEGATKALS 292

Query: 103 TLNGKQIENNVVKINWA 119
             + ++I    +++ + 
Sbjct: 293 DKSCRKIAGRPLRMEFG 309

>NDAI0G03970 Chr7 (945738..947561) [1824 bp, 607 aa] {ON} Anc_3.49
           YOL123W
          Length = 607

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 69/147 (46%), Gaps = 12/147 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNA-NYAFVEYFQSHDANIALQT- 103
           +++G L+    E+ L+ YF   G +  +KIM D     +  + F+ +      +  ++T 
Sbjct: 199 MFIGGLNWETTEDGLRNYFNKYGNVIELKIMKDGATGRSRGFGFLTFEHPSSVDEVVKTQ 258

Query: 104 --LNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQG 161
             L+GK I+    K +   + Q     +    +FVG +  DV  +     F +F T +  
Sbjct: 259 HILDGKVID---PKRSIPKEEQ-----DKIGKIFVGGIGTDVRPKEFEEFFAQFGTIIDA 310

Query: 162 HVMWDMQTGGSRGYGFVSFGSQEEAQK 188
            +M D  TG SRG+GF+++ S +   K
Sbjct: 311 QLMLDKDTGRSRGFGFITYDSADAVDK 337

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 54/109 (49%), Gaps = 9/109 (8%)

Query: 9   QNPTVESEVPASETISEEPSVVPANAIKGGRETSDKV--LYVGNLDTSINEEILKQYFQV 66
           ++P+   EV  ++ I +   + P  +I   +E  DK+  ++VG + T +  +  +++F  
Sbjct: 246 EHPSSVDEVVKTQHILDGKVIDPKRSIP--KEEQDKIGKIFVGGIGTDVRPKEFEEFFAQ 303

Query: 67  GGPIANVKIMVDKNNSNA-NYAFVEYFQSHDANIALQT----LNGKQIE 110
            G I + ++M+DK+   +  + F+ Y  +   +   Q       GKQIE
Sbjct: 304 FGTIIDAQLMLDKDTGRSRGFGFITYDSADAVDKVCQNKYIDFKGKQIE 352

>TDEL0H03240 Chr8 complement(540934..541437) [504 bp, 167 aa] {ON}
           Anc_7.159 YIR005W
          Length = 167

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 62/109 (56%), Gaps = 4/109 (3%)

Query: 100 ALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYL 159
           A+Q +N  ++ + ++  N ++ ++    D A   +F+G LNV++ +  +   F ++   +
Sbjct: 6   AIQRINDTELSSGILSPNLSWHNEY--KDRAY--IFIGGLNVELTEADILTIFSQYGIPV 61

Query: 160 QGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWA 208
              ++ D +TG S+G+G++ +  Q  A  A+D + G ++ GR ++++ A
Sbjct: 62  DVFLVRDRETGDSKGFGYLKYEDQRSAVLAIDNLNGSKIAGRIIKVDHA 110

 Score = 36.6 bits (83), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 45/77 (58%), Gaps = 3/77 (3%)

Query: 46  LYVGNLDTSINE-EILKQYFQVGGPIANVKIMVDKNNSNAN-YAFVEYFQSHDANIALQT 103
           +++G L+  + E +IL  + Q G P+ +V ++ D+   ++  + +++Y     A +A+  
Sbjct: 36  IFIGGLNVELTEADILTIFSQYGIPV-DVFLVRDRETGDSKGFGYLKYEDQRSAVLAIDN 94

Query: 104 LNGKQIENNVVKINWAF 120
           LNG +I   ++K++ A+
Sbjct: 95  LNGSKIAGRIIKVDHAW 111

>Kpol_1041.4 s1041 (12746..13900) [1155 bp, 384 aa] {ON}
           (12746..13900) [1155 nt, 385 aa]
          Length = 384

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 41/75 (54%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           LFVG+L+ D  D+ LR  F+     ++  +     TG  +G+ FV F ++E A KA+   
Sbjct: 224 LFVGNLSFDTTDDLLRKHFQHCGEIIKIRMATFQDTGKCKGFAFVDFKNEEGATKALTDK 283

Query: 194 QGHELNGRPLRINWA 208
              ++ GRPLR+ + 
Sbjct: 284 SCRKIAGRPLRMEFG 298

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 44  KVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNAN-YAFVEYFQSHDANIALQ 102
           ++L+VGNL     +++L+++FQ  G I  +++   ++      +AFV++     A  AL 
Sbjct: 222 RILFVGNLSFDTTDDLLRKHFQHCGEIIKIRMATFQDTGKCKGFAFVDFKNEEGATKALT 281

Query: 103 TLNGKQI 109
             + ++I
Sbjct: 282 DKSCRKI 288

>SAKL0D09680g Chr4 (803363..805381) [2019 bp, 672 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae or to YHR015W
           uniprot|P38760 Saccharomyces cerevisiae
          Length = 672

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 44/72 (61%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           LF+GDL+  V ++ LR+ F ++P+ +   +  D  +  S GYG+++F + E+A+KA +  
Sbjct: 104 LFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDEDAEKATEEF 163

Query: 194 QGHELNGRPLRI 205
               L G+ +RI
Sbjct: 164 NYVPLFGKEVRI 175

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 77/176 (43%), Gaps = 8/176 (4%)

Query: 29  VVPANAIKGGRETSDK---VLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDK-NNSNA 84
           +V  + +K     S K    L++G+LD  + E++L+  F     + +VKI VD  +  + 
Sbjct: 84  IVKLDKLKDSLYLSSKRLVALFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSL 143

Query: 85  NYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVD 144
            Y ++ +    DA  A +  N   +    V+I  + ++     +  T N+F  +L ++  
Sbjct: 144 GYGYINFSNDEDAEKATEEFNYVPLFGKEVRIMPSLRNSFYRKNIGT-NVFFSNLPLENL 202

Query: 145 DETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNG 200
             T R  +  F  Y  G ++   +    +  GF+ F     A+ A+D   G E  G
Sbjct: 203 SLTTRAFYDTFKKY--GKIL-SCKLDRRKNIGFIYFDKDTSAKSAIDDFNGKEYYG 255

 Score = 34.7 bits (78), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 43/75 (57%), Gaps = 3/75 (4%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANV-KIMVDKNNSNANYAFVEYFQSHDANIALQTL 104
           ++V NL  + NE+ +  +F   GP+ +V    V K NS+  +AFV Y +  D + A++ L
Sbjct: 314 IFVKNLPVNANEDDILDFFSRIGPVKSVFTSKVPKYNSS--WAFVTYKKGSDTSEAIEKL 371

Query: 105 NGKQIENNVVKINWA 119
           NG+  ++  +++  A
Sbjct: 372 NGEIFKHRKIEVARA 386

>Kpol_1075.1a s1075 (1..795) [795 bp, 264 aa] {ON} (1..795) [795 nt,
           265 aa]
          Length = 264

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 1/78 (1%)

Query: 133 NLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDA 192
           NLFV +L+  VDDE L+  F  F T +   VM   + G S+ +GFV F + EEA +A+  
Sbjct: 22  NLFVKNLDDSVDDEKLQEEFSPFGTIISAKVMR-TEDGKSKNFGFVCFSTPEEATRAITE 80

Query: 193 MQGHELNGRPLRINWASK 210
                + G+PL +  A +
Sbjct: 81  KNQQIVAGKPLYVAIAQR 98

 Score = 38.5 bits (88), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 34/60 (56%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           L+V NLD S+++E L++ F   G I + K+M  ++  + N+ FV +    +A  A+   N
Sbjct: 23  LFVKNLDDSVDDEKLQEEFSPFGTIISAKVMRTEDGKSKNFGFVCFSTPEEATRAITEKN 82

>TBLA0B00810 Chr2 complement(175882..177051) [1170 bp, 389 aa] {ON}
           Anc_2.80 YNL175C
          Length = 389

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 41/75 (54%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           LFVG+L+ D  DE LR+ F+     ++        TG  +G+ F+ F ++E A KA+   
Sbjct: 224 LFVGNLSYDTTDELLRSHFQHCGEIVKIRTATFEDTGKCKGFSFIDFLTEESATKALKDK 283

Query: 194 QGHELNGRPLRINWA 208
              ++ GRP+R+ + 
Sbjct: 284 SCRKIAGRPIRMEYG 298

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 16/77 (20%), Positives = 40/77 (51%), Gaps = 1/77 (1%)

Query: 44  KVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNAN-YAFVEYFQSHDANIALQ 102
           ++L+VGNL     +E+L+ +FQ  G I  ++    ++      ++F+++     A  AL+
Sbjct: 222 RILFVGNLSYDTTDELLRSHFQHCGEIVKIRTATFEDTGKCKGFSFIDFLTEESATKALK 281

Query: 103 TLNGKQIENNVVKINWA 119
             + ++I    +++ + 
Sbjct: 282 DKSCRKIAGRPIRMEYG 298

>AAL018W Chr1 (309542..310555) [1014 bp, 337 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL004W (HRB1) and
           YCL011C (GBP2)
          Length = 337

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 74/173 (42%), Gaps = 15/173 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           +++GNL      E L+Q F   G +    I+  + + +     VEY  + D + A++  N
Sbjct: 9   VFIGNLTYDTTPEDLRQLFGEVGHVVRADIITSRGH-HRGMGTVEYTNAQDVDEAIRRFN 67

Query: 106 GKQI--------ENNVVKINWAFQSQQVSP-----DEATFNLFVGDLNVDVDDETLRNAF 152
           G            +N   +    + +   P         F +FV +L   +  +TL++ F
Sbjct: 68  GMDFMHRELFVRRDNPPPVGERRERRGPGPLPRRTHPGGFEIFVANLPYSISWQTLKDMF 127

Query: 153 KEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRI 205
           KE    +   V  D   G SRG+G V   ++E    A++   G+EL GR L +
Sbjct: 128 KECSEVIHADVSVDAD-GYSRGFGTVYVTTRENQIAAIERWNGYELEGRILEV 179

>CAGL0E01947g Chr5 (193462..194820) [1359 bp, 452 aa] {ON} some
           similarities with uniprot|Q99383 Saccharomyces
           cerevisiae YOL123w HRP1
          Length = 452

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 67/139 (48%), Gaps = 12/139 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVD-KNNSNANYAFVEYFQSHDANIALQT- 103
           +++G L+    E+ L+ YF   G +  +KIM D     +  + F+ +  +   +  ++T 
Sbjct: 124 MFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFLTFESASSVDEVVKTQ 183

Query: 104 --LNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQG 161
             L+GK     V+    A   ++    + T  +FVG +  DV  +     F ++ T +  
Sbjct: 184 HILDGK-----VIDPKRAIPREEQ---DKTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDA 235

Query: 162 HVMWDMQTGGSRGYGFVSF 180
            +M D  TG SRG+GF+++
Sbjct: 236 QLMLDKDTGRSRGFGFITY 254

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 38/68 (55%), Gaps = 2/68 (2%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           +F+G LN +  ++ LR+ F ++    +  +M D  TG SRG+GF++F S     + +   
Sbjct: 124 MFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFLTFESASSVDEVVKTQ 183

Query: 194 QGHELNGR 201
             H L+G+
Sbjct: 184 --HILDGK 189

>KNAG0G03260 Chr7 (701431..702036) [606 bp, 201 aa] {ON} Anc_8.797
           YOR319W
          Length = 201

 Score = 50.8 bits (120), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 60/140 (42%), Gaps = 4/140 (2%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKN-NSNANYAFVEYFQSHDANIALQTL 104
           LYVGN+D  +  E L + F    P+ +++   DK   +   YAFV      DA+ A+Q L
Sbjct: 8   LYVGNIDPRVTREQLYELFVQACPVVSLRYPRDKVLQTPQGYAFVGVPSVQDADYAVQLL 67

Query: 105 -NGKQIENNVVKINWAFQSQQVSPDEA-TFNLFVGDLNVDVDDETLRNAFKEFPTYLQGH 162
            N   +    +KI  A      + D A    L+VG L   VD + L   F +F    +  
Sbjct: 68  HNCVTLHGRPLKIRRARPDSAEAADTAPVARLYVGGLAATVDAQQLARVFGKFGALYRPP 127

Query: 163 VMWDMQTGGSRGYGFVSFGS 182
            +      G R Y  V F S
Sbjct: 128 TVHPAGEAGRR-YALVEFRS 146

>NDAI0G00180 Chr7 complement(23120..24514) [1395 bp, 464 aa] {ON}
           Anc_1.408 YCL011C
          Length = 464

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/192 (22%), Positives = 81/192 (42%), Gaps = 34/192 (17%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           ++VGNL      E L++YF   G +    I+  K +       VE+  S D   A++  +
Sbjct: 112 IFVGNLTYDCTPEDLREYFSGIGEVVRADIITSKGHHRG-MGTVEFTNSKDVEDAIRQYD 170

Query: 106 G-----KQI-----------------ENNVVKINWAFQSQQVS----------PDEATFN 133
           G     +QI                  +  +  +  +Q +  S          P+   + 
Sbjct: 171 GSYFLDRQIFVRQDNPPPDGGRSSRRSDESISSSRGYQDKSSSSYDRAPSTRQPNRQGYK 230

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           +F+ +L   ++ + L++ FKEF   L+  +  D + G SRG+G V    +   +KA+  +
Sbjct: 231 VFIANLPFSINWQALKDMFKEFGDVLRADIELDSR-GRSRGFGTVILREKSAMEKAIATL 289

Query: 194 QGHELNGRPLRI 205
            G E+ GR + +
Sbjct: 290 NGTEMEGRRIDV 301

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 43/96 (44%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           +++ NL  SIN + LK  F+  G +    I +D    +  +  V   +      A+ TLN
Sbjct: 231 VFIANLPFSINWQALKDMFKEFGDVLRADIELDSRGRSRGFGTVILREKSAMEKAIATLN 290

Query: 106 GKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNV 141
           G ++E   + +   + ++Q   D    N +  D+N 
Sbjct: 291 GTEMEGRRIDVKEGYSNRQDPSDYKYGNDYRNDINT 326

 Score = 37.0 bits (84), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 51/123 (41%), Gaps = 15/123 (12%)

Query: 8   EQNPTVESEVPASETISEEPSVVP--------ANAIKGGRETSDKVLYVGNLDTSINEEI 59
           EQNP     +P       +PS  P           + G  E  + ++Y  NL  S     
Sbjct: 349 EQNPVGARAIPT------QPSYAPPILKNSTFTENVTGSGER-NHLIYCNNLPASTARSD 401

Query: 60  LKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWA 119
           L   F+  G I+N ++  +      + A VEY    DA++ ++ LNG       ++I++ 
Sbjct: 402 LYDLFESIGRISNAELKYNDKGEPTSEAVVEYINLEDADVCIERLNGYNYGGCELQISYG 461

Query: 120 FQS 122
            +S
Sbjct: 462 KRS 464

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 35/75 (46%), Gaps = 5/75 (6%)

Query: 296 YIGNIPHFAIEADLIPLLQNFGFIIDFK-HYPEKGC----CFIKYDTHEQAAVCIVALAN 350
           Y  N+P     +DL  L ++ G I + +  Y +KG       ++Y   E A VCI  L  
Sbjct: 389 YCNNLPASTARSDLYDLFESIGRISNAELKYNDKGEPTSEAVVEYINLEDADVCIERLNG 448

Query: 351 FPFQGRNLRTGWGKE 365
           + + G  L+  +GK 
Sbjct: 449 YNYGGCELQISYGKR 463

>ZYRO0E04928g Chr5 complement(374326..375537,375710..375727) [1230
           bp, 409 aa] {ON} similar to uniprot|P38922 Saccharomyces
           cerevisiae YNL004W
          Length = 409

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 83/195 (42%), Gaps = 32/195 (16%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           ++VGNL      E LK YF   G +    I+  + +       VE+  + D + A++  +
Sbjct: 105 VFVGNLTYDCAPEDLKDYFSQIGNVVRADIITSRGHHRG-MGTVEFTNTEDVDEAIRRFD 163

Query: 106 G-----KQI---ENNVVKINWAFQSQQVSPDEATF----------------------NLF 135
           G     +QI   ++N    + + +  Q    E TF                       +F
Sbjct: 164 GAYFMDRQIFVRQDNPPPESNSHERVQERRKERTFAGASSGSNNGTNAGGNSNGPIYEVF 223

Query: 136 VGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQG 195
           V +L   ++ + L++ FKE    ++  V    + G SRG+G V +G+ EE Q A+    G
Sbjct: 224 VANLPYSINWQALKDMFKECGNVIRADVEL-ARNGYSRGFGTVIYGTPEEMQDAIARFHG 282

Query: 196 HELNGRPLRINWASK 210
           +EL GR L +    K
Sbjct: 283 YELEGRILEVREGRK 297

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 35/78 (44%), Gaps = 7/78 (8%)

Query: 296 YIGNIPHFAIEADLIPLLQNFGFI------IDFKHYPEKGCCFIKYDTHEQAAVCIVALA 349
           Y  N+P     +DL  L +  G +       D K  P  G   ++Y+  E A VCI  L 
Sbjct: 333 YCANLPFSTATSDLYDLFETIGKLNNAELRFDSKGAP-TGVAIVEYENVEDADVCIDRLN 391

Query: 350 NFPFQGRNLRTGWGKERT 367
           N+ + G +L   +GK  T
Sbjct: 392 NYNYGGCDLEISYGKRET 409

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 27/61 (44%)

Query: 45  VLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTL 104
           ++Y  NL  S     L   F+  G + N ++  D   +    A VEY    DA++ +  L
Sbjct: 331 LIYCANLPFSTATSDLYDLFETIGKLNNAELRFDSKGAPTGVAIVEYENVEDADVCIDRL 390

Query: 105 N 105
           N
Sbjct: 391 N 391

>ADL160W Chr4 (408685..410265) [1581 bp, 526 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL123W (HRP1)
          Length = 526

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 65/141 (46%), Gaps = 12/141 (8%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNAN-YAFVEYFQSHDANIALQT- 103
           +++G L+    E+ L++YF   G +  VKIM D     +  + F+ +  +   +  ++T 
Sbjct: 165 MFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLSFADASSVDEVVKTQ 224

Query: 104 --LNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQG 161
             L+GK I+          +S           +FV  +  DV  +     F ++ + +  
Sbjct: 225 HILDGKVIDPK--------ESDPTGRARKAGKIFVAGIGPDVRPKEFEEFFSQWGSIIDA 276

Query: 162 HVMWDMQTGGSRGYGFVSFGS 182
            +M D  TG SRG+GF+++ S
Sbjct: 277 QLMLDKDTGRSRGFGFITYDS 297

>KLTH0H12958g Chr8 (1107939..1109858) [1920 bp, 639 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae or to YHR015W
           uniprot|P38760 Saccharomyces cerevisiae
          Length = 639

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 44/73 (60%)

Query: 133 NLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDA 192
           +LF+GDL+  V ++ L +AF  F T     +  D +T  S GYG+++F S +EA +A++ 
Sbjct: 95  SLFIGDLDKGVTEKMLLHAFSGFKTLASVKICIDSETKKSLGYGYLNFTSAQEADEAIEK 154

Query: 193 MQGHELNGRPLRI 205
               +L G+ +RI
Sbjct: 155 FSYVKLFGKEVRI 167

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 76/159 (47%), Gaps = 5/159 (3%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNA-NYAFVEYFQSHDANIALQTL 104
           L++G+LD  + E++L   F     +A+VKI +D     +  Y ++ +  + +A+ A++  
Sbjct: 96  LFIGDLDKGVTEKMLLHAFSGFKTLASVKICIDSETKKSLGYGYLNFTSAQEADEAIEKF 155

Query: 105 NGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVM 164
           +  ++    V+I  + ++     +  T N+F  +L ++    T R  ++ F  Y  G V+
Sbjct: 156 SYVKLFGKEVRIMPSMRNSYFRKNIGT-NVFFTNLPLENPALTTRVFYESFRKY--GRVL 212

Query: 165 WDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPL 203
              +    +  GFV F S   A+KA+D     E  G  +
Sbjct: 213 -SCKLDRRKNIGFVYFESDISAKKAIDDFNSREYFGNKI 250

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 58/134 (43%), Gaps = 19/134 (14%)

Query: 12  TVESEVPA-SETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPI 70
           ++ESE    S ++ + P   P+ ++           +V NL   +  E L  YF   GPI
Sbjct: 282 SLESEACTDSNSLGDSPGPTPSTSV-----------HVKNLPIGVCNEDLLNYFSKVGPI 330

Query: 71  ANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN-----GKQIE-NNVVKINWAFQSQQ 124
            +V      +    ++ F+ Y +S D   AL+ LN     GK++E    VK N   +S  
Sbjct: 331 KSV-YTSKADVYTTSWGFITYKRSRDTIRALEELNGAIFMGKRVEVTRAVKYNGERKSTS 389

Query: 125 VSPDEATFNLFVGD 138
            + +   F   VG+
Sbjct: 390 TNNNGIEFTGCVGN 403

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 40/77 (51%), Gaps = 3/77 (3%)

Query: 44  KVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDK-NNSNANYAFVEYFQSH-DANIAL 101
           ++LY+ ++    NE+ L    +    I   +I +D+ +     +A     +S  D+N   
Sbjct: 420 QMLYLSDMSAVCNEKFLSHLCRTE-KIKFQRITIDRYDEEGLTFAGSVLCKSRSDSNRLF 478

Query: 102 QTLNGKQIENNVVKINW 118
           + LNGK I ++VVK++W
Sbjct: 479 EVLNGKLIGDSVVKVSW 495

>CAGL0J11154g Chr10 (1085737..1086879) [1143 bp, 380 aa] {ON}
           similar to uniprot|P53883 Saccharomyces cerevisiae
           YNL175c NOP13
          Length = 380

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 76/168 (45%), Gaps = 20/168 (11%)

Query: 52  DTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQ----TLNGK 107
           D  I EE L    +V  P+A       K   N  + +V++        A++     LNG+
Sbjct: 141 DVEITEEDL---VRVNMPLAKND---GKQIKNKGFCYVDFKTQEQVEAAIKLSESQLNGR 194

Query: 108 QIENNVVKINWAFQSQQVSPDEATFN-------LFVGDLNVDVDDETLRNAFKEFPTYLQ 160
              N ++K + +++ +    D  + +       LFVG+L+ D  DE LR  F+     ++
Sbjct: 195 ---NLLIKNSKSYEGRPDKTDLVSMSKNPPSRILFVGNLSFDTTDELLRKHFQHCGEIVK 251

Query: 161 GHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWA 208
             +     +G  +G+ FV F ++E A  A+      ++ GRPLR+ + 
Sbjct: 252 IRMATFQDSGKCKGFAFVDFKNEEGATNALKDKSCRKIAGRPLRMEFG 299

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 43/77 (55%), Gaps = 1/77 (1%)

Query: 44  KVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNAN-YAFVEYFQSHDANIALQ 102
           ++L+VGNL     +E+L+++FQ  G I  +++   +++     +AFV++     A  AL+
Sbjct: 223 RILFVGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFKNEEGATNALK 282

Query: 103 TLNGKQIENNVVKINWA 119
             + ++I    +++ + 
Sbjct: 283 DKSCRKIAGRPLRMEFG 299

>CAGL0H03861g Chr8 complement(361189..362520) [1332 bp, 443 aa] {ON}
           similar to uniprot|P38922 Saccharomyces cerevisiae
           YNL004w HRB1
          Length = 443

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 76/183 (41%), Gaps = 25/183 (13%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           ++VGNL      E LK +F   G +    I+  + +       VE+    + + A++  +
Sbjct: 109 IFVGNLTYDCTPEDLKDFFSQVGKVVRADIITSRGHHRG-MGTVEFTSGEEVDEAIRKFD 167

Query: 106 GKQIENNVVKI-----------------------NWAFQSQQVSPDEATFNLFVGDLNVD 142
           G  + N  + +                       N     + V P +  + L + +L   
Sbjct: 168 GAYLMNRQIFVRQDNPPPESSSTHSSGSNSGHTTNVTKPKKAVKPQKKGYELMILNLPYS 227

Query: 143 VDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRP 202
           +  +TL+  FKEF   L+ +V  D  TG S G G V F +QE+  KA +   G E+ G+ 
Sbjct: 228 ISWQTLKTMFKEFGDVLKANVEVD-STGMSIGVGNVIFKNQEDMVKAYEHFNGFEIEGKV 286

Query: 203 LRI 205
           L +
Sbjct: 287 LEV 289

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 35/73 (47%), Gaps = 2/73 (2%)

Query: 131 TFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAM 190
           T ++FVG+L  D   E L++ F +    ++  ++     G  RG G V F S EE  +A+
Sbjct: 106 TNSIFVGNLTYDCTPEDLKDFFSQVGKVVRADII--TSRGHHRGMGTVEFTSGEEVDEAI 163

Query: 191 DAMQGHELNGRPL 203
               G  L  R +
Sbjct: 164 RKFDGAYLMNRQI 176

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 43/100 (43%), Gaps = 1/100 (1%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           L + NL  SI+ + LK  F+  G +    + VD    +     V +    D   A +  N
Sbjct: 219 LMILNLPYSISWQTLKTMFKEFGDVLKANVEVDSTGMSIGVGNVIFKNQEDMVKAYEHFN 278

Query: 106 GKQIENNVVKINWAF-QSQQVSPDEATFNLFVGDLNVDVD 144
           G +IE  V+++        Q+S    T +L V   N D++
Sbjct: 279 GFEIEGKVLEVRGQIPDPTQISSTRKTDDLTVNQDNEDIE 318

>TPHA0A02220 Chr1 complement(457287..459428) [2142 bp, 713 aa] {ON}
           Anc_1.357 YHR015W
          Length = 713

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 46/84 (54%)

Query: 122 SQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFG 181
           S  +   +++  L++GDL  DV +  L + F  + +++   +  D +TG S GYG+++  
Sbjct: 142 SDSILVGKSSIALYIGDLGKDVTEGMLNSIFNSYNSFVSAKICIDSKTGESLGYGYLNLS 201

Query: 182 SQEEAQKAMDAMQGHELNGRPLRI 205
           ++EEA   ++      + GR +RI
Sbjct: 202 NREEAYSLLERYNYTNIFGREVRI 225

>Suva_14.166 Chr14 complement(303573..304784) [1212 bp, 403 aa] {ON}
           YNL175C (REAL)
          Length = 403

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/235 (22%), Positives = 103/235 (43%), Gaps = 40/235 (17%)

Query: 8   EQNPTVESEVPASETISEEPSVVPAN--AIKGGRETSDKVLYVGNLDTSINEEILKQYF- 64
           +++ TVE + P  E+ ++      ++  A K  +E S   +++GNL     ++ L ++F 
Sbjct: 87  KKSDTVEKDAPDGESKTDAAVETTSDDAATKKKKEESKYGVWIGNLSFDTTKDDLVRFFI 146

Query: 65  ---------------QVGGPIANVKIMVDKNNSNAN----YAFVEYFQSHDANIALQT-- 103
                          Q    ++  ++    +NS  N    Y F +  +   A + L    
Sbjct: 147 AKTRDNEDEKSRVIQQDITRLSMPRVASKNSNSMQNKGFCYMFFKNVEQMKAVLELSESH 206

Query: 104 LNGKQIENNVVKINWAFQSQQVSPDEATFN----------LFVGDLNVDVDDETLRNAFK 153
           LNG+   N ++K +  F  +   PD+  F           LFVG+L+ DV D+ LR  F+
Sbjct: 207 LNGR---NMLIKDSENFSGR---PDKEDFVAMSKNPPSRILFVGNLSFDVTDDLLRKHFQ 260

Query: 154 EFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWA 208
                ++  +     +G  +G+ F+ F ++E +  A+      ++ GRPLR+ + 
Sbjct: 261 HCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALKDKSCRKIAGRPLRMEYG 315

>SAKL0F03982g Chr6 complement(319563..319895) [333 bp, 110 aa] {ON}
           similar to uniprot|P40567 Saccharomyces cerevisiae
           YIR009W MSL1 U2B component of U2 snRNP involved in
           splicing binds the U2 snRNA stem-loop IV in vitro does
           not contain the conserved C-terminal RNA binding domain
           found in other family members
          Length = 110

 Score = 47.8 bits (112), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 48/96 (50%), Gaps = 4/96 (4%)

Query: 115 KINWAFQSQQVSPDEATFN-LFVGDLNVDVDDETLR-NAFKEFPTYLQGHVMWDMQTGGS 172
           KI    +S +  P+ +  N L+V +LN  +   TLR N +  F TY  G V+    T   
Sbjct: 10  KIKLQGESHEGQPETSPKNTLYVNNLNDQIRPNTLRENLYLLFSTY--GEVIQVSMTSKE 67

Query: 173 RGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWA 208
           RG  FV   +  EA  AM ++Q     G+PLRI ++
Sbjct: 68  RGQAFVLLRTMNEANLAMISLQDEPFFGKPLRIRFS 103

>NDAI0G04190 Chr7 (1005539..1006618) [1080 bp, 359 aa] {ON}
           Anc_1.408 YCL011C
          Length = 359

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 75/174 (43%), Gaps = 13/174 (7%)

Query: 43  DKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQ 102
           D  ++VGNL      E L  YF   G +    I+  K   +     VE+  + DA  A++
Sbjct: 67  DNRVFVGNLSFDTTAEDLVDYFSQVGEVVTADIITFKGR-HKGLGTVEFTNADDATEAIE 125

Query: 103 TLNGKQIENNVVKIN-------WAFQSQQVSP----DEATFNLFVGDLNVDVDDETLRNA 151
             +        + +           ++ +++P    +   +  FV +L   +  + L++ 
Sbjct: 126 RCDNTHFMGRDIYVKDDQPPPGARQKTMRIAPIRDINRQGYEAFVINLPYSITWQNLKDL 185

Query: 152 FKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRI 205
           F+E    L+  +  D   G SRG G V + +++   +A+D   G+EL GR L +
Sbjct: 186 FRECGDILRADIELDYN-GFSRGLGSVLYATEDAMHRAIDTFNGYELEGRVLEV 238

>NCAS0E03880 Chr5 complement(761175..763328) [2154 bp, 717 aa] {ON}
           Anc_5.76 YGR250C
          Length = 717

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/202 (21%), Positives = 87/202 (43%), Gaps = 39/202 (19%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDK----------NNSNANYAFVEYFQSH 95
           +++G ++  I+E  ++  F+  G I ++K+  D+          +++   Y F+ +    
Sbjct: 183 IFIGGINHKIDESKIRALFEKFGSILSIKLFHDRLMNSNTNNSTSSNPIGYGFISFVLGS 242

Query: 96  DANIALQTLNGKQIENNVVKINWAFQSQQV-----------SPDEATFNLFVG------- 137
            A+  +   NGK IE   + +N+  + ++            + DE    +F+G       
Sbjct: 243 QASECINEFNGKIIEGTKLFLNYHVERKERERIQWSHIKENNDDEKFKCIFIGNLPTTLT 302

Query: 138 DLNVDVDDETLRNAFKE-----------FPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEA 186
           DL +D+  + ++    E           FP     +   + ++   +GYGFV+ GS E+A
Sbjct: 303 DLTIDLILDKIKTELSEVLPSLQILSYYFPQSKNVNNNINNKSSPLKGYGFVNLGSHEQA 362

Query: 187 QKAMDAMQGHELNGRPLRINWA 208
            K +  + G E  G  L +N A
Sbjct: 363 LKVIQTLDGLEWKGNRLVVNKA 384

 Score = 37.7 bits (86), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 40/84 (47%), Gaps = 9/84 (10%)

Query: 133 NLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSR---------GYGFVSFGSQ 183
           N+F+G +N  +D+  +R  F++F + L   +  D     +          GYGF+SF   
Sbjct: 182 NIFIGGINHKIDESKIRALFEKFGSILSIKLFHDRLMNSNTNNSTSSNPIGYGFISFVLG 241

Query: 184 EEAQKAMDAMQGHELNGRPLRINW 207
            +A + ++   G  + G  L +N+
Sbjct: 242 SQASECINEFNGKIIEGTKLFLNY 265

>Suva_8.370 Chr8 (653473..654114) [642 bp, 213 aa] {ON} YOR319W
           (REAL)
          Length = 213

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 81/182 (44%), Gaps = 16/182 (8%)

Query: 42  SDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKN-NSNANYAFVEYFQSHDANIA 100
           S   +YVGN+D  I +E L + F    PI  +K   DK   +   YAF+E+    DA   
Sbjct: 7   SGSTVYVGNIDPRITKEQLYELFIQINPILRIKYPKDKVLQTYQGYAFIEFHSKEDAQYV 66

Query: 101 LQTLNGK-QIENNVVKINWAFQSQQVSPDEATFN-----------LFVGDLNVDVDDETL 148
           +Q +N   ++ + ++K+     S  V    A+ N           LFV +L   VD E L
Sbjct: 67  IQIMNNTVKLYDRLIKVRQVTNS--VGAANASSNNSKGISLPIAKLFVKNLADSVDIEQL 124

Query: 149 RNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWA 208
              F +F   +    ++ + TG  +   +V F   E+A  A+ ++    +    + +++A
Sbjct: 125 EKIFNKFGKTVNKPEIFHLSTGKLKC-AYVYFEDFEKADMAIKSLNNQLVANNRITVDYA 183

Query: 209 SK 210
            K
Sbjct: 184 FK 185

>KLLA0A08338g Chr1 (736461..738761) [2301 bp, 766 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae or to YHR015W
           uniprot|P38760 Saccharomyces cerevisiae
          Length = 766

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 42/72 (58%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           LF+GDL  +V ++ L N F +F ++    +  D  T  S GYG+++FG  ++A+ A+D  
Sbjct: 140 LFIGDLPGNVTEDMLHNIFNKFKSFNSVKICVDSNTKKSLGYGYLNFGDPKDAENAVDEY 199

Query: 194 QGHELNGRPLRI 205
               + GR +R+
Sbjct: 200 NYMPIFGREIRM 211

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 77/172 (44%), Gaps = 8/172 (4%)

Query: 28  SVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNA-NY 86
           S    N +K  ++T+   L++G+L  ++ E++L   F       +VKI VD N   +  Y
Sbjct: 125 STQQTNTMKSEKQTA---LFIGDLPGNVTEDMLHNIFNKFKSFNSVKICVDSNTKKSLGY 181

Query: 87  AFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDE 146
            ++ +    DA  A+   N   I    +++  + ++     +  T N+F  +L +D    
Sbjct: 182 GYLNFGDPKDAENAVDEYNYMPIFGREIRMMPSLRNTYFRKNIGT-NVFFSNLPLDNTKL 240

Query: 147 TLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHEL 198
           T R  + EF  +  G ++   +    +  GF+ F +   A++A+    G E 
Sbjct: 241 TTRVFYDEFKKF--GKIL-SCKLDRRKNIGFIYFENDAAAKEAIKQYNGKEF 289

 Score = 37.7 bits (86), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 78/178 (43%), Gaps = 25/178 (14%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           ++V NL  + + + L  +F   GP+ +V    D +  ++++AF+ Y +  D   A++ LN
Sbjct: 388 IFVKNLPINPSHDNLLNFFSKIGPVKSV-YTSDVSKFDSSWAFITYKRIQDTKTAIEKLN 446

Query: 106 G-----KQIENNVVKINWAFQSQ---QVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPT 157
           G     + IE    + +   +SQ      P+     +F+ +L+V  ++        EF  
Sbjct: 447 GCKYMKRTIEVKKTERHHLEESQFENNTRPNNYKKTVFLTNLSVICNE--------EFLN 498

Query: 158 YLQGHVMWDMQTGGSRGY--------GFVSFGSQEEAQKAMDAMQGHELNGRPLRINW 207
           +L G      +    R Y        G+V   S+ +AQ+  + M+   L    ++ +W
Sbjct: 499 FLCGQERIKTERVVVRYYEEKTDTYSGYVRCASRNDAQRLFELMENKLLGDSEVKASW 556

>TBLA0B08010 Chr2 (1910016..1912835) [2820 bp, 939 aa] {ON} Anc_5.76
           YGR250C
          Length = 939

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 40/75 (53%)

Query: 133 NLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDA 192
           NL++  +  D+  + L+  F  F   L   ++ D+ TG S GYGF+SF    EA   ++ 
Sbjct: 230 NLYIRGIPKDLTIDDLKPIFDTFGKVLSLKIICDLITGESLGYGFISFKLGSEASNCINK 289

Query: 193 MQGHELNGRPLRINW 207
           + G  +NG  L IN+
Sbjct: 290 LNGTAMNGSTLFINY 304

>KNAG0I01590 Chr9 complement(308547..310319) [1773 bp, 590 aa] {ON}
           Anc_1.357 YHR015W
          Length = 590

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 40/72 (55%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           L++G L   ++ +TL   FK+F +     V +D  TG S GYG+++F SQ+E  K +D  
Sbjct: 88  LYIGGLGKSINSKTLIETFKDFLSLQSAKVCYDSLTGDSLGYGYLNFTSQKELDKFVDKY 147

Query: 194 QGHELNGRPLRI 205
               + G  +++
Sbjct: 148 NYKRMLGGEIKL 159

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 2/75 (2%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           +FV +L VDV  + L + F +F       V     T  +  + F+++  Q++AQK +D  
Sbjct: 295 VFVKNLPVDVTTDELLDYFSQFGPV--KSVYTSRTTQHTSEWAFITYKWQKDAQKLLDDF 352

Query: 194 QGHELNGRPLRINWA 208
              E  GR + +  A
Sbjct: 353 PTVEFRGRTVTVARA 367

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 30/159 (18%), Positives = 67/159 (42%), Gaps = 5/159 (3%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNA-NYAFVEYFQSHDANIALQTL 104
           LY+G L  SIN + L + F+    + + K+  D    ++  Y ++ +    + +  +   
Sbjct: 88  LYIGGLGKSINSKTLIETFKDFLSLQSAKVCYDSLTGDSLGYGYLNFTSQKELDKFVDKY 147

Query: 105 NGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVM 164
           N K++    +K+  + ++     +  T N+F  +L +     + R  +  F  Y  G ++
Sbjct: 148 NYKRMLGGEIKLMPSLRNSVYRKNIGT-NVFFSNLPLHNSGLSTRRFYDIFKKY--GKIL 204

Query: 165 WDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPL 203
              +    +  GFV F   + A K ++     +  G  +
Sbjct: 205 -SCKLDARKNIGFVYFEDDKAATKVINDFNNTDFYGNKI 242

>CAGL0I08943g Chr9 (867666..869474) [1809 bp, 602 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae YFR023w PES4
           DNA-directed DNA polymerase epsilon suppressor
          Length = 602

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 44/72 (61%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           LFVG+L  ++  E L   FK + +++   V  +     S G+G+++FG++E+A++A +  
Sbjct: 66  LFVGNLAEEITSERLTEMFKVYKSFISAKVCTNADDNRSLGHGYINFGNKEDAERATEDF 125

Query: 194 QGHELNGRPLRI 205
             +++ G+ +RI
Sbjct: 126 NYNKIMGKEIRI 137

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 67/156 (42%), Gaps = 5/156 (3%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVD-KNNSNANYAFVEYFQSHDANIALQTL 104
           L+VGNL   I  E L + F+V     + K+  +  +N +  + ++ +    DA  A +  
Sbjct: 66  LFVGNLAEEITSERLTEMFKVYKSFISAKVCTNADDNRSLGHGYINFGNKEDAERATEDF 125

Query: 105 NGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVM 164
           N  +I    ++I  + +      +  T N+F  +L +  +  T R  +  F  Y  G+V+
Sbjct: 126 NYNKIMGKEIRIMPSIRDSVYRKNFGT-NIFFSNLPLQKEKLTHRMFYDIFRKY--GNVL 182

Query: 165 WDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNG 200
             ++   S+  GFV F     A+  +      E  G
Sbjct: 183 -SVKLDSSKNIGFVYFEDDTIARDVIKEFNNKEFLG 217

>NDAI0F03320 Chr6 (798225..799424) [1200 bp, 399 aa] {ON} Anc_2.80
          Length = 399

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 40/75 (53%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           LFVG+L+ D  DE LR  F+     ++  +     +G  +G+ FV F ++E A  A+   
Sbjct: 240 LFVGNLSFDTTDELLRKHFQHCGEIIKIRMATFEDSGKCKGFAFVDFKNEEGATNALKDK 299

Query: 194 QGHELNGRPLRINWA 208
              ++ GRPLR+ + 
Sbjct: 300 TCRKIAGRPLRMEFG 314

 Score = 37.0 bits (84), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 44  KVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNAN-YAFVEYFQSHDANIALQ 102
           ++L+VGNL     +E+L+++FQ  G I  +++   +++     +AFV++     A  AL+
Sbjct: 238 RILFVGNLSFDTTDELLRKHFQHCGEIIKIRMATFEDSGKCKGFAFVDFKNEEGATNALK 297

Query: 103 TLNGKQI 109
               ++I
Sbjct: 298 DKTCRKI 304

>KLTH0B06886g Chr2 (557856..559046) [1191 bp, 396 aa] {ON} similar
           to uniprot|P53883 Saccharomyces cerevisiae YNL175C
          Length = 396

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 83/191 (43%), Gaps = 32/191 (16%)

Query: 46  LYVGNLDTSINEEILKQYF-------------------QVGGPIANVKIMVDKNNSNANY 86
           +++GNL    ++E L ++F                   +V  P+A       KN   A+ 
Sbjct: 125 VWIGNLTFDTSKEDLCRFFIAKTKELDPDSRVEESDILRVNLPLAQNDGKQVKNKGFAHM 184

Query: 87  AFVEYFQSHDANIALQT--LNGKQIENNVVKINWAFQSQ-------QVSPDEATFNLFVG 137
            F    Q  DA IAL    LNG+   N ++K + +F  +        +S +  +  LFVG
Sbjct: 185 NFRTQKQ-MDAVIALSESHLNGR---NMLIKNSASFDGRPDKNDLISMSKNPPSRILFVG 240

Query: 138 DLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHE 197
           +L+ D  DE L+  F+     ++  +     TG  +G+ FV F ++E    A+       
Sbjct: 241 NLSFDTTDELLKKHFQHCGEIVKIRMATFQDTGKCKGFAFVDFKNEEGPTNALKDKTCRR 300

Query: 198 LNGRPLRINWA 208
           + GRPLR+ + 
Sbjct: 301 IAGRPLRMEFG 311

>TPHA0D03960 Chr4 complement(829035..831653) [2619 bp, 872 aa] {ON}
           Anc_3.432 YPR112C
          Length = 872

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 100/221 (45%), Gaps = 28/221 (12%)

Query: 13  VESEVPASETISE-EPSVVPANAIKGG----RETSDKV-------LYVGNLDTSINEEIL 60
           VES  P  E + E +PS+     +K      ++++D V       +++ NL+ S   + L
Sbjct: 604 VESSTPKEEEVKEIKPSIGDMMEVKTSNNEEQDSTDNVVDGPTVSIFIKNLNFSTTSQQL 663

Query: 61  KQYFQV--GGPIANVKIMVDKNNS----NANYAFVEYFQSHDANIALQTLNGKQIENNVV 114
            Q F+   G  +A VK   D        +  + F E+     A  A+  ++G  I+ + +
Sbjct: 664 SQQFKNFNGFIVAQVKTKSDPKIEGKILSMGFGFAEFKTKEQALAAISAMDGSVIDGHKI 723

Query: 115 KINWAFQ-----SQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTY--LQGHVMWDM 167
           +I  + +        VS  + +  + V +L  +    T ++ F+ F ++  L+   +   
Sbjct: 724 QIKLSHRQGTASKSNVSQRKPSGKIIVKNLPFEA---TRKDVFELFSSFGQLKSVRVPKK 780

Query: 168 QTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWA 208
               +RG+ FV F   +EA+ AMD +QG  L GR L I +A
Sbjct: 781 FDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVIQYA 821

 Score = 37.0 bits (84), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 31/54 (57%)

Query: 66  VGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWA 119
           V   I +VKI+ DKN ++  +AF+ +    DA  A++  NG  I+   ++++ A
Sbjct: 37  VDSLITDVKILKDKNGTSRRFAFIGFLTEDDARDAIRYFNGSFIDTARIQVSEA 90

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 36/76 (47%)

Query: 130 ATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKA 189
           +T  LF+ ++     ++  R+ F+ F    + HV  D +TG S+G+ +V +     A +A
Sbjct: 330 STGRLFLRNILYTSTEKDFRDLFEPFGELEEVHVALDTRTGQSKGFAYVLYKDSANAVQA 389

Query: 190 MDAMQGHELNGRPLRI 205
              +      GR L I
Sbjct: 390 YINLDKQIFQGRLLHI 405

>Skud_8.67 Chr8 (116061..118019) [1959 bp, 652 aa] {ON} YHR015W
           (REAL)
          Length = 652

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 41/73 (56%)

Query: 133 NLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDA 192
           +LF+G L   V +E LR  FK++ ++    +  D  T  S GYG+++FG++++A+ A   
Sbjct: 112 SLFIGKLKSTVTEEMLRKTFKKYQSFESAKICRDFLTKKSLGYGYLNFGNKKDAEAAKKE 171

Query: 193 MQGHELNGRPLRI 205
                  G+ ++I
Sbjct: 172 FNYRIFFGQEVKI 184

 Score = 37.0 bits (84), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 76/181 (41%), Gaps = 5/181 (2%)

Query: 21  ETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVD-K 79
           E +SE+  V      K  + +    L++G L +++ EE+L++ F+      + KI  D  
Sbjct: 88  EGVSEKMCVKEGVEKKSTKNSRMSSLFIGKLKSTVTEEMLRKTFKKYQSFESAKICRDFL 147

Query: 80  NNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDL 139
              +  Y ++ +    DA  A +  N +      VKI  + ++     +  T N+F  +L
Sbjct: 148 TKKSLGYGYLNFGNKKDAEAAKKEFNYRIFFGQEVKIMPSMKNTLFRKNIGT-NVFFSNL 206

Query: 140 NVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELN 199
            +D    T R+ +     Y  G+V+  +     +  GFV F +   A+  +      E  
Sbjct: 207 PLDNPQLTTRSFYLIMIEY--GNVLSCL-LEKRKNIGFVYFDNDISARNVIKKYNNQEFF 263

Query: 200 G 200
           G
Sbjct: 264 G 264

>CAGL0B04807g Chr2 (460721..461980) [1260 bp, 419 aa] {ON} similar
           to uniprot|P25555 Saccharomyces cerevisiae YCL011c GBP2
           or uniprot|P38922 Saccharomyces cerevisiae YNL004w HRB1
          Length = 419

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 38/179 (21%), Positives = 75/179 (41%), Gaps = 18/179 (10%)

Query: 43  DKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQ 102
           D  +++GNL      E L  +F   G +    I+  +         VE+      + A++
Sbjct: 118 DNSIFIGNLSFDATPEDLHDFFGQAGEVLRADIITSRGRHRG-MGTVEFTSPEGVDNAIR 176

Query: 103 TLNGKQIEN----------------NVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDE 146
             NG +                   ++  +   F           F +F+ +L   +  +
Sbjct: 177 DFNGVEFMGRPLFVRQDNPPPEPMESLPPMRERFNDYPPEGRPPMFEVFIVNLPYSMTWQ 236

Query: 147 TLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRI 205
           TL++ F+E    ++  +  D + G SRG+G V +G+QEE   A++   G +++GR L++
Sbjct: 237 TLKDLFREAGDVIRADIELD-RNGFSRGFGTVFYGTQEEMFNAIERFNGFDVDGRILQV 294

 Score = 37.4 bits (85), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 42/93 (45%), Gaps = 2/93 (2%)

Query: 27  PSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANY 86
           PS    N + GG  ++  ++Y  NL  +     L   F+  G + + ++  D++ +    
Sbjct: 326 PSQFTENVVGGGERST--LIYCSNLPLTTATGDLYDLFETIGRVRHAELKFDESGAPTGI 383

Query: 87  AFVEYFQSHDANIALQTLNGKQIENNVVKINWA 119
           A +EY    DA+  +Q LN        + I++A
Sbjct: 384 AVIEYENVEDADFCIQRLNNYNYGGCDLDISYA 416

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 32/80 (40%), Gaps = 7/80 (8%)

Query: 291 RVTTAYIGNIPHFAIEADLIPLLQNFGFI------IDFKHYPEKGCCFIKYDTHEQAAVC 344
           R T  Y  N+P      DL  L +  G +       D    P  G   I+Y+  E A  C
Sbjct: 339 RSTLIYCSNLPLTTATGDLYDLFETIGRVRHAELKFDESGAP-TGIAVIEYENVEDADFC 397

Query: 345 IVALANFPFQGRNLRTGWGK 364
           I  L N+ + G +L   + K
Sbjct: 398 IQRLNNYNYGGCDLDISYAK 417

>KLTH0C04268g Chr3 (367879..369231) [1353 bp, 450 aa] {ON} similar
           to uniprot|P49960 Saccharomyces cerevisiae YMR268C PRP24
           Splicing factor that reanneals U4 and U6 snRNPs during
           spliceosome recycling
          Length = 450

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 90/194 (46%), Gaps = 29/194 (14%)

Query: 40  ETSDKVLYVGNLDTSINEEILKQYF-QVGGPIANVKIMVDKNNSNANYAFVEYFQSHDAN 98
           E S   L+  N   + ++  L Q F Q GG + +V++   + +S   +A+++     +A+
Sbjct: 113 ELSKSTLWATNFPPTYDQGKLMQLFGQFGGTVLSVRLPSLRFDSRRRFAYIDMASKQEAS 172

Query: 99  IALQTLNGKQIENNVVKINWAFQSQQVS-PDEATF---NLFVGDLNVDVDDETLRNAFKE 154
           +AL+ L+G +IEN  + +  +  S   +  D+A      + V +LN + ++  L   F +
Sbjct: 173 LALEKLDGVEIENYKMIVKLSQPSNAAARTDKAVIERRQVLVRNLNYNTNEAALSAIFAK 232

Query: 155 FPTYLQGHV------------MWDMQTGG------SRGYGFVSFGSQEEAQKAMDAMQGH 196
           F     GHV              ++ T G      + G+ F++F     A+ ++ ++ G 
Sbjct: 233 F-----GHVEQINLPRTRENKHGEIDTKGETKERLNEGFAFITFSDASCARSSL-SLNGT 286

Query: 197 ELNGRPLRINWASK 210
           E++ R L +  A +
Sbjct: 287 EIDNRILDVTLADR 300

>ZYRO0G07216g Chr7 (568877..569692) [816 bp, 271 aa] {ON} similar to
           uniprot|P25299 Saccharomyces cerevisiae YGL044C RNA15
           Cleavage and polyadenylation factor I (CF I) component
           involved in cleavage and polyadenylation of mRNA 3' ends
           interacts with the A-rich polyadenylation signal in
           complex with Rna14p and Hrp1p
          Length = 271

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 46/88 (52%), Gaps = 1/88 (1%)

Query: 33  NAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVD-KNNSNANYAFVEY 91
           N   GG+    +V+Y+G++     EE +       GP+ N+K+M D +   +  YAFVEY
Sbjct: 2   NRTSGGQHLPSRVVYLGSIPYDQTEEQILDLCSNVGPVNNLKMMFDPQTGKSKGYAFVEY 61

Query: 92  FQSHDANIALQTLNGKQIENNVVKINWA 119
                +  A++ LNG Q  + ++K  +A
Sbjct: 62  KDLESSASAVRNLNGYQFGSRLLKCGYA 89

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 8/81 (9%)

Query: 289 PPRVTTAYIGNIPHFAIEADLIPLLQNFG------FIIDFKHYPEKGCCFIKYDTHEQAA 342
           P RV   Y+G+IP+   E  ++ L  N G       + D +    KG  F++Y   E +A
Sbjct: 11  PSRV--VYLGSIPYDQTEEQILDLCSNVGPVNNLKMMFDPQTGKSKGYAFVEYKDLESSA 68

Query: 343 VCIVALANFPFQGRNLRTGWG 363
             +  L  + F  R L+ G+ 
Sbjct: 69  SAVRNLNGYQFGSRLLKCGYA 89

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%)

Query: 162 HVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWAS 209
            +M+D QTG S+GY FV +   E +  A+  + G++   R L+  +A+
Sbjct: 43  KMMFDPQTGKSKGYAFVEYKDLESSASAVRNLNGYQFGSRLLKCGYAT 90

>KAFR0H01450 Chr8 (267293..269365) [2073 bp, 690 aa] {ON} Anc_8.491
           YPL043W
          Length = 690

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           LFV  +  DV DE L   F  F       V+ D+    SRG+GFVSF ++E+ + A+   
Sbjct: 24  LFVRSIPFDVTDEELGGFFSNFAPTKHAVVVKDVNKK-SRGFGFVSFATEEDTKDALGKA 82

Query: 194 QGHELNGRPLRINWASK 210
           +  +LNG  LR++ A +
Sbjct: 83  RRSKLNGNVLRVDIAKR 99

>TBLA0A03300 Chr1 (785613..786701) [1089 bp, 362 aa] {ON} Anc_5.382
           YHR086W
          Length = 362

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 37/75 (49%)

Query: 290 PRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALA 349
           P  TT +IG +     E +L  L Q FG I+  K    KGC F++Y+T + A + I  + 
Sbjct: 252 PTNTTVFIGGLSSLVTENELRSLFQPFGEIVYVKIPFGKGCGFVQYETRKAAELAIHKMK 311

Query: 350 NFPFQGRNLRTGWGK 364
               +   +R  WGK
Sbjct: 312 GVSIKNSKIRLSWGK 326

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 42  SDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIAL 101
           ++  +++G L + + E  L+  FQ  G I  VKI   K        FV+Y     A +A+
Sbjct: 253 TNTTVFIGGLSSLVTENELRSLFQPFGEIVYVKIPFGKGC-----GFVQYETRKAAELAI 307

Query: 102 QTLNGKQIENNVVKINWA 119
             + G  I+N+ ++++W 
Sbjct: 308 HKMKGVSIKNSKIRLSWG 325

 Score = 36.6 bits (83), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 43/81 (53%), Gaps = 6/81 (7%)

Query: 128 DEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQ 187
           D     +F+G L+  V +  LR+ F+ F     G +++ ++    +G GFV + +++ A+
Sbjct: 251 DPTNTTVFIGGLSSLVTENELRSLFQPF-----GEIVY-VKIPFGKGCGFVQYETRKAAE 304

Query: 188 KAMDAMQGHELNGRPLRINWA 208
            A+  M+G  +    +R++W 
Sbjct: 305 LAIHKMKGVSIKNSKIRLSWG 325

>ADR017W Chr4 (734484..735005) [522 bp, 173 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIR005W (IST3)
          Length = 173

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 64/111 (57%), Gaps = 12/111 (10%)

Query: 100 ALQTLNGKQIENNVV--KINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEF-- 155
           ++Q L+  ++E+ ++  + +W +Q +    D+A  + F G LNV++ +  +   F +F  
Sbjct: 6   SIQKLSETELEHGILSEEASWHYQYK----DQAYIH-FSG-LNVELTEGDILTVFSQFGV 59

Query: 156 PTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRIN 206
           PT L+  ++ D +TG SRG+GF+ +  Q     A+D + G  L GR L+++
Sbjct: 60  PTDLK--LVRDRETGESRGFGFLKYEDQRSTVLAVDNLNGVNLCGRVLKVD 108

>KAFR0B03680 Chr2 (767040..768365) [1326 bp, 441 aa] {ON} Anc_8.822
           YMR268C
          Length = 441

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 76/176 (43%), Gaps = 32/176 (18%)

Query: 37  GGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHD 96
             RE S   + V NL  S N+  +K++FQ  G I  V ++ D     +  A VE F+SHD
Sbjct: 24  SNREVS--TVLVKNLPKSSNQNKVKKFFQDCGDIRYVDVL-DDLKKLSRLARVE-FESHD 79

Query: 97  ANIALQTLNGKQIENNVVKIN-------WA--FQSQQVSPDEATFNLFVGDLNVDVDDET 147
           A +   T   K++ NN ++++       WA  F       D       VG L + V    
Sbjct: 80  AALTALTKTSKKVGNNEIEVSLLENCTLWATNFPPTYTIKDIKALLKSVGLLAISV---- 135

Query: 148 LRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPL 203
                  FP+         ++   +R + ++   S E+ QKA+D ++G E  G  L
Sbjct: 136 ------RFPS---------LRYNANRRFAYIDVPSNEDLQKAVDLLEGKEFEGYNL 176

>Skud_15.487 Chr15 (852519..853160) [642 bp, 213 aa] {ON} YOR319W
           (REAL)
          Length = 213

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 80/183 (43%), Gaps = 18/183 (9%)

Query: 42  SDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKN-NSNANYAFVEYFQSHDANIA 100
           SD  +YVGN+D  I ++ L + F    P+  +K   DK   +   YAF+E++   DA   
Sbjct: 7   SDSTVYVGNIDPRITKDQLYELFIQINPVLRIKYPKDKVLQTYQGYAFIEFYNKEDAEYV 66

Query: 101 LQTLNG-----------KQIENNVVKINWAFQSQQVSPDEA--TFNLFVGDLNVDVDDET 147
           +Q +N            +Q+ N+V   N    S   S D A     LFV +L   +D + 
Sbjct: 67  IQIMNNTVKLYDRLIKVRQVTNSVGTANL---SSNNSKDIALPIAKLFVKNLADSIDIDQ 123

Query: 148 LRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINW 207
           L   F +F   +    ++ +  G  +    V F   E+A  A+ ++    +    + I++
Sbjct: 124 LAKIFGKFGKTISKPEIFHLSNGKLKC-ACVYFEDFEKADLAIKSLNNQLVANSRITIDY 182

Query: 208 ASK 210
           A K
Sbjct: 183 AFK 185

>Skud_14.159 Chr14 complement(298222..299424) [1203 bp, 400 aa] {ON}
           YNL175C (REAL)
          Length = 400

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 41/75 (54%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           LFVG+L+ DV D+ LR  F+     ++  +     +G  +G+ F+ F ++E +  A+   
Sbjct: 238 LFVGNLSFDVTDDLLRKHFQHCGDVVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALKDK 297

Query: 194 QGHELNGRPLRINWA 208
              ++ GRPLR+ + 
Sbjct: 298 SCRKIAGRPLRMEYG 312

>NDAI0G05970 Chr7 complement(1475760..1477595) [1836 bp, 611 aa]
           {ON} Anc_1.357 YFR023W
          Length = 611

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 40/72 (55%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           L++G L+ DV +ETL  AF+++ T     +  D  T  S GYG+++F +  EA K +D  
Sbjct: 103 LYIGGLSKDVTEETLFEAFEDYKTLASIKICRDSVTNESLGYGYLNFSNSVEATKLIDDY 162

Query: 194 QGHELNGRPLRI 205
               L G  ++I
Sbjct: 163 NYTNLFGNEIKI 174

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 67/146 (45%), Gaps = 5/146 (3%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDK-NNSNANYAFVEYFQSHDANIALQTL 104
           LY+G L   + EE L + F+    +A++KI  D   N +  Y ++ +  S +A   +   
Sbjct: 103 LYIGGLSKDVTEETLFEAFEDYKTLASIKICRDSVTNESLGYGYLNFSNSVEATKLIDDY 162

Query: 105 NGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVM 164
           N   +  N +KI  + ++     +  T N+F  +L ++    T R  +  F  Y  G ++
Sbjct: 163 NYTNLFGNEIKIMPSMRNTLYRKNIGT-NVFFSNLPLENKQLTTRKFYDTFKKY--GEIL 219

Query: 165 WDMQTGGSRGYGFVSFGSQEEAQKAM 190
              +    +  GFV F + + A +A+
Sbjct: 220 -SCKLDSRKNIGFVYFENDKAALQAI 244

 Score = 33.5 bits (75), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 28/162 (17%), Positives = 71/162 (43%), Gaps = 1/162 (0%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           +++ NL  + N++ +  +F   GP+ +V         N+ +AFV Y +S D  +A+Q L+
Sbjct: 313 VFIKNLPMTTNDDEILDFFSKIGPVKSV-FASQVLKYNSLWAFVTYKKSSDTELAIQKLD 371

Query: 106 GKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMW 165
               ++  + +  A   +          +++ +L+   ++  +     +    +Q   + 
Sbjct: 372 QTYFKDRAISVTKAKSKKTNFKIHDKKTVYLKNLSPICNERFIERICLQERIRVQKISVD 431

Query: 166 DMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINW 207
            +        GFV+  ++ +A K  + M    + G  ++++W
Sbjct: 432 PISPDILTNTGFVTCKTEVDANKLFNFMDKRLIGGCSVQVSW 473

>KLLA0D05016g Chr4 complement(431592..432911,433342..433353) [1332
           bp, 443 aa] {ON} similar to uniprot|P38922 Saccharomyces
           cerevisiae YNL004W
          Length = 443

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 74/176 (42%), Gaps = 19/176 (10%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           +++GNL  +   E LK+YF   G +    I+  + +       VE+  S D + A++  +
Sbjct: 143 IFIGNLTYNTTPEDLKEYFGKIGEVRRADIITSRGHHRG-MGTVEFNNSTDVDTAIRDCD 201

Query: 106 GKQIENNVVKIN----------------WAFQSQQVSPDEATFNLFVGDLNVDVDDETLR 149
           G  +    + +                       + + DE  F +FV  L   V+ + L+
Sbjct: 202 GAFLNGRAIFVRQDNPPPAEISRTGNNNGPPPPPKRAHDEG-FEVFVAQLPFSVNWQELK 260

Query: 150 NAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRI 205
           + FK     L   V+ D + G SRG+G V   ++E+   A+    G E  GR L +
Sbjct: 261 DMFKPCGDVLHADVVTD-RDGKSRGFGTVYMATKEQQNDAIRHWTGTEYKGRVLDV 315

>AGL250W Chr7 (232080..234269) [2190 bp, 729 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL043W (NOP4)
          Length = 729

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 1/77 (1%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           LFV ++  D  D  L + F +F       ++ D   G SRG+GFVSF  + + Q A+D  
Sbjct: 18  LFVRNIPFDATDAELTDFFSQFAPIKHAVIVKD-NAGSSRGFGFVSFAVESDTQAALDKG 76

Query: 194 QGHELNGRPLRINWASK 210
           +  +  GR LR++ A +
Sbjct: 77  RKTQFKGRLLRVDVAKR 93

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 37/192 (19%), Positives = 74/192 (38%), Gaps = 28/192 (14%)

Query: 44  KVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQT 103
           K L+V N+     +  L  +F    PI +  I+ D   S+  + FV +    D   AL  
Sbjct: 16  KTLFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDNAGSSRGFGFVSFAVESDTQAALDK 75

Query: 104 LNGKQIENNVVKINWAFQSQQVSP----------------------DEATF----NLFVG 137
               Q +  +++++ A + ++                         DEA       L + 
Sbjct: 76  GRKTQFKGRLLRVDVAKRRERSKKGDEAEAQTSAEDAEKPTTAPEGDEALMRGKPKLIIR 135

Query: 138 DLNVDVDDET-LRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGH 196
           ++     D T L+  F  F    +  +      G   G+ FV+       +KA++  +G 
Sbjct: 136 NMPWSCRDPTKLKKIFGRFGVVAEASIPRKAD-GKLCGFAFVTMKKLSNCRKAIEECKGL 194

Query: 197 ELNGRPLRINWA 208
           +++GR + +++A
Sbjct: 195 KIDGREVAVDFA 206

>YNL175C Chr14 complement(307401..308612) [1212 bp, 403 aa] {ON}
           NOP13Nucleolar protein found in preribosomal complexes;
           contains an RNA recognition motif (RRM)
          Length = 403

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 41/75 (54%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           LFVG+L+ DV D+ LR  F+     ++  +     +G  +G+ F+ F ++E +  A+   
Sbjct: 241 LFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALKDK 300

Query: 194 QGHELNGRPLRINWA 208
              ++ GRPLR+ + 
Sbjct: 301 SCRKIAGRPLRMEYG 315

 Score = 36.6 bits (83), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 15/77 (19%), Positives = 44/77 (57%), Gaps = 1/77 (1%)

Query: 44  KVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNAN-YAFVEYFQSHDANIALQ 102
           ++L+VGNL   + +++L+++FQ  G I  +++   +++     +AF+++     +  AL+
Sbjct: 239 RILFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALK 298

Query: 103 TLNGKQIENNVVKINWA 119
             + ++I    +++ + 
Sbjct: 299 DKSCRKIAGRPLRMEYG 315

>Kwal_27.11832 s27 complement(966449..968509) [2061 bp, 686 aa] {ON}
           YPL043W (NOP4) - RNA recognition motif-containing
           protein [contig 27] FULL
          Length = 686

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 40/77 (51%), Gaps = 1/77 (1%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           LFV  +  D  DE L N F          ++ D Q   SRG+GFVSF  +++ + A+D  
Sbjct: 23  LFVRSIPFDATDEELANYFSNLAPIKHAVIVKDDQKN-SRGFGFVSFAVEDDTKDALDKA 81

Query: 194 QGHELNGRPLRINWASK 210
           +  +  GR LR++ A +
Sbjct: 82  RKTKFKGRLLRVDIAKR 98

 Score = 33.9 bits (76), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 30/148 (20%), Positives = 61/148 (41%), Gaps = 11/148 (7%)

Query: 44  KVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQT 103
           K L+V ++     +E L  YF    PI +  I+ D   ++  + FV +    D   AL  
Sbjct: 21  KTLFVRSIPFDATDEELANYFSNLAPIKHAVIVKDDQKNSRGFGFVSFAVEDDTKDALDK 80

Query: 104 LNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNV----DVDDETLRNAFKEFPTYL 159
               + +  +++++ A +  +   D+   N   G  +     D +DE L       P  +
Sbjct: 81  ARKTKFKGRLLRVDIAKRRDRTKKDQ---NAAAGSEDTSGPQDKEDELLGGK----PKLI 133

Query: 160 QGHVMWDMQTGGSRGYGFVSFGSQEEAQ 187
             ++ W ++        F+ +G+  EA+
Sbjct: 134 VRNMPWSVRNPDELKKIFMRYGTVVEAK 161

>KAFR0A07490 Chr1 (1512089..1513234) [1146 bp, 381 aa] {ON} Anc_2.80
           YNL175C
          Length = 381

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 38/75 (50%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           LFVG+L+ D  DE L+  F+     ++  +     +G  +G+ FV F S+E A  A+   
Sbjct: 225 LFVGNLSFDTTDEVLKKHFQHCGEIIKIRMATFQDSGKCKGFAFVDFKSEEGATNALKDK 284

Query: 194 QGHELNGRPLRINWA 208
               +  RP+R+ + 
Sbjct: 285 TCRRIASRPIRMEYG 299

>KAFR0H03110 Chr8 complement(593465..594760,595029..595058) [1326
           bp, 441 aa] {ON} Anc_1.408 YNL004W intron location
           uncertain
          Length = 441

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 1/74 (1%)

Query: 132 FNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMD 191
           F +FV +L   V+ + L++ FK     L+  V  D   G SRG+G V F +QE+ ++A+D
Sbjct: 242 FEIFVANLPFSVNWQALKDMFKPCGNVLRADVELD-HVGRSRGFGTVLFSNQEDMRRAID 300

Query: 192 AMQGHELNGRPLRI 205
              G+E+ GR L +
Sbjct: 301 DYNGYEIEGRRLDV 314

 Score = 37.0 bits (84), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 7/76 (9%)

Query: 296 YIGNIPHFAIEADLIPLLQNFGFII------DFKHYPEKGCCFIKYDTHEQAAVCIVALA 349
           Y  N+P     +DL  L +  G +I      D  + P  G   I+Y+  E A VCI  L 
Sbjct: 366 YCSNLPFSTDRSDLYDLFETIGKVINAELRYDSANQP-TGVAVIEYENIEDADVCIERLN 424

Query: 350 NFPFQGRNLRTGWGKE 365
           N+ + G +L   + K+
Sbjct: 425 NYNYGGCDLVISYAKK 440

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 45/102 (44%), Gaps = 2/102 (1%)

Query: 6   NLEQNPTVESEVPASETISEEPSVVPANAIKG--GRETSDKVLYVGNLDTSINEEILKQY 63
           N  +N   E+   ++ET ++  S    +  +G    +  +  +Y  NL  S +   L   
Sbjct: 323 NGNRNGADETNKDSNETEAQAQSNSTVDFTEGYISGDERNNFIYCSNLPFSTDRSDLYDL 382

Query: 64  FQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           F+  G + N ++  D  N     A +EY    DA++ ++ LN
Sbjct: 383 FETIGKVINAELRYDSANQPTGVAVIEYENIEDADVCIERLN 424

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 17/79 (21%), Positives = 36/79 (45%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           ++V NL  S+N + LK  F+  G +    + +D    +  +  V +    D   A+   N
Sbjct: 244 IFVANLPFSVNWQALKDMFKPCGNVLRADVELDHVGRSRGFGTVLFSNQEDMRRAIDDYN 303

Query: 106 GKQIENNVVKINWAFQSQQ 124
           G +IE   + +   +++ +
Sbjct: 304 GYEIEGRRLDVREGYRNSR 322

>Smik_14.155 Chr14 complement(286559..287770) [1212 bp, 403 aa] {ON}
           YNL175C (REAL)
          Length = 403

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 41/75 (54%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           LFVG+L+ DV D+ LR  F+     ++  +     +G  +G+ F+ F ++E +  A+   
Sbjct: 241 LFVGNLSFDVTDDLLRKHFQHCGDIIKIRMATFEDSGKCKGFAFIDFKNEEGSTNALKDK 300

Query: 194 QGHELNGRPLRINWA 208
              ++ GRPLR+ + 
Sbjct: 301 GCRKIAGRPLRMEYG 315

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/77 (19%), Positives = 43/77 (55%), Gaps = 1/77 (1%)

Query: 44  KVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNAN-YAFVEYFQSHDANIALQ 102
           ++L+VGNL   + +++L+++FQ  G I  +++   +++     +AF+++     +  AL+
Sbjct: 239 RILFVGNLSFDVTDDLLRKHFQHCGDIIKIRMATFEDSGKCKGFAFIDFKNEEGSTNALK 298

Query: 103 TLNGKQIENNVVKINWA 119
               ++I    +++ + 
Sbjct: 299 DKGCRKIAGRPLRMEYG 315

>Suva_3.8 Chr3 complement(12157..13458) [1302 bp, 433 aa] {ON}
           YCL011C (REAL)
          Length = 433

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 75/175 (42%), Gaps = 22/175 (12%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           ++V NL      E LK+ F   G I    I+  K +       VE+  +     A+   +
Sbjct: 128 IFVRNLTFDCTPEDLKELFGTVGEILEADIITSKGHHRG-MGTVEFTNNEAVQDAISKFD 186

Query: 106 GKQIENNVVKINWAFQSQQVSPDEAT---------------FNLFVGDLNVDVDDETLRN 150
           G    +  + +      Q   P EA+               F +F+ +L   ++ ++L++
Sbjct: 187 GALFMDRKLMV-----RQDNPPPEASKEFSKKATREEVDNGFEVFIINLPYSINWQSLKD 241

Query: 151 AFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRI 205
            FKE    L+  V  D   G SRG+G V + +++E  +A+D   G E+ GR L +
Sbjct: 242 MFKECGHVLRADVELDF-NGFSRGFGSVIYPTKDEMMRAIDTFNGMEVEGRVLEV 295

>Kwal_33.14463 s33 complement(685488..686669) [1182 bp, 393 aa] {ON}
           YNL175C (NOP13) - nucleolar protein [contig 103] FULL
          Length = 393

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 38/75 (50%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           LFVG+L+ D  DE L+  F+     ++  +     TG  +G+ FV F  +E    A+   
Sbjct: 237 LFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKDEEGPTNALKDK 296

Query: 194 QGHELNGRPLRINWA 208
              ++ GRPLR+ + 
Sbjct: 297 TCRKIAGRPLRMEFG 311

>KLTH0H00792g Chr8 (88079..90586) [2508 bp, 835 aa] {ON} some
           similarities with uniprot|P53316 Saccharomyces
           cerevisiae YGR250C Hypothetical ORF
          Length = 835

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 41/75 (54%)

Query: 133 NLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDA 192
           NL+V  +  D+  + L   F +F   L   ++ D  TG S GYGF+S+    +A + +  
Sbjct: 250 NLYVRGIPKDLTIDDLVPVFAKFGPVLSMKIICDSNTGDSLGYGFLSYPLGSQASRCIKE 309

Query: 193 MQGHELNGRPLRINW 207
           + G+ +NG PL IN+
Sbjct: 310 LNGNLMNGSPLFINY 324

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 48/108 (44%), Gaps = 7/108 (6%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNA-NYAFVEYFQSHDANIALQTL 104
           LYV  +   +  + L   F   GP+ ++KI+ D N  ++  Y F+ Y     A+  ++ L
Sbjct: 251 LYVRGIPKDLTIDDLVPVFAKFGPVLSMKIICDSNTGDSLGYGFLSYPLGSQASRCIKEL 310

Query: 105 NGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAF 152
           NG  +  + + IN+  + ++         +    +  D DDE  +  F
Sbjct: 311 NGNLMNGSPLFINYHVERKERE------RIHWDHIKEDNDDERFKGVF 352

>YOR319W Chr15 (912822..913463) [642 bp, 213 aa] {ON}  HSH49U2-snRNP
           associated splicing factor with similarity to the
           mammalian splicing factor SAP49; proposed to function as
           a U2-snRNP assembly factor along with Hsh155p and
           binding partner Cus1p; contains two RNA recognition
           motifs (RRM)
          Length = 213

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 81/185 (43%), Gaps = 22/185 (11%)

Query: 42  SDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKN-NSNANYAFVEYFQSHDANIA 100
           S   +YVGN+D  I +E L + F    P+  +K   DK   +   YAF+E++   DA  A
Sbjct: 7   SGNTVYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYA 66

Query: 101 LQTLNGKQIENNVVKINWAFQSQQVSPDEATFN---------------LFVGDLNVDVDD 145
           ++ +N     N V   +   + +QV+    T N               LF+ +L   +D 
Sbjct: 67  IKIMN-----NTVRLYDRLIKVRQVTNSTGTTNLPSNISKDMILPIAKLFIKNLADSIDS 121

Query: 146 ETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRI 205
           + L   F +F   ++   ++ +  G  +   +V F   E+A  A+ ++    +    + +
Sbjct: 122 DQLVKIFNKFGKLIREPEIFYLSNGKLKC-AYVYFEDFEKADLAIKSLNNQLVANNRITV 180

Query: 206 NWASK 210
           ++A K
Sbjct: 181 DYAFK 185

>YHR015W Chr8 (134554..136533) [1980 bp, 659 aa] {ON}  MIP6Putative
           RNA-binding protein, interacts with Mex67p, which is a
           component of the nuclear pore involved in nuclear mRNA
           export
          Length = 659

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 41/81 (50%)

Query: 125 VSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQE 184
           ++    T +LF+G+L   V +E LR  FK + ++    V  D  T  S GYG+++F  + 
Sbjct: 104 ITKTSKTNSLFIGNLKSTVTEEMLRKIFKRYQSFESAKVCRDFLTKKSLGYGYLNFKDKN 163

Query: 185 EAQKAMDAMQGHELNGRPLRI 205
           +A+ A          G+ ++I
Sbjct: 164 DAESARKEFNYTVFFGQEVKI 184

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 39/192 (20%), Positives = 79/192 (41%), Gaps = 11/192 (5%)

Query: 19  ASETISEEPSVVPANAIKGG------RETSDKVLYVGNLDTSINEEILKQYFQVGGPIAN 72
           A++   E+  V      KG       + +    L++GNL +++ EE+L++ F+      +
Sbjct: 80  ATQEKKEQEQVFEKTVAKGSVQKYITKTSKTNSLFIGNLKSTVTEEMLRKIFKRYQSFES 139

Query: 73  VKIMVD-KNNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVSPDEAT 131
            K+  D     +  Y ++ +   +DA  A +  N        VKI  + ++     +  T
Sbjct: 140 AKVCRDFLTKKSLGYGYLNFKDKNDAESARKEFNYTVFFGQEVKIMPSMKNTLFRKNIGT 199

Query: 132 FNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMD 191
            N+F  +L ++    T R+ +     Y  G+V+  +     +  GFV F +   A+  + 
Sbjct: 200 -NVFFSNLPLENPQLTTRSFYLIMIEY--GNVLSCL-LERRKNIGFVYFDNDISARNVIK 255

Query: 192 AMQGHELNGRPL 203
                E  G  +
Sbjct: 256 KYNNQEFFGNKI 267

 Score = 30.8 bits (68), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 46/103 (44%), Gaps = 4/103 (3%)

Query: 12  TVESEVPASETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIA 71
           T   ++  S+ + E+  +   N     R    K + V NL +   +E +  YF   GPI 
Sbjct: 284 TKRKKMIGSDIVIEDELLASNNLSDNAR---SKTILVKNLPSDTTQEEVLDYFSTIGPIK 340

Query: 72  NVKIMVDKNNSNANYAFVEYFQSHDANIALQTLNGKQIENNVV 114
           +V  + +K  +  + AFV Y    ++  A + LN    +N+ +
Sbjct: 341 SV-FISEKQANTPHKAFVTYKNEEESKKAQKCLNKTIFKNHTI 382

>NDAI0F01720 Chr6 complement(418941..420365) [1425 bp, 474 aa] {ON} 
          Length = 474

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 55/116 (47%), Gaps = 12/116 (10%)

Query: 93  QSHDANIALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAF 152
           Q   A +AL T+    + +N          Q +  +     +FVG L+ DV ++ L   F
Sbjct: 275 QEQTAQLALSTVVTGNLRSN------GNIRQGLGSNSKNSTIFVGGLSTDVSEQELNELF 328

Query: 153 KEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWA 208
           + F     G +M D++    +  GFV+F  + +A+ A+  + G  + G P+R++W 
Sbjct: 329 RPF-----GEIM-DVKIPLGKKCGFVTFKRRIDAKAAIKGLHGFLVRGCPIRLSWG 378

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 59/130 (45%), Gaps = 22/130 (16%)

Query: 84  ANYAFVEYFQSHDANIALQTLNGKQIEN---------------NVVKINWAF--QSQQVS 126
           ANY  VE+    +A  AL TLNG  + N               +V ++NWA       +S
Sbjct: 99  ANYCLVEFESQQEAAEAL-TLNGLPLPNFFSRSRNSVINASQLSVFRLNWAVWPTVNGLS 157

Query: 127 PDEATFNLFVGDLNVDVDDETLRNAFK-EFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEE 185
           P+   + LFVG+L+    +  L   F+  + +     +M +   G S  +GF+ F + EE
Sbjct: 158 PE---YPLFVGNLSSITREADLLLLFRSRYKSVKTVRMMTEPIPGKSDSFGFICFANCEE 214

Query: 186 AQKAMDAMQG 195
            + A + M G
Sbjct: 215 RRLAAEEMNG 224

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 43/82 (52%), Gaps = 5/82 (6%)

Query: 38  GRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDA 97
           G  + +  ++VG L T ++E+ L + F+  G I +VKI + K        FV + +  DA
Sbjct: 302 GSNSKNSTIFVGGLSTDVSEQELNELFRPFGEIMDVKIPLGK-----KCGFVTFKRRIDA 356

Query: 98  NIALQTLNGKQIENNVVKINWA 119
             A++ L+G  +    ++++W 
Sbjct: 357 KAAIKGLHGFLVRGCPIRLSWG 378

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 33/72 (45%)

Query: 293 TTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 352
           +T ++G +     E +L  L + FG I+D K    K C F+ +     A   I  L  F 
Sbjct: 308 STIFVGGLSTDVSEQELNELFRPFGEIMDVKIPLGKKCGFVTFKRRIDAKAAIKGLHGFL 367

Query: 353 FQGRNLRTGWGK 364
            +G  +R  WGK
Sbjct: 368 VRGCPIRLSWGK 379

>SAKL0H23298g Chr8 complement(2021024..2021797) [774 bp, 257 aa]
           {ON} similar to uniprot|P25299 Saccharomyces cerevisiae
           YGL044C RNA15 Cleavage and polyadenylation factor I (CF
           I) component involved in cleavage and polyadenylation of
           mRNA 3' ends interacts with the A-rich polyadenylation
           signal in complex with Rna14p and Hrp1p
          Length = 257

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 65/154 (42%), Gaps = 16/154 (10%)

Query: 44  KVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVD-KNNSNANYAFVEYFQSHDANIALQ 102
           +V+Y+G++     EE +       GP+ N+K+M D +   +  YAFVEY     +N A++
Sbjct: 13  RVVYLGSIPYDQTEEQILDLCSNVGPVTNLKMMFDPQTGKSKGYAFVEYKDLEASNSAVR 72

Query: 103 TLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQG- 161
            LNG Q+ N  +K  + +     S D               D  T  N    FP+  QG 
Sbjct: 73  NLNGYQLGNRFLKCGY-YGGGSTSNDTG-------------DSNTTTNETLTFPSLPQGT 118

Query: 162 HVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQG 195
            V  +M T        +S   + E    +  +QG
Sbjct: 119 DVNINMTTPAMMISSLLSTKDKAEQYDLLRTLQG 152

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 37/74 (50%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           +++G +  D  +E + +            +M+D QTG S+GY FV +   E +  A+  +
Sbjct: 15  VYLGSIPYDQTEEQILDLCSNVGPVTNLKMMFDPQTGKSKGYAFVEYKDLEASNSAVRNL 74

Query: 194 QGHELNGRPLRINW 207
            G++L  R L+  +
Sbjct: 75  NGYQLGNRFLKCGY 88

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 289 PPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHY------PEKGCCFIKYDTHEQAA 342
           P RV   Y+G+IP+   E  ++ L  N G + + K          KG  F++Y   E + 
Sbjct: 11  PSRV--VYLGSIPYDQTEEQILDLCSNVGPVTNLKMMFDPQTGKSKGYAFVEYKDLEASN 68

Query: 343 VCIVALANFPFQGRNLRTGW 362
             +  L  +    R L+ G+
Sbjct: 69  SAVRNLNGYQLGNRFLKCGY 88

>TDEL0F00680 Chr6 complement(114474..115640) [1167 bp, 388 aa] {ON}
           Anc_2.80 YNL175C
          Length = 388

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 50/224 (22%), Positives = 98/224 (43%), Gaps = 33/224 (14%)

Query: 14  ESEVPASETISEEPSVVPANAIKGGRETSDKV--LYVGNLDTSINEEILKQYFQVGGP-- 69
           ESEV    T  E+P    A+  +   +  DK   +++GNL     +E L ++F       
Sbjct: 78  ESEVKEQAT-KEKPESSSADGEQPTADKKDKKYGVWIGNLSFDTTKEDLVRFFSAKTKES 136

Query: 70  ----------IANVKIMVDKNN----SNANYAFVEY--FQSHDANIALQT--LNGKQIEN 111
                     I  V + + +N+     N  + ++++   +  +A I+L    LNG+ +  
Sbjct: 137 EDGAQITEETIVRVNMPLAQNDGKKIRNKGFCYMDFETTEQMEAAISLSESHLNGRNL-- 194

Query: 112 NVVKINWAFQSQQVSPDEATFN-------LFVGDLNVDVDDETLRNAFKEFPTYLQGHVM 164
            ++K + +F  +    D  + +       LFVG+L+ D  DE L+  F+     ++  + 
Sbjct: 195 -LIKNSKSFDGRPDKNDLVSLSKNPPSRILFVGNLSFDTTDELLKKHFQHCGEIVKIRMA 253

Query: 165 WDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWA 208
               +G  +G+ FV F  +E A  A+      ++  RP+R+ + 
Sbjct: 254 TFQDSGKCKGFAFVDFKDEEGATNALKDKGCRKIAQRPIRMEYG 297

>Kpol_150.1 s150 (1938..2354) [417 bp, 138 aa] {ON} (1938..2354)
           [417 nt, 139 aa]
          Length = 138

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 56/109 (51%), Gaps = 8/109 (7%)

Query: 100 ALQTLNGKQIENNVVK--INWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPT 157
           A+Q +N  ++EN V+   ++W         D+A   +++G LN D+ +  +   F +F  
Sbjct: 6   AIQKINENELENGVLSPSLSW----HDTYKDQAY--IYIGRLNKDLTEGDILTVFSQFGV 59

Query: 158 YLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRIN 206
            +   ++ + +TG SRG+ ++ +  Q     A+D + G E+ G  + ++
Sbjct: 60  PVDIKLVRENETGSSRGFAYLKYEDQRSTILAVDNLNGAEIAGNAIVVD 108

>SAKL0E12738g Chr5 (1052695..1053885) [1191 bp, 396 aa] {ON} similar
           to uniprot|P53883 Saccharomyces cerevisiae YNL175C
          Length = 396

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/137 (21%), Positives = 66/137 (48%), Gaps = 14/137 (10%)

Query: 83  NANYAFVEYFQSHDAN----IALQTLNGKQIENNVVKINWAFQSQ-------QVSPDEAT 131
           N  +A++++      N    ++   LNG+   N ++K + +++ +        +S +  +
Sbjct: 172 NKGFAYMDFKNKEQMNAVIGLSESQLNGR---NMLIKNSSSYEGRPDKNDLIAMSKNPPS 228

Query: 132 FNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMD 191
             LFVG+L+ D  DE LR  F+     ++  +     +G  +G+ F+ F  ++   +A+ 
Sbjct: 229 RILFVGNLSFDTTDELLRKHFQHCGEIVKVRMATFQDSGKCKGFAFIDFKDEKGPTEALT 288

Query: 192 AMQGHELNGRPLRINWA 208
                ++ GRPLR+ + 
Sbjct: 289 DKSCRKIAGRPLRMEFG 305

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/77 (22%), Positives = 41/77 (53%), Gaps = 1/77 (1%)

Query: 44  KVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNAN-YAFVEYFQSHDANIALQ 102
           ++L+VGNL     +E+L+++FQ  G I  V++   +++     +AF+++        AL 
Sbjct: 229 RILFVGNLSFDTTDELLRKHFQHCGEIVKVRMATFQDSGKCKGFAFIDFKDEKGPTEALT 288

Query: 103 TLNGKQIENNVVKINWA 119
             + ++I    +++ + 
Sbjct: 289 DKSCRKIAGRPLRMEFG 305

>KAFR0C05430 Chr3 complement(1088709..1089533) [825 bp, 274 aa] {ON}
           Anc_5.536 YDR429C
          Length = 274

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 45/91 (49%), Gaps = 3/91 (3%)

Query: 119 AFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFK-EFPTYLQGHVMWDMQTGGSRGYGF 177
           A++  +   D  T  +    LN + D+ TLR      F    +  V+ + +TG SRG  F
Sbjct: 182 AYRDSKERDDMCTLKIM--QLNENADENTLREELLFPFAPIPKAVVVRNRETGRSRGLAF 239

Query: 178 VSFGSQEEAQKAMDAMQGHELNGRPLRINWA 208
           V+F S+E A+KA+  + G       LR+ W+
Sbjct: 240 VTFSSEEMAEKALHFLDGRGFMNLILRVEWS 270

>KNAG0A02210 Chr1 (195984..198032) [2049 bp, 682 aa] {ON} Anc_8.491
           YPL043W
          Length = 682

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 43/77 (55%), Gaps = 1/77 (1%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           LFV  +   V DE L   F  F       V+ D+    SRG+GFVSF S+E+ ++A+   
Sbjct: 19  LFVRAIPFAVTDEQLTEFFANFAPTKHAVVVKDVNKK-SRGFGFVSFASEEDTKEALLKA 77

Query: 194 QGHELNGRPLRINWASK 210
           +  +LNG+ LR++ A +
Sbjct: 78  RKEKLNGQLLRVDIAKR 94

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 34/192 (17%), Positives = 77/192 (40%), Gaps = 29/192 (15%)

Query: 45  VLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTL 104
            L+V  +  ++ +E L ++F    P  +  ++ D N  +  + FV +    D   AL   
Sbjct: 18  TLFVRAIPFAVTDEQLTEFFANFAPTKHAVVVKDVNKKSRGFGFVSFASEEDTKEALLKA 77

Query: 105 NGKQIENNVVKINWAFQSQQVSPDEATFN--------------------LFVGDLNVDV- 143
             +++   +++++ A + ++    E   N                     F G   + + 
Sbjct: 78  RKEKLNGQLLRVDIAKRRERNKRKEDASNGIAAPKPEHKEKRTYGDEDDQFKGKPKLIIR 137

Query: 144 -------DDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGH 196
                  D  TL+N F  F T +  H+    + G   G+ FV+       + A++  +  
Sbjct: 138 NMPWSCRDPNTLKNIFGRFGTVVDAHIPR-KRDGKLCGFAFVTMNKISNCKNALENTKDL 196

Query: 197 ELNGRPLRINWA 208
           +++GR + +++A
Sbjct: 197 KIDGRQVAVDFA 208

>NCAS0C02380 Chr3 (444347..446455) [2109 bp, 702 aa] {ON} Anc_8.491
           YPL043W
          Length = 702

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 49/94 (52%), Gaps = 3/94 (3%)

Query: 117 NWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYG 176
           N A++      D  T  LFV  + +DV DE L + F  F       V+ D+    SRG+G
Sbjct: 13  NAAYKQNDNGLDMKT--LFVRSIPMDVTDEELADYFSNFAPTKHAVVVKDVNKK-SRGFG 69

Query: 177 FVSFGSQEEAQKAMDAMQGHELNGRPLRINWASK 210
           FVSF  +++ ++A+   +  +L G  LR++ A +
Sbjct: 70  FVSFAVEDDTKEALKQARKAKLKGHLLRVDIAKR 103

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 35/195 (17%), Positives = 82/195 (42%), Gaps = 31/195 (15%)

Query: 44  KVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQT 103
           K L+V ++   + +E L  YF    P  +  ++ D N  +  + FV +    D   AL+ 
Sbjct: 26  KTLFVRSIPMDVTDEELADYFSNFAPTKHAVVVKDVNKKSRGFGFVSFAVEDDTKEALKQ 85

Query: 104 LNGKQIENNVVKINWAFQSQQVS-------PDEAT-FNLFVGDLNVDVDDET-------- 147
               +++ ++++++ A +  + +       P++ T  +    D N +VD+E+        
Sbjct: 86  ARKAKLKGHLLRVDIAKRRDRSNKPGEGDKPEKKTRTDTIARDENEEVDEESLLKGKPKL 145

Query: 148 --------------LRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
                         L+  F  F T ++  +    + G   G+ FV+         A++  
Sbjct: 146 IIRNMPWSCRDPNQLKKIFSRFGTVVEASI-PKKRDGKLCGFAFVTMKKLSNCTIALENT 204

Query: 194 QGHELNGRPLRINWA 208
           +  +++GR + +++A
Sbjct: 205 KDLKIDGRSVAVDFA 219

>NCAS0G01950 Chr7 complement(348633..349847) [1215 bp, 404 aa] {ON}
           Anc_2.80
          Length = 404

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 39/75 (52%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           LFVG+L+ D  DE L+  F+     ++  +     +G  +G+ F+ F S+E A  A+   
Sbjct: 240 LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFIDFRSEEGATNALKDK 299

Query: 194 QGHELNGRPLRINWA 208
              ++  RP+R+ + 
Sbjct: 300 TCRKIAARPIRMEYG 314

>AEL217W Chr5 (225217..227721) [2505 bp, 834 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR250C
          Length = 834

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 41/75 (54%)

Query: 133 NLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDA 192
           NL++  +  D+  + L   F +F T L   ++ D  T  S GYGF+S+    +A + +  
Sbjct: 218 NLYIRGIPKDLSVDDLIPIFSKFGTVLSLKIIIDGNTRESLGYGFISYPLGSQAARCIKE 277

Query: 193 MQGHELNGRPLRINW 207
           + G+ +NG PL IN+
Sbjct: 278 LNGNLMNGSPLFINY 292

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/256 (21%), Positives = 98/256 (38%), Gaps = 66/256 (25%)

Query: 4   QENLEQNPTVESEVPASETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQY 63
           +ENLE++  VE+      +IS+ P  +          T    LY+  +   ++ + L   
Sbjct: 192 KENLEKSDHVEAW-----SISQNPHAL----------THPGNLYIRGIPKDLSVDDLIPI 236

Query: 64  FQVGGPIANVKIMVDKNNSNA-NYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQS 122
           F   G + ++KI++D N   +  Y F+ Y     A   ++ LNG  +  + + IN+  + 
Sbjct: 237 FSKFGTVLSLKIIIDGNTRESLGYGFISYPLGSQAARCIKELNGNLMNGSPLFINYHVER 296

Query: 123 QQV-----------SPDEATFNLFVGDLNVDVDDETL---RNAFKEFPTYL--------- 159
           ++            + DE    +FVG+L  + +D TL      F +F   L         
Sbjct: 297 KERERIHLDHLKEDNDDERFRGVFVGNLPTEYEDGTLITPEQVFNKFNHILDPVDILSYY 356

Query: 160 -------------------------QGHVMWDMQTGGS--RGYGFVSFGSQEEAQKAMDA 192
                                    +     D Q   S  +GYGF+ F + + A KA+D 
Sbjct: 357 FPKRNSNTNIEYKDDDSTSPTSSSKENAETCDSQNEDSPLKGYGFIKFSTHDMALKAIDK 416

Query: 193 MQGHELNGRPLRINWA 208
           +      G  L +N A
Sbjct: 417 LNSFTWLGHSLVVNKA 432

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 29/77 (37%), Gaps = 6/77 (7%)

Query: 296 YIGNIPHFAIEADLIPLLQNFG------FIIDFKHYPEKGCCFIKYDTHEQAAVCIVALA 349
           YI  IP      DLIP+   FG       IID       G  FI Y    QAA CI  L 
Sbjct: 220 YIRGIPKDLSVDDLIPIFSKFGTVLSLKIIIDGNTRESLGYGFISYPLGSQAARCIKELN 279

Query: 350 NFPFQGRNLRTGWGKER 366
                G  L   +  ER
Sbjct: 280 GNLMNGSPLFINYHVER 296

 Score = 33.9 bits (76), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 15/80 (18%)

Query: 128 DEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHV---------------MWDMQTGGS 172
           D+   NL+V  + +   DE L + + ++   +   +               + D+  G S
Sbjct: 595 DQQESNLYVKHIPLSWRDEDLNDFYSQYGEIISAKIITVGGSKNEIGESKALEDVPVGTS 654

Query: 173 RGYGFVSFGSQEEAQKAMDA 192
           RGYGFV F +  +A +AM A
Sbjct: 655 RGYGFVCFKNPLDASRAMMA 674

>Ecym_1121 Chr1 (248858..249832) [975 bp, 324 aa] {ON} similar to
           Ashbya gossypii AFR649W
          Length = 324

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 39/75 (52%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           LF+  LN     E +   F+ F   L   ++ D +TG S GYGF+ F ++E  ++A   M
Sbjct: 243 LFICKLNPLTKAEHIATIFERFGDVLSVEIVRDKKTGNSLGYGFIEFETKEACEQAYSKM 302

Query: 194 QGHELNGRPLRINWA 208
               ++ R + ++++
Sbjct: 303 DNTLIDDRRIHVDFS 317

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/101 (20%), Positives = 50/101 (49%), Gaps = 2/101 (1%)

Query: 21  ETISEEPSV-VPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDK 79
           E I +E ++ +  +  K G + ++ VL++  L+     E +   F+  G + +V+I+ DK
Sbjct: 217 EIIRKELTLEIIGDIYKAGIKPAENVLFICKLNPLTKAEHIATIFERFGDVLSVEIVRDK 276

Query: 80  NNSNA-NYAFVEYFQSHDANIALQTLNGKQIENNVVKINWA 119
              N+  Y F+E+        A   ++   I++  + ++++
Sbjct: 277 KTGNSLGYGFIEFETKEACEQAYSKMDNTLIDDRRIHVDFS 317

>Smik_15.500 Chr15 (862344..862985) [642 bp, 213 aa] {ON} YOR319W
           (REAL)
          Length = 213

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 82/186 (44%), Gaps = 24/186 (12%)

Query: 42  SDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKN-NSNANYAFVEYFQSHDANIA 100
           S   +YVGNLD  I +E L + F    P+  +K   DK   ++  YAF+E++   DA   
Sbjct: 7   SGNTVYVGNLDPRITKEQLYELFIQINPVLRIKYPKDKVLQTHQGYAFIEFYNREDAQYV 66

Query: 101 LQTLNGKQIENNVVKI-NWAFQSQQVSPDEATFN---------------LFVGDLNVDVD 144
           +      QI +N VK+ +   + +QV+    T N               LF+ +L   ++
Sbjct: 67  I------QIMHNTVKLYDRLIKVRQVTSSIGTSNLASNSSRDITLPVAKLFIKNLADSIN 120

Query: 145 DETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLR 204
            + L   F +F   +    ++ +  G  +   +V F   E+A  A+ ++    +    + 
Sbjct: 121 CDQLTKIFNKFGRTISEPKIFHLSNGKLKC-AYVYFEDFEKADLAIKSLDNQLVANSRIN 179

Query: 205 INWASK 210
           +++A K
Sbjct: 180 VDYAFK 185

>NDAI0E03070 Chr5 (651544..653649) [2106 bp, 701 aa] {ON} Anc_8.491
           YPL043W
          Length = 701

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 43/77 (55%), Gaps = 1/77 (1%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           LFV  + +DV DE L + F  F       V+ D+    SRG+GFVSF  +++ ++A+   
Sbjct: 28  LFVRSIPMDVTDEELTDYFSNFAPTKHAVVVKDVNKK-SRGFGFVSFAVEDDTKEALKKA 86

Query: 194 QGHELNGRPLRINWASK 210
           +  +L G  LR++ A +
Sbjct: 87  RQTKLKGHLLRVDIAKR 103

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 39/203 (19%), Positives = 82/203 (40%), Gaps = 41/203 (20%)

Query: 44  KVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQT 103
           K L+V ++   + +E L  YF    P  +  ++ D N  +  + FV +    D   AL+ 
Sbjct: 26  KTLFVRSIPMDVTDEELTDYFSNFAPTKHAVVVKDVNKKSRGFGFVSFAVEDDTKEALKK 85

Query: 104 LNGKQIENNVVKINWAFQSQQVSPDE-------ATFNLFV---GDLNVD----VDDETLR 149
               +++ ++++++ A +  + S  +        T  + V   GD N D    VD+E+L 
Sbjct: 86  ARQTKLKGHLLRVDIAKRRDRSSKSDDKNEGKVKTDTIAVGTRGDDNGDEPEEVDEESL- 144

Query: 150 NAFKEFPTYLQGHVMWDM------------------------QTGGSRGYGFVSFGSQEE 185
              K  P  +  ++ W                          + G   G+ FV+      
Sbjct: 145 --LKGKPKLIIRNMPWSCRDPEKLKKVFGRFGNVVEATIPRKRDGKLCGFAFVTMKKLSN 202

Query: 186 AQKAMDAMQGHELNGRPLRINWA 208
              A++  +  +++GRP+ +++A
Sbjct: 203 CHLALENTKDLKIDGRPVAVDFA 225

>NCAS0G04280 Chr7 (796093..797400) [1308 bp, 435 aa] {ON} Anc_1.408
          Length = 435

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 80/189 (42%), Gaps = 31/189 (16%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           ++VGNL      E L+ YF   G +    I+  K +       VE+  S D   A++  +
Sbjct: 107 IFVGNLTYDCTPEDLRDYFSGIGEVVRADIITSKGHHRG-MGTVEFTNSRDVEEAIRQYD 165

Query: 106 G-----KQI--------------ENNVVKINWAFQSQQVSPDEATFNL----------FV 136
                 +QI              E    +   A  S+Q       +++          FV
Sbjct: 166 SSYFMDRQIFVRQDNPPPDNGRNERTPSRRTTAPSSRQQDISSGAYSMQSNMKQGYEIFV 225

Query: 137 GDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGH 196
            +L   ++ + L++ FKE    ++  V  D + G SRG+G V F ++++ ++A+D     
Sbjct: 226 ANLPYSINWQALKDMFKECGDVMRADVELD-RAGRSRGFGTVIFRTRDDMERAIDRYNRF 284

Query: 197 ELNGRPLRI 205
           E++GR L +
Sbjct: 285 EVDGRTLDV 293

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 44/100 (44%), Gaps = 2/100 (2%)

Query: 20  SETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDK 79
           SE  S   S      ++GG   +  ++Y  NL  S     L   F+  G + N ++  D+
Sbjct: 335 SEPASNRTSTFTEGVVEGGERNT--LIYCSNLPPSTARSDLYDLFESIGKVRNAELKYDR 392

Query: 80  NNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWA 119
           N      A VE+    DA++ ++ LN        ++I++A
Sbjct: 393 NGETTGVAIVEFISQDDADVCIERLNKYNYGGCDLEISYA 432

>Suva_16.271 Chr16 (472819..474879) [2061 bp, 686 aa] {ON} YPL043W
           (REAL)
          Length = 686

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           LFV  +  DV DE L + F  F       V+ D+    SRG+GFVSF  +++ ++A+   
Sbjct: 28  LFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDVNKR-SRGFGFVSFAVEDDTKEALAKA 86

Query: 194 QGHELNGRPLRINWASK 210
           +  + NG  LR++ A +
Sbjct: 87  RKTKFNGHSLRVDVAKR 103

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 32/62 (51%)

Query: 122 SQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFG 181
           +++V      F++FV ++  D  +E+L   F +F +      + D  TG ++G  FV+F 
Sbjct: 282 TRKVQNKREDFSIFVRNVPYDATEESLAAHFSKFGSVKYALPVIDKSTGLAKGTAFVAFK 341

Query: 182 SQ 183
            Q
Sbjct: 342 DQ 343

>KLLA0D13420g Chr4 complement(1157491..1157991) [501 bp, 166 aa]
           {ON} similar to uniprot|P40565 YIR005W Saccharomyces
           cerevisiae IST3 Component of the U2 snRNP required for
           the first catalytic step of splicing and for
           spliceosomal assembly
          Length = 166

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/109 (22%), Positives = 59/109 (54%), Gaps = 4/109 (3%)

Query: 100 ALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYL 159
           ++Q L+ +++E  ++K   ++  +    D+A  N   G +++++ +  +   F ++   +
Sbjct: 6   SIQKLSERELECGILKPESSWHHE--YKDQAYINF--GGMHLELTEADILTIFSQYGCPV 61

Query: 160 QGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWA 208
              ++ D  TG S+G+GF+ +  Q     A+D + G ++ GR +R++ A
Sbjct: 62  DIKLVRDQTTGKSKGFGFLKYEDQRSTILAVDNLNGAKVCGRLIRVDHA 110

>YCL011C Chr3 complement(102075..103358) [1284 bp, 427 aa] {ON}
           GBP2Poly(A+) RNA-binding protein, involved in the export
           of mRNAs from the nucleus to the cytoplasm; similar to
           Hrb1p and Npl3p; also binds single-stranded telomeric
           repeat sequence in vitro
          Length = 427

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 75/175 (42%), Gaps = 22/175 (12%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           ++V NL      E LK+ F   G +    I+  K +       VE+ ++     A+   +
Sbjct: 124 IFVRNLTFDCTPEDLKELFGTVGEVVEADIITSKGHHRG-MGTVEFTKNESVQDAISKFD 182

Query: 106 GKQIENNVVKINWAFQSQQVSPDEAT---------------FNLFVGDLNVDVDDETLRN 150
           G    +  + +      Q   P EA                F +F+ +L   ++ ++L++
Sbjct: 183 GALFMDRKLMV-----RQDNPPPEAAKEFSKKATREEIDNGFEVFIINLPYSMNWQSLKD 237

Query: 151 AFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRI 205
            FKE    L+  V  D   G SRG+G V + +++E  +A+D   G E+ GR L +
Sbjct: 238 MFKECGHVLRADVELDF-NGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVLEV 291

>Skud_9.178 Chr9 complement(326982..327734) [753 bp, 250 aa] {ON}
           YIR001C (REAL)
          Length = 250

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 51/92 (55%), Gaps = 9/92 (9%)

Query: 122 SQQVSPDEA--------TFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSR 173
           SQ++S +E         + ++FVG++ +DV  E +   F++     +  +++D  TG  +
Sbjct: 46  SQKLSKEEKHAHQLEADSRSIFVGNITLDVTPEQIEEHFQDCGLIKRITLLYDRNTGAPK 105

Query: 174 GYGFVSFGSQEEAQKAMDAMQGHELNGRPLRI 205
           GYG++ F S    +KA+  + G ELNG+ + +
Sbjct: 106 GYGYIEFESPAFREKALQ-LNGVELNGKKIAV 136

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 5/75 (6%)

Query: 40  ETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNN-SNANYAFVEYFQSHDAN 98
           E   + ++VGN+   +  E ++++FQ  G I  + ++ D+N  +   Y ++E+       
Sbjct: 60  EADSRSIFVGNITLDVTPEQIEEHFQDCGLIKRITLLYDRNTGAPKGYGYIEFESPAFRE 119

Query: 99  IALQ----TLNGKQI 109
            ALQ     LNGK+I
Sbjct: 120 KALQLNGVELNGKKI 134

>Smik_3.71 Chr3 complement(100547..101833) [1287 bp, 428 aa] {ON}
           YCL011C (REAL)
          Length = 428

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 75/175 (42%), Gaps = 22/175 (12%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           ++V NL  +   E LK+ F   G I    I+  K +       VE+  +     A+   +
Sbjct: 125 IFVRNLTFNCTPEDLKELFGTVGEIVEADIITSKGHHRG-MGTVEFTNNEAVQDAISKFD 183

Query: 106 GKQIENNVVKINWAFQSQQVSPDEAT---------------FNLFVGDLNVDVDDETLRN 150
           G    +  + +      Q   P EA                F +F+ +L   ++ ++L++
Sbjct: 184 GALFMDRKLMV-----RQDNPPPEAAREFSKKATKEEIDNGFEVFIINLPYSINWQSLKD 238

Query: 151 AFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRI 205
            FKE    L+  V  D   G SRG+G V + +++E  +A+D   G E+ GR L +
Sbjct: 239 MFKECGHVLRADVELDF-NGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVLEV 292

>KNAG0I02030 Chr9 (396201..396890) [690 bp, 229 aa] {ON} Anc_2.167
           YNL110C
          Length = 229

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 37  GGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNA-NYAFVEYFQSH 95
           G R+    +LYV  L    +E  L +YF   G +  V++  +K   N+ +Y F+E+ +  
Sbjct: 93  GARDEHSSILYVSRLPHGFHERELSRYFSQFGDLKEVRLARNKKTGNSRHYGFIEFAEVG 152

Query: 96  DANIALQTLN 105
           DA +A +T+N
Sbjct: 153 DAQVAQETMN 162

 Score = 37.0 bits (84), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 39/85 (45%)

Query: 126 SPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEE 185
           + DE +  L+V  L     +  L   F +F    +  +  + +TG SR YGF+ F    +
Sbjct: 94  ARDEHSSILYVSRLPHGFHERELSRYFSQFGDLKEVRLARNKKTGNSRHYGFIEFAEVGD 153

Query: 186 AQKAMDAMQGHELNGRPLRINWASK 210
           AQ A + M  + L G  L++    K
Sbjct: 154 AQVAQETMNNYLLMGHLLQVRLLGK 178

>TDEL0F02850 Chr6 (516483..517322) [840 bp, 279 aa] {ON} Anc_4.66
           YGL044C
          Length = 279

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 44  KVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVD-KNNSNANYAFVEYFQSHDANIALQ 102
           KV+Y+G++     EE +       GP+ N+K+M D +   +  YAFVEY     +  A++
Sbjct: 16  KVVYLGSIPYDQTEEQILDLCSNVGPVTNLKMMFDPQTGKSKGYAFVEYKDLESSASAVR 75

Query: 103 TLNGKQIENNVVKINWAFQS 122
            LNG Q  + ++K  +A  S
Sbjct: 76  NLNGYQFGSRLLKCGYASNS 95

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 38/76 (50%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           +++G +  D  +E + +            +M+D QTG S+GY FV +   E +  A+  +
Sbjct: 18  VYLGSIPYDQTEEQILDLCSNVGPVTNLKMMFDPQTGKSKGYAFVEYKDLESSASAVRNL 77

Query: 194 QGHELNGRPLRINWAS 209
            G++   R L+  +AS
Sbjct: 78  NGYQFGSRLLKCGYAS 93

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 8/82 (9%)

Query: 288 APPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHY------PEKGCCFIKYDTHEQA 341
           AP +V   Y+G+IP+   E  ++ L  N G + + K          KG  F++Y   E +
Sbjct: 13  APSKV--VYLGSIPYDQTEEQILDLCSNVGPVTNLKMMFDPQTGKSKGYAFVEYKDLESS 70

Query: 342 AVCIVALANFPFQGRNLRTGWG 363
           A  +  L  + F  R L+ G+ 
Sbjct: 71  ASAVRNLNGYQFGSRLLKCGYA 92

>Smik_16.192 Chr16 (345251..347323) [2073 bp, 690 aa] {ON} YPL043W
           (REAL)
          Length = 690

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 1/77 (1%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           LFV  +  DV DE L + F  F       V+ D     SRG+GFVSF  +++ ++A+   
Sbjct: 28  LFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKR-SRGFGFVSFAVEDDTKEALAKA 86

Query: 194 QGHELNGRPLRINWASK 210
           +  + NG  LR++ A +
Sbjct: 87  RKTKFNGHTLRVDVAKR 103

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/83 (20%), Positives = 37/83 (44%)

Query: 44  KVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQT 103
           K L+V ++   + +E L  +F    PI +  ++ D N  +  + FV +    D   AL  
Sbjct: 26  KTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKRSRGFGFVSFAVEDDTKEALAK 85

Query: 104 LNGKQIENNVVKINWAFQSQQVS 126
               +   + ++++ A +  + S
Sbjct: 86  ARKTKFNGHTLRVDVAKRRDRTS 108

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 33/62 (53%)

Query: 122 SQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFG 181
           +++V   +  F++FV ++  D  +E+L   F +F +      + D  TG ++G  FV+F 
Sbjct: 285 TRKVQNKKEDFSVFVRNVPYDATEESLAAHFSKFGSVKYALPVIDKSTGLAKGTAFVAFK 344

Query: 182 SQ 183
            Q
Sbjct: 345 DQ 346

>Kwal_55.20972 s55 (629521..629928) [408 bp, 135 aa] {ON} YIR005W
           (IST3) - U2 snRNP associated protein [contig 135] FULL
          Length = 135

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/109 (22%), Positives = 60/109 (55%), Gaps = 8/109 (7%)

Query: 100 ALQTLNGKQIENNVVK--INWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPT 157
           ++Q L+ +++E  ++    +W F+ +    D+A   +FVG L+ D+ +  +   F ++  
Sbjct: 6   SIQNLSFRELEQGILSPTASWHFEYK----DQAY--IFVGGLHKDLTEGDILTIFSQYGI 59

Query: 158 YLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRIN 206
            +   ++ D ++G S+G+ ++ +  Q     A+D + G ++ GR +R++
Sbjct: 60  PVDLKLVRDRESGESKGFAYLKYEDQRSTVLAVDNLNGVKIAGRSIRVD 108

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/82 (20%), Positives = 34/82 (41%), Gaps = 10/82 (12%)

Query: 296 YIGNIPHFAIEADLIPLLQNFGFIIDFKHYPE------KGCCFIKYDTHEQAAVCIVALA 349
           ++G +     E D++ +   +G  +D K   +      KG  ++KY+      + +  L 
Sbjct: 37  FVGGLHKDLTEGDILTIFSQYGIPVDLKLVRDRESGESKGFAYLKYEDQRSTVLAVDNLN 96

Query: 350 NFPFQGRNLRTGWGKERTSFVP 371
                GR++R     + T F P
Sbjct: 97  GVKIAGRSIRV----DHTMFTP 114

>Ecym_4446 Chr4 (912645..915212) [2568 bp, 855 aa] {ON} similar to
           Ashbya gossypii ADR035C
          Length = 855

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 79/176 (44%), Gaps = 16/176 (9%)

Query: 46  LYVGNLDTSINEEILKQYFQ--VGGPIANVKIMVDKNNS----NANYAFVEYFQSHDANI 99
           ++V NL+ S   E L   F+   G  +A +K   D        +  + FVE+     AN 
Sbjct: 632 IFVKNLNFSTKTEDLTDKFKSFAGFIVAQIKTKPDPKRKGKTQSMGFGFVEFRTKEQANA 691

Query: 100 ALQTLNGKQIENNVVKINWAFQ-----SQQVSPDEATFNLFVGDLNVDVDDETLRNAFKE 154
            +  L G  I+ + +++  + +     + + S       + V +L  +    T ++ F+ 
Sbjct: 692 VISALEGTVIDGHKIQLKLSHRQGTASTAKTSKKNINGKIIVKNLPFEA---TRKDIFEL 748

Query: 155 FPTY--LQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWA 208
           F ++  L+   +       +RG+ FV F   +EA+ AMD ++G  L GR L + +A
Sbjct: 749 FSSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLEGVHLLGRRLVMQYA 804

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 40/85 (47%)

Query: 121 QSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSF 180
           + Q +S   A+  LF+ ++     ++  +  F  +    + H+  D +TG S+G+ +V F
Sbjct: 302 EEQCLSKIRASGRLFLRNILYTAKEDDFQQLFAPYGEIEEIHIAVDTRTGQSKGFAYVLF 361

Query: 181 GSQEEAQKAMDAMQGHELNGRPLRI 205
            + ++A  A   +      GR L I
Sbjct: 362 KNPDDAVNAYIELDKQIFQGRLLHI 386

>Smik_9.204 Chr9 (340893..341342) [450 bp, 149 aa] {ON} YIR005W
           (REAL)
          Length = 149

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 53/104 (50%), Gaps = 8/104 (7%)

Query: 111 NNVVKINWA-FQSQQVSPDEATFN-------LFVGDLNVDVDDETLRNAFKEFPTYLQGH 162
           N + KIN A  QS  +SP  +  N       +++G+LN ++ +  +   F E+   +   
Sbjct: 2   NKIQKINDAELQSGILSPHHSWHNEYKDNAYIYIGNLNRELTEGDILTVFSEYGVPVDII 61

Query: 163 VMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRIN 206
           +  D  TG S+GY ++ +  Q     A+D + G+++  R L+++
Sbjct: 62  ISRDENTGESQGYAYLKYEDQRSTILAVDNLNGYKIGERALKVD 105

 Score = 35.8 bits (81), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 43/77 (55%), Gaps = 3/77 (3%)

Query: 46  LYVGNLDTSINE-EILKQYFQVGGPIANVKIMVDKNNSNAN-YAFVEYFQSHDANIALQT 103
           +Y+GNL+  + E +IL  + + G P+ ++ I  D+N   +  YA+++Y       +A+  
Sbjct: 33  IYIGNLNRELTEGDILTVFSEYGVPV-DIIISRDENTGESQGYAYLKYEDQRSTILAVDN 91

Query: 104 LNGKQIENNVVKINWAF 120
           LNG +I    +K++  F
Sbjct: 92  LNGYKIGERALKVDHTF 108

>Skud_3.48 Chr3 complement(80985..82274) [1290 bp, 429 aa] {ON}
           YCL011C (REAL)
          Length = 429

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 75/175 (42%), Gaps = 22/175 (12%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLN 105
           ++V NL  +   E LK+ F   G I    I+  K +       VE+  +     A+   +
Sbjct: 126 IFVRNLTFNCTPEDLKELFGTVGEIVEADIITSKGHHRG-MGTVEFTNNESVQDAISKFD 184

Query: 106 GKQIENNVVKINWAFQSQQVSPDEAT---------------FNLFVGDLNVDVDDETLRN 150
           G    +  + +      Q   P EA                F +F+ +L   ++ ++L++
Sbjct: 185 GALFMDRKLMV-----RQDNPPPEAAKEFSKKATKEEIDNGFEVFIINLPYSINWQSLKD 239

Query: 151 AFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRI 205
            FKE    L+  V  D   G SRG+G V + +++E  +A+D   G E+ GR L +
Sbjct: 240 MFKECGHVLRADVEVDF-NGFSRGFGSVIYPTKDEMIRAIDTFNGMEVEGRVLEV 293

>KLLA0E11045g Chr5 (968674..969972) [1299 bp, 432 aa] {ON} similar
           to uniprot|P49960 Saccharomyces cerevisiae YMR268C PRP24
           Splicing factor that reanneals U4 and U6 snRNPs during
           spliceosome recycling
          Length = 432

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 82/177 (46%), Gaps = 13/177 (7%)

Query: 40  ETSDKVLYVGNL----DTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSH 95
           + +D  ++V N     D S    +L QY  +  PI ++++     NS   +A+V+     
Sbjct: 109 QLTDSTIWVTNFPPGYDASKLRNLLSQY--IDSPILSIRLPSLAFNSRRRFAYVDLVSPE 166

Query: 96  DANIALQTLNGKQIENN--VVKINWAFQSQQVSPDEAT--FNLFVGDLNVDVDDETLRNA 151
            A  A   LNG +I N   V KI+   +  + + +  +    + V +L  D+  + L   
Sbjct: 167 VAKKATNRLNGIEINNYKLVAKISNVNERTERTDNAISDGREIIVKNLPDDITIDDLIKM 226

Query: 152 FKEFPTYLQGHVMWDMQT--GGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRIN 206
           F EF    +  ++   +T  G    Y F++F ++  A  A+ ++ G  +NG+PL ++
Sbjct: 227 FNEFGDTEKARIVTGDETNPGRHSRYAFITFKNKASADNAL-SLNGAVMNGKPLHVS 282

>Suva_9.210 Chr9 complement(343096..343848) [753 bp, 250 aa] {ON}
           YIR001C (REAL)
          Length = 250

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           +FVG++ +DV  E +   F++     +  +++D  TG  +GYG++ F S    +KA+  +
Sbjct: 66  IFVGNITLDVTPEQIEELFQDCGIIKRITLLYDRNTGAPKGYGYIEFESPAFREKALQ-L 124

Query: 194 QGHELNGRPLRI 205
            G EL G+ + +
Sbjct: 125 NGAELKGKKIAV 136

 Score = 33.1 bits (74), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 40/78 (51%), Gaps = 2/78 (2%)

Query: 40  ETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNN-SNANYAFVEYFQSHDAN 98
           E   + ++VGN+   +  E +++ FQ  G I  + ++ D+N  +   Y ++E+       
Sbjct: 60  EADSRSIFVGNITLDVTPEQIEELFQDCGIIKRITLLYDRNTGAPKGYGYIEFESPAFRE 119

Query: 99  IALQTLNGKQIENNVVKI 116
            ALQ LNG +++   + +
Sbjct: 120 KALQ-LNGAELKGKKIAV 136

>Skud_16.399 Chr16 complement(714087..716726) [2640 bp, 879 aa] {ON}
           YPR112C (REAL)
          Length = 879

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 97/217 (44%), Gaps = 14/217 (6%)

Query: 3   EQENLEQNPTVESEVPASETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQ 62
           +Q+ +E  P+    +  +   +EE S      I  G   S   +++ NL+ S   + L  
Sbjct: 617 QQKAVEIKPSSNDLMETNTDANEESSATHEEDIAEGPTVS---IFIKNLNFSTTNQNLTD 673

Query: 63  YFQV--GGPIANVKIMVDKNNS----NANYAFVEYFQSHDANIALQTLNGKQIENNVVKI 116
            F+   G  +A VK   D  +     +  + FVE+     AN  +  ++G  I+ + +++
Sbjct: 674 RFKAFSGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQANAVISAMDGTVIDGHKIQL 733

Query: 117 NWAF-QSQQVSPDEATFNLFVGDLNVDVD--DETLRNAFKEFPTY--LQGHVMWDMQTGG 171
             +  QS Q S  +   N   G + V     + T ++ F+ F ++  L+   +       
Sbjct: 734 KLSHRQSSQNSNTKTKSNKRSGKIIVKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKS 793

Query: 172 SRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWA 208
           +RG+ FV F   +EA+ AMD + G  L GR L + +A
Sbjct: 794 ARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLIMQYA 830

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 34/75 (45%)

Query: 131 TFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAM 190
           T  LF+ ++  +  +E  +  F  F    + HV  D +TG S+G+ +V F   + A  A 
Sbjct: 336 TGRLFLRNILYNSKEEDFKELFGPFGDLEEVHVALDTRTGQSKGFAYVLFKDPKNAVNAY 395

Query: 191 DAMQGHELNGRPLRI 205
             +      GR L I
Sbjct: 396 VELDKQIFQGRLLHI 410

 Score = 30.4 bits (67), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 26/50 (52%)

Query: 70  IANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWA 119
           I +VKI+ D+N  +  + F+ Y    DA  A+   NG  +  + +++  A
Sbjct: 43  ITDVKILRDRNGESRRFGFIGYRNEDDAFDAVDYFNGSFVNTSKIEVAMA 92

>TDEL0A03990 Chr1 complement(713693..714529) [837 bp, 278 aa] {ON}
           Anc_5.536 YDR429C
          Length = 278

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 48/94 (51%), Gaps = 9/94 (9%)

Query: 119 AFQSQQVSPDEATFNLFVGDLNVDVDDETLRNA----FKEFPTYLQGHVMWDMQTGGSRG 174
           A++  +   D AT  L +  LN + D+ TLR      F   P  +   V+ + +TG SRG
Sbjct: 181 AYRDSRERDDMAT--LKITQLNENADENTLREELLFPFAPIPKVV---VVRNRETGRSRG 235

Query: 175 YGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWA 208
             FV+F S+E A++A+  + G       LR+ W+
Sbjct: 236 LSFVTFASEEIAEQALHFLDGRGFMNLILRVEWS 269

>NDAI0A04750 Chr1 (1085815..1088346) [2532 bp, 843 aa] {ON}
           Anc_3.432
          Length = 843

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 82/177 (46%), Gaps = 17/177 (9%)

Query: 46  LYVGNLDTSINEEILKQYFQV--GGPIANVKIMVDKNNSNAN----YAFVEYFQSHDANI 99
           +++ NL+ S +   L   F+V  G  +A VK   D  + N      + F E+     AN 
Sbjct: 645 IFIKNLNFSTSSSDLTSRFKVFNGFVVAQVKTKPDPKHPNKTLSMGFGFAEFRTKEQANA 704

Query: 100 ALQTLNGKQIENNVVKINWAFQSQQVSPDEATFN------LFVGDLNVDVDDETLRNAFK 153
            +  ++G  I+ + +++  + +      + ++ N      + V +L  +    T ++ F+
Sbjct: 705 VIAAMDGTVIDGHKIQLKLSHRQGTKGNNTSSKNKTKSAKIIVKNLPFEA---TRKDVFE 761

Query: 154 EFPTY--LQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWA 208
            F ++  L+   +       +RG+ F+ F   +EA+ AMD +QG  L GR L + +A
Sbjct: 762 LFNSFGQLKSVRVPKKFDKSARGFAFIEFLLPKEAENAMDQLQGVHLLGRRLVMQYA 818

 Score = 37.0 bits (84), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 35/75 (46%)

Query: 131 TFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAM 190
           T  LF+ ++     +E  R  F  F    + H+  D +TG S+G+ ++ F   ++A +A 
Sbjct: 328 TGRLFLRNILYSSTEEDFRKLFSPFGELEEVHIALDTRTGQSKGFAYILFKDPKDALQAY 387

Query: 191 DAMQGHELNGRPLRI 205
             +      GR L I
Sbjct: 388 IELDKQIFQGRLLHI 402

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 39/84 (46%), Gaps = 10/84 (11%)

Query: 46  LYVGNLDTSINEEILKQYF----------QVGGPIANVKIMVDKNNSNANYAFVEYFQSH 95
           + V  L T + ++ LK +F          +    I +VK++ D+N  +  +AF+ Y    
Sbjct: 4   IIVKGLPTFLTDDNLKTHFNKRLSTTHKGKSDNLITDVKVLRDRNGESRRFAFIGYRNEE 63

Query: 96  DANIALQTLNGKQIENNVVKINWA 119
           DA  A+   NG  I    ++++ A
Sbjct: 64  DAFDAVNYFNGSYINTAKIEVSMA 87

>Skud_16.238 Chr16 (433890..435932) [2043 bp, 680 aa] {ON} YPL043W
           (REAL)
          Length = 680

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 1/77 (1%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           LFV  +  DV DE L + F  F       V+ D     SRG+GFVSF  +++ ++A+   
Sbjct: 28  LFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKR-SRGFGFVSFAVEDDTKEALIKA 86

Query: 194 QGHELNGRPLRINWASK 210
           +  + NG  LR++ A +
Sbjct: 87  RKTKFNGHTLRVDVAKR 103

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 33/62 (53%)

Query: 122 SQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFG 181
           +++V   +  F++FV ++  D  +E+L   F +F +      + D  TG ++G  FV+F 
Sbjct: 275 TRKVQNKKEEFSVFVRNVPYDATEESLVAHFSKFGSVKYALPVIDRSTGLAKGTAFVAFK 334

Query: 182 SQ 183
            Q
Sbjct: 335 DQ 336

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 38/199 (19%), Positives = 80/199 (40%), Gaps = 35/199 (17%)

Query: 44  KVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIAL-- 101
           K L+V ++   + +E L  +F    PI +  ++ D N  +  + FV +    D   AL  
Sbjct: 26  KTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKRSRGFGFVSFAVEDDTKEALIK 85

Query: 102 ---QTLNGKQIENNVVK-INWAFQSQQVSPDEA--TFNLFVGDLNV---DVDDE------ 146
                 NG  +  +V K  + + +S + +P +A  +F   +G       D D E      
Sbjct: 86  ARKTKFNGHTLRVDVAKRRDRSKKSSEGAPMKASESFEKTIGQKTENEHDADGEDSMLKG 145

Query: 147 -----------------TLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKA 189
                             L++ F  + T ++  +    + G   G+ FV+       + A
Sbjct: 146 KPKLIIRNMPWSCRDSTKLKDIFSRYGTVVEATIPR-KRDGKLCGFAFVTMKKISNCRIA 204

Query: 190 MDAMQGHELNGRPLRINWA 208
           ++  +  +++GR + +++A
Sbjct: 205 LENSKDLKIDGRKVAVDFA 223

>Skud_9.182 Chr9 (335662..336111) [450 bp, 149 aa] {ON} YIR005W
           (REAL)
          Length = 149

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/106 (22%), Positives = 59/106 (55%), Gaps = 4/106 (3%)

Query: 101 LQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQ 160
           +Q +N +++++ ++  + ++ S+    D A   +++G+LN ++ +  +   F E+   + 
Sbjct: 4   IQEINDRELQSGILSPHLSWHSEY--RDNAY--VYIGNLNKELTEGDILTVFSEYGVPVD 59

Query: 161 GHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRIN 206
             +  D  TG S+G+ ++ +  Q     A+D + G ++ GRPL+I+
Sbjct: 60  VILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGVKVGGRPLKID 105

 Score = 32.7 bits (73), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 43/77 (55%), Gaps = 3/77 (3%)

Query: 46  LYVGNLDTSINE-EILKQYFQVGGPIANVKIMVDKNNSNAN-YAFVEYFQSHDANIALQT 103
           +Y+GNL+  + E +IL  + + G P+ +V +  D+N   +  +A+++Y       +A+  
Sbjct: 33  VYIGNLNKELTEGDILTVFSEYGVPV-DVILSRDENTGESQGFAYLKYEDQRSTILAVDN 91

Query: 104 LNGKQIENNVVKINWAF 120
           LNG ++    +KI+  F
Sbjct: 92  LNGVKVGGRPLKIDHTF 108

>YIR001C Chr9 complement(356143..356895) [753 bp, 250 aa] {ON}
           SGN1Cytoplasmic RNA-binding protein, contains an RNA
           recognition motif (RRM); may have a role in mRNA
           translation, as suggested by genetic interactions with
           genes encoding proteins involved in translational
           initiation
          Length = 250

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           +FVG++  DV  E + + FK+     +  +++D  TG  +GYG++ F S    +KA+  +
Sbjct: 66  IFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTGTPKGYGYIEFESPAYREKAL-QL 124

Query: 194 QGHELNGRPLRI 205
            G EL G+ + +
Sbjct: 125 NGGELKGKKIAV 136

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 39/78 (50%), Gaps = 2/78 (2%)

Query: 40  ETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSN-ANYAFVEYFQSHDAN 98
           E   + ++VGN+   +  E ++ +F+  G I  + ++ D+N      Y ++E+       
Sbjct: 60  EADSRSIFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTGTPKGYGYIEFESPAYRE 119

Query: 99  IALQTLNGKQIENNVVKI 116
            ALQ LNG +++   + +
Sbjct: 120 KALQ-LNGGELKGKKIAV 136

>CAGL0H04675g Chr8 complement(447256..448080) [825 bp, 274 aa] {ON}
           highly similar to uniprot|Q04067 Saccharomyces
           cerevisiae YDR429c TIF35
          Length = 274

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 47/91 (51%), Gaps = 3/91 (3%)

Query: 119 AFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFK-EFPTYLQGHVMWDMQTGGSRGYGF 177
           A++  +   D  T  +    LN + D+ TLRN     F    +  V+ + +TG SRG  F
Sbjct: 178 AYRDARERDDSCTLKIL--QLNENADENTLRNELLFPFEPIQKVVVVRNKETGRSRGLAF 235

Query: 178 VSFGSQEEAQKAMDAMQGHELNGRPLRINWA 208
           V+F +++ A+KA+  + G       LR++W+
Sbjct: 236 VTFINEDMAEKALHFLDGRGFMNLILRVDWS 266

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 49/105 (46%), Gaps = 6/105 (5%)

Query: 18  PASETISEEPSVVPANAIKGGRETSDKV-LYVGNLDTSINEEILKQYFQVG-GPIANVKI 75
           P+    + +PS   ++A +  RE  D   L +  L+ + +E  L+        PI  V +
Sbjct: 165 PSRRAGARDPS---SDAYRDARERDDSCTLKILQLNENADENTLRNELLFPFEPIQKVVV 221

Query: 76  MVDKNNSNAN-YAFVEYFQSHDANIALQTLNGKQIENNVVKINWA 119
           + +K    +   AFV +     A  AL  L+G+   N +++++W+
Sbjct: 222 VRNKETGRSRGLAFVTFINEDMAEKALHFLDGRGFMNLILRVDWS 266

>YPL043W Chr16 (469939..471996) [2058 bp, 685 aa] {ON}
           NOP4Nucleolar protein, essential for processing and
           maturation of 27S pre-rRNA and large ribosomal subunit
           biogenesis; constituent of 66S pre-ribosomal particles;
           contains four RNA recognition motifs (RRMs)
          Length = 685

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 1/77 (1%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           LFV  +  DV DE L + F  F       V+ D     SRG+GFVSF  +++ ++A+   
Sbjct: 28  LFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKR-SRGFGFVSFAVEDDTKEALAKA 86

Query: 194 QGHELNGRPLRINWASK 210
           +  + NG  LR++ A +
Sbjct: 87  RKTKFNGHILRVDIAKR 103

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/76 (21%), Positives = 35/76 (46%)

Query: 44  KVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQT 103
           K L+V ++   + +E L  +F    PI +  ++ D N  +  + FV +    D   AL  
Sbjct: 26  KTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKRSRGFGFVSFAVEDDTKEALAK 85

Query: 104 LNGKQIENNVVKINWA 119
               +   ++++++ A
Sbjct: 86  ARKTKFNGHILRVDIA 101

 Score = 30.8 bits (68), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 28/52 (53%)

Query: 132 FNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQ 183
           F++FV ++  D  +E+L   F +F +      + D  TG ++G  FV+F  Q
Sbjct: 290 FSVFVRNVPYDATEESLAPHFSKFGSVKYALPVIDKSTGLAKGTAFVAFKDQ 341

>NDAI0D04810 Chr4 complement(1135992..1137872) [1881 bp, 626 aa]
           {ON} Anc_4.33 YHL024W
          Length = 626

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 53/108 (49%), Gaps = 11/108 (10%)

Query: 29  VVPANAIKGGRETSDKVLYVGNLDTSINEEIL----KQYFQVGGPIANVKIMVDKNNSNA 84
           + PA   K  R      ++V +L +++ ++ L      YF+  G I  VK++ D+  +N 
Sbjct: 43  IPPAMNTKPFRGRPSSCVFVASLTSTLTDDELCVSVTDYFKKFGEIVRVKVLRDQ--ANR 100

Query: 85  NYAFVEYFQSHDANIALQT-----LNGKQIENNVVKINWAFQSQQVSP 127
            YAFV+Y    DAN AL+T     LNG+++     ++N        SP
Sbjct: 101 PYAFVQYTNDKDANNALKTAHGSLLNGRRLRCEPARVNRTLFITHDSP 148

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 7/75 (9%)

Query: 134 LFVGDLNVDVDDETL----RNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKA 189
           +FV  L   + D+ L     + FK+F   ++  V+ D     +R Y FV + + ++A  A
Sbjct: 60  VFVASLTSTLTDDELCVSVTDYFKKFGEIVRVKVLRDQ---ANRPYAFVQYTNDKDANNA 116

Query: 190 MDAMQGHELNGRPLR 204
           +    G  LNGR LR
Sbjct: 117 LKTAHGSLLNGRRLR 131

>Kpol_1023.95 s1023 (221318..222142) [825 bp, 274 aa] {ON}
           (221318..222142) [825 nt, 275 aa]
          Length = 274

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 48/94 (51%), Gaps = 9/94 (9%)

Query: 119 AFQSQQVSPDEATFNLFVGDLNVDVDDETLRNA----FKEFPTYLQGHVMWDMQTGGSRG 174
           A++  +   D AT  L +  LN + D+ TLR      F   P  +   V+ + +TG SRG
Sbjct: 180 AYRDSRERDDMAT--LKITQLNENADETTLREELLFPFGNIPRVV---VVRNRETGRSRG 234

Query: 175 YGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWA 208
             FV+F S+E A+KA   + G       L+++W+
Sbjct: 235 LAFVTFSSEEVAEKARRLLNGRGFMNLILQVDWS 268

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 52/107 (48%), Gaps = 10/107 (9%)

Query: 18  PASETISEEPSVVPANAIKGGRETSD-KVLYVGNLDTSINEEILKQYFQVGGPIANV-KI 75
           P+    +++PS   ++A +  RE  D   L +  L+ + +E  L++      P  N+ ++
Sbjct: 167 PSRRAGAKDPS---SDAYRDSRERDDMATLKITQLNENADETTLREELLF--PFGNIPRV 221

Query: 76  MVDKNNSNAN---YAFVEYFQSHDANIALQTLNGKQIENNVVKINWA 119
           +V +N         AFV +     A  A + LNG+   N +++++W+
Sbjct: 222 VVVRNRETGRSRGLAFVTFSSEEVAEKARRLLNGRGFMNLILQVDWS 268

>KLTH0E11418g Chr5 complement(1020231..1022312) [2082 bp, 693 aa]
           {ON} some similarities with uniprot|P37838 Saccharomyces
           cerevisiae YPL043W NOP4 Nucleolar protein essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis contains four RNA
           recognition motifs (RRMs)
          Length = 693

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 1/77 (1%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           LFV  +  +  DE L N F E        ++ D +   SRG+GFVSF  +++ + A++  
Sbjct: 23  LFVRSIPFEATDEELTNYFSELAPIKHAVIVKDNEKN-SRGFGFVSFAVEDDTKDALEKA 81

Query: 194 QGHELNGRPLRINWASK 210
           +  +  GR LR++ A +
Sbjct: 82  RKTKFKGRLLRVDIAKR 98

 Score = 37.0 bits (84), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 34/187 (18%), Positives = 77/187 (41%), Gaps = 23/187 (12%)

Query: 44  KVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQT 103
           K L+V ++     +E L  YF    PI +  I+ D   ++  + FV +    D   AL+ 
Sbjct: 21  KTLFVRSIPFEATDEELTNYFSELAPIKHAVIVKDNEKNSRGFGFVSFAVEDDTKDALEK 80

Query: 104 LNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDD------------------ 145
               + +  +++++ A + ++   D+ + +      NV+  +                  
Sbjct: 81  ARKTKFKGRLLRVDIAKRRERSKGDQRSSSSSEQAGNVENKENELMGGKPKLIIRNMPWS 140

Query: 146 ----ETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGR 201
               E L+  F  F T ++  +      G   G+ FV+       +KA++  +  +++GR
Sbjct: 141 VRKPEQLKQIFMRFGTVVEAKIP-KKPDGKLCGFAFVTMKKLAACKKAIEDSKDLKIDGR 199

Query: 202 PLRINWA 208
            + +++A
Sbjct: 200 QVAVDFA 206

>KLTH0F11968g Chr6 (1008620..1011259) [2640 bp, 879 aa] {ON} similar
           to uniprot|Q06106 Saccharomyces cerevisiae YPR112C MRD1
           Essential conserved protein that associates with 35S
           precursor rRNA and is required for its initial
           processing at the A(0)-A(2) cleavage sites shows partial
           nucleolar localization contains five consensus RNA-
           binding domains
          Length = 879

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 79/177 (44%), Gaps = 17/177 (9%)

Query: 46  LYVGNLDTSINEEILKQYFQ--VGGPIANVKIMVDKNNSNAN----YAFVEYFQSHDANI 99
           ++V NL+ S   + L + F+   G  +A VK   D  N+N      + F E+     A  
Sbjct: 653 IFVKNLNFSTTTKELTEKFKPFSGFVVAQVKTKPDPKNANKTLSMGFGFAEFKTKEQAVA 712

Query: 100 ALQTLNGKQIENNVVKINWAFQSQQVSP------DEATFNLFVGDLNVDVDDETLRNAFK 153
            +  L+G  ++ + +++  + +    +P       +++  + V +L  + + + +   F 
Sbjct: 713 VIDALDGAVLDGHRIQLKLSHRQGSAAPTSGQSKKKSSGKIVVKNLPFEAERKQVFELFS 772

Query: 154 EFPTYLQGHV--MWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINWA 208
            F       V   +D  T   RG+ FV F   +EA+ AM+ +QG  L GR L +  A
Sbjct: 773 SFGQLKSVRVPKKFDKST---RGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHA 826

 Score = 38.5 bits (88), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 42/88 (47%), Gaps = 5/88 (5%)

Query: 128 DEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMW-----DMQTGGSRGYGFVSFGS 182
           D  T ++FV +LN     + L   FK F  ++   V       +     S G+GF  F +
Sbjct: 647 DGPTVSIFVKNLNFSTTTKELTEKFKPFSGFVVAQVKTKPDPKNANKTLSMGFGFAEFKT 706

Query: 183 QEEAQKAMDAMQGHELNGRPLRINWASK 210
           +E+A   +DA+ G  L+G  +++  + +
Sbjct: 707 KEQAVAVIDALDGAVLDGHRIQLKLSHR 734

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 35/75 (46%)

Query: 131 TFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAM 190
           T  LF+ ++     +E  +     F    + HV  D +TG S+G+ +V F + E+A  A 
Sbjct: 334 TGRLFLRNILYTATEEDFKGLLAPFGELEEVHVALDTRTGKSKGFAYVMFRNPEDAVNAY 393

Query: 191 DAMQGHELNGRPLRI 205
             +  H   GR L I
Sbjct: 394 VELDKHIFQGRLLHI 408

>TPHA0B04300 Chr2 (1005558..1006562) [1005 bp, 334 aa] {ON}
           Anc_1.102
          Length = 334

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 55/121 (45%), Gaps = 5/121 (4%)

Query: 90  EYFQSHDANIALQTLNGKQIENN--VVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDET 147
           E  + H A   +  L   +IEN    ++I     S  + P +    LFV  LN   + + 
Sbjct: 201 ELIEKHQAKSKMSLLKS-EIENQELALEIIGDIPSSTIKPLKTV--LFVCKLNAMTNAKD 257

Query: 148 LRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINW 207
           L   F  F   +   ++ D  TG S GYGF+ F S+   + A   M+G  ++ + + +++
Sbjct: 258 LAQIFSRFGQIISVEIVRDKDTGRSLGYGFIEFDSEGAVELAYSNMEGVIIDDKKIHVDF 317

Query: 208 A 208
           +
Sbjct: 318 S 318

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 56/115 (48%), Gaps = 8/115 (6%)

Query: 13  VESEVPASETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIAN 72
           ++SE+   E   E    +P++ IK  +     VL+V  L+   N + L Q F   G I +
Sbjct: 215 LKSEIENQELALEIIGDIPSSTIKPLK----TVLFVCKLNAMTNAKDLAQIFSRFGQIIS 270

Query: 73  VKIMVDKNNSNA-NYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVS 126
           V+I+ DK+   +  Y F+E+       +A   + G  I++  + +++   SQ VS
Sbjct: 271 VEIVRDKDTGRSLGYGFIEFDSEGAVELAYSNMEGVIIDDKKIHVDF---SQSVS 322

>KLTH0F13442g Chr6 (1103806..1104210) [405 bp, 134 aa] {ON} similar
           to uniprot|P40565 YIR005W Saccharomyces cerevisiae IST3
           Component of the U2 snRNP required for the first
           catalytic step of splicing and for spliceosomal assembly
          Length = 134

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 62/109 (56%), Gaps = 8/109 (7%)

Query: 100 ALQTLNGKQIENNVV--KINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPT 157
           ++Q L+ +++EN V+  K +W  + +    D+A   +++G LN ++ +  +   F ++  
Sbjct: 6   SIQNLSLRELENGVLSPKASWHHEYR----DQAY--VYIGGLNKELTEGDVLTVFSQYGV 59

Query: 158 YLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRIN 206
            +  +++ D +TG S+G+ ++ F  Q  +  A+D + G  + GR ++++
Sbjct: 60  PVDINLVRDRETGESKGFCYLKFEDQRSSILAVDNLNGAVVAGRAIKVD 108

>KAFR0I02240 Chr9 complement(459158..460426) [1269 bp, 422 aa] {ON}
           Anc_1.408 YNL004W
          Length = 422

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 75/178 (42%), Gaps = 19/178 (10%)

Query: 43  DKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQ 102
           D  ++VGNL      + L+  F   G + +  I      S      VE+  + D + A+ 
Sbjct: 127 DNSVFVGNLSFDCTGDDLRDLFSSIGRVISANIYYSHGRSKG-MGTVEFEDTADVDEAIN 185

Query: 103 TLN-----GKQI----------ENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDET 147
            LN     G+ I          +N   +       Q+  P    + +F+ +L      + 
Sbjct: 186 QLNDTMFMGRNIFLKPDSPPPNQNKFPRAQPLSHQQESLP--QGYEVFIINLPYSATWQD 243

Query: 148 LRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRI 205
           L++ F+E    L+  +  D   G SRG+G V + ++EE   A+D   G++ NGR L +
Sbjct: 244 LKDLFRESGDVLRADIELDYN-GYSRGFGNVFYATKEEMYSAIDRFNGYDWNGRILEV 300

>Ecym_5574 Chr5 complement(1175694..1178309) [2616 bp, 871 aa] {ON}
           similar to Ashbya gossypii AEL217W
          Length = 871

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 42/75 (56%)

Query: 133 NLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDA 192
           NL++  +  D+  + +   F +F T L   ++ D+ TG S GYGF+S+    +A + +  
Sbjct: 252 NLYIRGIPKDLTVDDVLPLFSKFGTVLSLKIIVDIGTGESLGYGFISYPLGSQAARCIKE 311

Query: 193 MQGHELNGRPLRINW 207
           + G+ +NG  L IN+
Sbjct: 312 LNGNLMNGSLLFINY 326

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 43/198 (21%), Positives = 76/198 (38%), Gaps = 50/198 (25%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNA-NYAFVEYFQSHDANIALQTL 104
           LY+  +   +  + +   F   G + ++KI+VD     +  Y F+ Y     A   ++ L
Sbjct: 253 LYIRGIPKDLTVDDVLPLFSKFGTVLSLKIIVDIGTGESLGYGFISYPLGSQAARCIKEL 312

Query: 105 NGKQIENNVVKINWAFQSQQV-----------SPDEATFNLFVGDLNVDVDDETLR---- 149
           NG  +  +++ IN+  + ++            + DE    +FVG+L  + +D TL     
Sbjct: 313 NGNLMNGSLLFINYHVERKERERIHLDHLKEDNDDERFRGVFVGNLPTEYEDGTLTTPEQ 372

Query: 150 --NAFKE-----------FPT--------------YLQGHVMWDMQTGGS-------RGY 175
               FKE           FP               Y       + +T  S       +GY
Sbjct: 373 VFKKFKELLDPVEILSYYFPKRNSNTNIEYKDDYDYFHAASKENAETCDSQNEDSPLKGY 432

Query: 176 GFVSFGSQEEAQKAMDAM 193
           GF+ F   E A KA++ +
Sbjct: 433 GFIKFSKHEMALKAIETL 450

 Score = 33.9 bits (76), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 29/77 (37%), Gaps = 6/77 (7%)

Query: 296 YIGNIPHFAIEADLIPLLQNFG------FIIDFKHYPEKGCCFIKYDTHEQAAVCIVALA 349
           YI  IP      D++PL   FG       I+D       G  FI Y    QAA CI  L 
Sbjct: 254 YIRGIPKDLTVDDVLPLFSKFGTVLSLKIIVDIGTGESLGYGFISYPLGSQAARCIKELN 313

Query: 350 NFPFQGRNLRTGWGKER 366
                G  L   +  ER
Sbjct: 314 GNLMNGSLLFINYHVER 330

 Score = 30.4 bits (67), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 166 DMQTGGSRGYGFVSFGSQEEAQKAMDA 192
           D+  G SRGYGFV F +  +A +AM A
Sbjct: 688 DVPIGTSRGYGFVCFKNPLDASRAMMA 714

>KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 652

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 80/170 (47%), Gaps = 30/170 (17%)

Query: 43  DKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDAN--IA 100
           ++ +Y+GNL  ++  E +    + GG + N+K++ D++       FV +     A    A
Sbjct: 471 NRTVYLGNLPKNVKLEEICNAIR-GGLLQNIKLLNDRH-----VCFVTFIDPTAAAQFYA 524

Query: 101 LQTLNGKQIENNVVKINWAFQSQQVS-------PDEATFNLFVGDLNVDVD--------- 144
           + +L+G  I N   KI W   S  +           A+ N+++G++N + D         
Sbjct: 525 MSSLHGLTIHNKRCKIGWGKHSGPLPNPIALAVSRGASRNIYLGNINFEEDAKQEESVFA 584

Query: 145 DETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQ 194
           ++TLR  F+EF T  Q + +++      +   F++F +   A  A+D ++
Sbjct: 585 EDTLRAIFEEFGTVEQINFLYE------KNCCFINFANISNAILAIDKIK 628

 Score = 37.4 bits (85), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 36/79 (45%), Gaps = 5/79 (6%)

Query: 288 APPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAV--CI 345
           AP R  T Y+GNIP       L+  ++  G + + K   EK C F+ +     A +    
Sbjct: 230 APSR--TVYLGNIPATITYKALLDYVRT-GVVEEVKILSEKMCAFVSFVDENDALLFHSD 286

Query: 346 VALANFPFQGRNLRTGWGK 364
             L      GR+++ GWGK
Sbjct: 287 AILKRLNIDGRDIKIGWGK 305

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 1/66 (1%)

Query: 306 EADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKE 365
           E  L  + + FG +       EK CCFI +     A + I  + + P    NL+  +GK+
Sbjct: 585 EDTLRAIFEEFGTVEQINFLYEKNCCFINFANISNAILAIDKIKSNP-HFNNLKINFGKD 643

Query: 366 RTSFVP 371
           R   VP
Sbjct: 644 RCGNVP 649

>TPHA0G01080 Chr7 complement(217639..218301) [663 bp, 220 aa] {ON}
           Anc_8.797 YOR319W
          Length = 220

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/184 (21%), Positives = 87/184 (47%), Gaps = 16/184 (8%)

Query: 42  SDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKN-NSNANYAFVEYFQSHDANIA 100
           S+K +YVGN+D  +  +IL + F    PI+++K   DK   +   YAF+++F   D    
Sbjct: 10  SNKTVYVGNIDPQVTLDILYELFVQVAPISSIKYPKDKVLQAYQGYAFIDFFTEDDVQYV 69

Query: 101 LQTLNGK-QIENNVVKI---NWAFQSQQVSPDEATFN----------LFVGDLNVDVDDE 146
           ++ +N   ++   ++K+   N+A  +   +    T            +F+ D++     E
Sbjct: 70  IKVMNNTVRLYGKLLKVRLSNYALSASTANASNKTETANVEILPVPKVFIKDIDSTTTTE 129

Query: 147 TLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRIN 206
           TL + FK+    L+    + +  G  R   ++   + +++ KA+  +    +  + ++++
Sbjct: 130 TLSSLFKKIGPVLKEPEFFYLSYGKLRC-AYLYMKNYDDSDKAIKILNNSLVGNKRVKVD 188

Query: 207 WASK 210
           +A K
Sbjct: 189 YAFK 192

>Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa]
           {ON} complement(185133..186905) [1773 nt, 591 aa]
          Length = 590

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 40/79 (50%), Gaps = 5/79 (6%)

Query: 288 APPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAV--CI 345
           AP R  T Y+GNIP      +L+  +++ G + D K  PEK C FI +     A +    
Sbjct: 166 APSR--TVYLGNIPTTLTVKELLDHVRS-GVVEDVKILPEKMCAFISFVDDSSALLFHSD 222

Query: 346 VALANFPFQGRNLRTGWGK 364
             L     +GR+++ GWGK
Sbjct: 223 AILKRLNIEGRDIKIGWGK 241

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 37/86 (43%), Gaps = 10/86 (11%)

Query: 295 AYIGNI---------PHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCI 345
            YIGNI              E +L  L Q +G +      P K CCFI Y     A   I
Sbjct: 502 VYIGNIDFEEDSKRNERVFTEDNLRKLFQEYGEVEQINFLPSKNCCFINYTNISNAISAI 561

Query: 346 VALANFPFQGRNLRTGWGKERTSFVP 371
             + + P+  ++L+  +GK+R   +P
Sbjct: 562 DKIKSNPY-FKDLKINFGKDRCGNIP 586

>ZYRO0G04862g Chr7 complement(387238..388368) [1131 bp, 376 aa] {ON}
           highly similar to gnl|GLV|CAGL0J11154g Candida glabrata
           CAGL0J11154g and similar to YNL175C uniprot|P53883
           Saccharomyces cerevisiae
          Length = 376

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 38/75 (50%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           LFVG+L+ D  D+ LR  F+     ++  +     +G  +G+ FV F  ++ A  A+   
Sbjct: 216 LFVGNLSFDTSDDLLRKHFQHCGDIIKVRMATFQDSGKCKGFAFVDFKEEQGATNALKDK 275

Query: 194 QGHELNGRPLRINWA 208
              ++ GR +R+ + 
Sbjct: 276 SCRKIAGRSIRMEYG 290

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 44  KVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNAN-YAFVEYFQSHDANIALQ 102
           ++L+VGNL    ++++L+++FQ  G I  V++   +++     +AFV++ +   A  AL+
Sbjct: 214 RILFVGNLSFDTSDDLLRKHFQHCGDIIKVRMATFQDSGKCKGFAFVDFKEEQGATNALK 273

Query: 103 TLNGKQIENNVVKINWA 119
             + ++I    +++ + 
Sbjct: 274 DKSCRKIAGRSIRMEYG 290

>KLLA0D11792g Chr4 (1005079..1007136) [2058 bp, 685 aa] {ON} similar
           to uniprot|P37838 Saccharomyces cerevisiae YPL043W NOP4
           Nucleolar protein essential for processing and
           maturation of 27S pre-rRNA and large ribosomal subunit
           biogenesis contains four RNA recognition motifs (RRMs),
          Length = 685

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 134 LFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAM 193
           LFV  +  +  DE   N F +F       ++ D + G SRG+GFVSF  +++ + A++  
Sbjct: 17  LFVRGVPFESTDEEFGNFFSQFSPIKHAVIVKDGE-GASRGFGFVSFAVEDDTKTALNQA 75

Query: 194 QGHELNGRPLRINWASK 210
           +  +  GR LRI+ A +
Sbjct: 76  RKTKFMGRLLRIDIAKR 92

>KAFR0A00980 Chr1 complement(182578..184506) [1929 bp, 642 aa] {ON}
           Anc_1.357 YHR015W
          Length = 642

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 45/87 (51%), Gaps = 7/87 (8%)

Query: 120 FQSQQ-VSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFV 178
           F+SQ+ V+P      LF+G L   V +  L+  F +F +     + +D +T  S GYG++
Sbjct: 88  FKSQKKVTP------LFIGGLGPHVTESMLKELFNKFSSLYSVKICYDSETKKSLGYGYL 141

Query: 179 SFGSQEEAQKAMDAMQGHELNGRPLRI 205
           +F   +E  + ++     E+ G  ++I
Sbjct: 142 NFSGSDEIDRVIEEFNYTEVFGSEIKI 168

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 29/147 (19%), Positives = 68/147 (46%), Gaps = 5/147 (3%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNA-NYAFVEYFQSHDANIALQTL 104
           L++G L   + E +LK+ F     + +VKI  D     +  Y ++ +  S + +  ++  
Sbjct: 97  LFIGGLGPHVTESMLKELFNKFSSLYSVKICYDSETKKSLGYGYLNFSGSDEIDRVIEEF 156

Query: 105 NGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVM 164
           N  ++  + +KI  + ++     +  T N+F  +L ++  + T R  +  F  Y  G ++
Sbjct: 157 NYTEVFGSEIKIMPSLRNSLYRKNIGT-NIFFSNLPLENSELTTRVFYDTFKKY--GKIL 213

Query: 165 WDMQTGGSRGYGFVSFGSQEEAQKAMD 191
              +    +  GFV +   + A++ ++
Sbjct: 214 -SCKLDHRKNIGFVYYEDDKVAREVIE 239

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 41/77 (53%), Gaps = 7/77 (9%)

Query: 46  LYVGNLDTSINEEILKQYFQVGGPIANV---KIMVDKNNSNANYAFVEYFQSHDANIALQ 102
           ++V NL     E+ +  +F V GP+ +V   K++  K    + +AF+ Y +  D   A++
Sbjct: 307 VFVKNLPIDTTEDEILDFFSVVGPVKSVFTSKVLKFK----SEWAFITYKKGSDTERAIE 362

Query: 103 TLNGKQIENNVVKINWA 119
            L+GK+ ++  + +  A
Sbjct: 363 ELDGKKYKDRKISVTKA 379

>SAKL0E10604g Chr5 (884025..884690) [666 bp, 221 aa] {ON} similar to
           uniprot|P53927 Saccharomyces cerevisiae YNL110C NOP15
           Constituent of 66S pre-ribosomal particles involved in
           60S ribosomal subunit biogenesis localizes to both
           nucleolus and cytoplasm
          Length = 221

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 48/86 (55%), Gaps = 4/86 (4%)

Query: 35  IKGGRETSDK---VLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNA-NYAFVE 90
           ++GG E++ +   ++YV  L    +E  L +YF   G +  V++  +K   N+ +YAF+E
Sbjct: 80  VEGGNESNKEQSSIIYVSRLPQGFHERELSKYFSQFGDLKQVRLARNKKTGNSRHYAFIE 139

Query: 91  YFQSHDANIALQTLNGKQIENNVVKI 116
           +    DA +A  T+N   I  +++K+
Sbjct: 140 FVNKDDALVAQDTMNNYLILGHLLKV 165

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 38/80 (47%)

Query: 126 SPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEE 185
           S  E +  ++V  L     +  L   F +F    Q  +  + +TG SR Y F+ F ++++
Sbjct: 86  SNKEQSSIIYVSRLPQGFHERELSKYFSQFGDLKQVRLARNKKTGNSRHYAFIEFVNKDD 145

Query: 186 AQKAMDAMQGHELNGRPLRI 205
           A  A D M  + + G  L++
Sbjct: 146 ALVAQDTMNNYLILGHLLKV 165

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,598,518
Number of extensions: 1462626
Number of successful extensions: 6684
Number of sequences better than 10.0: 653
Number of HSP's gapped: 6202
Number of HSP's successfully gapped: 1360
Length of query: 402
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 290
Effective length of database: 40,638,807
Effective search space: 11785254030
Effective search space used: 11785254030
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)