Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G022302.293ON48848825100.0
ZYRO0A02024g2.293ON48648218430.0
Skud_9.832.293ON49148817310.0
Smik_9.892.293ON49148817310.0
YIL090W (ICE2)2.293ON49148817090.0
Suva_9.1092.293ON49148817040.0
NCAS0B062202.293ON48648316700.0
NDAI0B035202.293ON50149216330.0
CAGL0D04202g2.293ON49949815930.0
SAKL0E07524g2.293ON47948715810.0
KAFR0J013302.293ON49148815790.0
KNAG0A053902.293ON49748715750.0
Kpol_1003.422.293ON49049014670.0
KLTH0G10516g2.293ON47448214410.0
Kwal_27.115002.293ON47548514340.0
ADL208W2.293ON50251012361e-166
Ecym_33322.293ON51351712331e-165
KLLA0E08207g2.293ON48648812091e-162
TBLA0B069902.293ON53653511831e-158
TBLA0B059802.293ON49349911761e-157
TPHA0C034402.293ON57955211561e-153
SAKL0F00748g3.569ON707106706.3
YLR171WsingletonOFF12993658.8
TBLA0B01730singletonON355204679.8
Kpol_1039.412.268ON65675689.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G02230
         (488 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.2...   971   0.0  
ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} simila...   714   0.0  
Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W (...   671   0.0  
Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W (...   671   0.0  
YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integr...   662   0.0  
Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W ...   660   0.0  
NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa] ...   647   0.0  
NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {O...   633   0.0  
CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} simila...   618   0.0  
SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {...   613   0.0  
KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {...   612   0.0  
KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {O...   611   0.0  
Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON} (1007...   569   0.0  
KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} simila...   559   0.0  
Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {...   556   0.0  
ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic ho...   480   e-166
Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar t...   479   e-165
KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {...   470   e-162
TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON}            460   e-158
TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON} Anc_2...   457   e-157
TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.2...   449   e-153
SAKL0F00748g Chr6 (64800..66923) [2124 bp, 707 aa] {ON} highly s...    32   6.3  
YLR171W Chr12 (500733..501122) [390 bp, 129 aa] {OFF} Dubious op...    30   8.8  
TBLA0B01730 Chr2 complement(385644..386711) [1068 bp, 355 aa] {O...    30   9.8  
Kpol_1039.41 s1039 complement(126117..128087) [1971 bp, 656 aa] ...    31   9.8  

>TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.293
           YIL090W
          Length = 488

 Score =  971 bits (2510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/488 (98%), Positives = 481/488 (98%)

Query: 1   MTTISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMV 60
           MTTISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMV
Sbjct: 1   MTTISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMV 60

Query: 61  AQSYGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPEQSLVNVLRN 120
           AQSYGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPEQSLVNVLRN
Sbjct: 61  AQSYGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPEQSLVNVLRN 120

Query: 121 NVFSNHSSWMLXXXXXXXVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDEM 180
           NVFSNHSSWML       VVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDEM
Sbjct: 121 NVFSNHSSWMLYYYYYRYVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDEM 180

Query: 181 NSNTWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLFGIVS 240
           NSNTWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLFGIVS
Sbjct: 181 NSNTWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLFGIVS 240

Query: 241 KNGSVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYYQ 300
           KNGSVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYYQ
Sbjct: 241 KNGSVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYYQ 300

Query: 301 DVVLKNAEMVWESIVLRTKNSDATTFTAIQPLNKLWHAFTPIWKFFKGFVLSVPSSIGGV 360
           DVVLKNAEMVWESIVLRTKNSDATTFTAIQPLNKLWHAFTPIWKFFKGFVLSVPSSIGGV
Sbjct: 301 DVVLKNAEMVWESIVLRTKNSDATTFTAIQPLNKLWHAFTPIWKFFKGFVLSVPSSIGGV 360

Query: 361 FQVTLKLASESVSPAIVLNLCFRVLVFYSATRIIPALQRKNTRELRKSRRIMNVLYWYSP 420
           FQVTLKLASESVSPAIVLNLCFRVLVFYSATRIIPALQRKNTRELRKSRRIMNVLYWYSP
Sbjct: 361 FQVTLKLASESVSPAIVLNLCFRVLVFYSATRIIPALQRKNTRELRKSRRIMNVLYWYSP 420

Query: 421 CILIAMYTHLILQYSGELNSDLCLWGCSEKWFGSGQPKIEINTWVFWNWCNIFWTVLIYG 480
           CILIAMYTHLILQYSGELNSDLCLWGCSEKWFGSGQPKIEINTWVFWNWCNIFWTVLIYG
Sbjct: 421 CILIAMYTHLILQYSGELNSDLCLWGCSEKWFGSGQPKIEINTWVFWNWCNIFWTVLIYG 480

Query: 481 SELIGGKR 488
           SELIGGKR
Sbjct: 481 SELIGGKR 488

>ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 486

 Score =  714 bits (1843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/482 (72%), Positives = 406/482 (84%), Gaps = 2/482 (0%)

Query: 9   LQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMVAQSYGNKC 68
           +Q  R+ LA FYLLS L+TIPISFKVGGLYCGLSFTVTLFNLY ++TTLS+  + Y ++ 
Sbjct: 5   VQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASRF 64

Query: 69  YIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPEQSLVNVLRNNVFSNHSS 128
           Y+  T  IYY QH +IASLLYLFLSGFSNEELTK+LE GSQPEQSL+ VL++N FS HS+
Sbjct: 65  YVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPEQSLLEVLKSNPFSAHSN 124

Query: 129 WMLXXXXXXXVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDEMNSNTWIIA 188
           W+L       +VQPWQ +L+HSTAFF+LSEGFFT+L IQA+GE++RWLL E+NSN W I 
Sbjct: 125 WILYYYYYCYIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSNIWNIT 184

Query: 189 SLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLFGIVSKNGSVIES 248
           SLL SGGVITA+LYYLYRIYVTP+W LS+QTASLLGFTLS+VCG+GL+GIVSKNGSVIES
Sbjct: 185 SLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNGSVIES 244

Query: 249 SLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYYQDVVLKNAE 308
           SLFFAYIVRCIYEISPKLATTATDEILE+ K AWQKHQ+N S+TNNLLSYY DVVL +AE
Sbjct: 245 SLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVVLDSAE 304

Query: 309 MVWESIVLRT-KNSDATTFTAI-QPLNKLWHAFTPIWKFFKGFVLSVPSSIGGVFQVTLK 366
           M+WESIV +T   SD    T++  PL K    F P+  FFK F +SVPSSI G+FQVTLK
Sbjct: 305 MMWESIVSKTVTTSDPFYHTSMFPPLRKFTDIFKPVGIFFKNFTISVPSSIEGLFQVTLK 364

Query: 367 LASESVSPAIVLNLCFRVLVFYSATRIIPALQRKNTRELRKSRRIMNVLYWYSPCILIAM 426
           +AS+SVSPAIV+NL FRVL+FYSAT+IIPALQ K  R+L KSRRIMNVLYWYSPCILIAM
Sbjct: 365 MASDSVSPAIVVNLFFRVLIFYSATKIIPALQGKGDRQLNKSRRIMNVLYWYSPCILIAM 424

Query: 427 YTHLILQYSGELNSDLCLWGCSEKWFGSGQPKIEINTWVFWNWCNIFWTVLIYGSELIGG 486
           YTHLILQYSGELN DLCLWGC+  WF   Q KI +++W FWNWCNIFWT+L+YGSELIGG
Sbjct: 425 YTHLILQYSGELNRDLCLWGCNSMWFSLNQTKIVVDSWGFWNWCNIFWTILVYGSELIGG 484

Query: 487 KR 488
           K+
Sbjct: 485 KK 486

>Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/488 (67%), Positives = 393/488 (80%), Gaps = 3/488 (0%)

Query: 1   MTTISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMV 60
           MT++SKSF+Q  R+  A FYLL TL++IPISFKVGGL CGLSFTVTLF LY ITTTL+++
Sbjct: 1   MTSLSKSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVL 60

Query: 61  AQSYGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPEQSLVNVLRN 120
           A+ +G K YI  T  +YY QHF+IASLLYLFLSGFSN+EL  VL++ S   +S ++ L++
Sbjct: 61  AKRHGGKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRSNESESFLDALKD 120

Query: 121 NVFSNHSSWMLXXXXXXXVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDEM 180
           ++ SN  +++L       VVQPWQ VLT ST FF LSEGFFT+L IQA+GETNRWL +++
Sbjct: 121 SLNSNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180

Query: 181 NSNTWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLFGIVS 240
           NSNTWII+SLL SGGVITASLYYLYRIYVTPIW LS+QTASLLGF LS+VCG+GL+GIVS
Sbjct: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240

Query: 241 KNGSVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYYQ 300
           + GSVIESSLFFAYIVRCIYEISPKLATTATDEIL++ K  WQKHQ+NL T +NLL Y+ 
Sbjct: 241 QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300

Query: 301 DVVLKNAEMVWESIVLRTKNSDA---TTFTAIQPLNKLWHAFTPIWKFFKGFVLSVPSSI 357
           +VVLKNAEM+W S + R +           +I    K+     P WKFFK F  SVP SI
Sbjct: 301 NVVLKNAEMLWGSFIPRGRKKTGDFHDKIISILSFEKVSLISRPFWKFFKNFTFSVPLSI 360

Query: 358 GGVFQVTLKLASESVSPAIVLNLCFRVLVFYSATRIIPALQRKNTRELRKSRRIMNVLYW 417
               QVT+K+ASESVSPAIV+NLCFRVL+FYSATRIIPALQRKN ++LRKSRRIM  LYW
Sbjct: 361 NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMRGLYW 420

Query: 418 YSPCILIAMYTHLILQYSGELNSDLCLWGCSEKWFGSGQPKIEINTWVFWNWCNIFWTVL 477
           YSPCILIAMYTHLILQYSGEL  DLC+WGCSEKWFG+ QP+I +++W FWNWCNIF T+L
Sbjct: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGAEQPEIIVDSWGFWNWCNIFCTIL 480

Query: 478 IYGSELIG 485
           +Y +ELIG
Sbjct: 481 VYATELIG 488

>Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/488 (67%), Positives = 391/488 (80%), Gaps = 3/488 (0%)

Query: 1   MTTISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMV 60
           MT++SKSF+Q  R+  A FYLL TL++IPISFKVGGL CGLSFTVTLF LY ITTTL+++
Sbjct: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVL 60

Query: 61  AQSYGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPEQSLVNVLRN 120
           A+ YG K YI  T+ +YY QHF+IASLLYLFLSGFSN+EL  VL+      +S +  L+N
Sbjct: 61  ARRYGGKLYIFLTSCLYYSQHFIIASLLYLFLSGFSNDELGNVLKKRPNESESFLEALKN 120

Query: 121 NVFSNHSSWMLXXXXXXXVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDEM 180
           ++ SN  +++L       VVQPWQ +LT ST FF LSEGFFT+L IQA+GETNRWL +++
Sbjct: 121 SLNSNQINYVLYYYYFRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180

Query: 181 NSNTWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLFGIVS 240
           NSNTWII+SLL SGGVITASLYYLYRIYVTPIW LS+QTASLLGF LS+VCG+GL+GIVS
Sbjct: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240

Query: 241 KNGSVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYYQ 300
           + GSVIESSLFFAYIVRCIYEISPKLATTATDEIL++ K  WQKHQ+NL T +NLL Y+ 
Sbjct: 241 QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300

Query: 301 DVVLKNAEMVWESIVLRTKNSDA---TTFTAIQPLNKLWHAFTPIWKFFKGFVLSVPSSI 357
           +V+LKNAEM+W S + R +           ++    K+     P WKFFK F  SVP SI
Sbjct: 301 NVILKNAEMLWGSFIPRGRKKTGDFHDKLISVLSFEKVSLISKPFWKFFKNFTFSVPLSI 360

Query: 358 GGVFQVTLKLASESVSPAIVLNLCFRVLVFYSATRIIPALQRKNTRELRKSRRIMNVLYW 417
               QVT+K+ASESVSPAIV+NLCFRVL+FYSATRIIPALQRKN ++LRKSRRIM  LYW
Sbjct: 361 NEFCQVTIKMASESVSPAIVVNLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYW 420

Query: 418 YSPCILIAMYTHLILQYSGELNSDLCLWGCSEKWFGSGQPKIEINTWVFWNWCNIFWTVL 477
           YSPCILIAMYTHLILQYSGEL  DLC+WGCSEKWFGS QP+I +++W FWNWCNIF T+L
Sbjct: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGSDQPEIIVDSWGFWNWCNIFCTIL 480

Query: 478 IYGSELIG 485
           +Y +ELIG
Sbjct: 481 VYATELIG 488

>YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integral
           ER membrane protein with type-III transmembrane domains;
           required for ER zinc homeostasis; mutations cause
           defects in cortical ER morphology in both the mother and
           daughter cells
          Length = 491

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/488 (67%), Positives = 389/488 (79%), Gaps = 3/488 (0%)

Query: 1   MTTISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMV 60
           MT++SKSF+Q  R+  A FYLL TL++IPISFKVGGL CGLSFTVTLF LY ITTTL+++
Sbjct: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVL 60

Query: 61  AQSYGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPEQSLVNVLRN 120
           A+ +G + YI  T  +YY QHF+IASLLYLFLSGFSN+EL  VL++     +S +  L+N
Sbjct: 61  ARRHGGRLYIFFTNCLYYSQHFIIASLLYLFLSGFSNDELGNVLKNKYNESESFLEALKN 120

Query: 121 NVFSNHSSWMLXXXXXXXVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDEM 180
           ++ SN  +++L       VVQPWQ VLT ST FF LSEGFFT+L IQA+GETNRWL +++
Sbjct: 121 SLNSNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180

Query: 181 NSNTWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLFGIVS 240
           NSNTWII+SLLTSGGVITASLYYLYRIYVTPIW LS+QTASLLG  LS+VCG+GL+GIVS
Sbjct: 181 NSNTWIISSLLTSGGVITASLYYLYRIYVTPIWPLSIQTASLLGLVLSMVCGLGLYGIVS 240

Query: 241 KNGSVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYYQ 300
           + GSVIESSLFFAYIVRCIYEISPKLATTATDEIL + K  WQKHQ+NL T +NLL Y+ 
Sbjct: 241 QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILNLFKDVWQKHQRNLPTADNLLCYFH 300

Query: 301 DVVLKNAEMVWESIVLRTKNSDA---TTFTAIQPLNKLWHAFTPIWKFFKGFVLSVPSSI 357
           +V+LKNAE++W S + R +           +I    K+     P WKFFK F  SVP SI
Sbjct: 301 NVILKNAEVLWGSFIPRGRKKTGDFHDKLISILSFEKVSLISKPFWKFFKNFTFSVPLSI 360

Query: 358 GGVFQVTLKLASESVSPAIVLNLCFRVLVFYSATRIIPALQRKNTRELRKSRRIMNVLYW 417
               QVT+K+ASESVSPAIV+NLCFRVL+FYSATRIIPALQRKN ++LRKSRRIM  LYW
Sbjct: 361 NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYW 420

Query: 418 YSPCILIAMYTHLILQYSGELNSDLCLWGCSEKWFGSGQPKIEINTWVFWNWCNIFWTVL 477
           YSPCILIAMYTHLILQYSGEL  DLC+WGCSEKWFG  QP+I +++W FWNWCNIF T+L
Sbjct: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGVDQPEIIVDSWGFWNWCNIFCTIL 480

Query: 478 IYGSELIG 485
           +Y +ELIG
Sbjct: 481 VYATELIG 488

>Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/488 (66%), Positives = 392/488 (80%), Gaps = 3/488 (0%)

Query: 1   MTTISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMV 60
           MT++SKSF+Q  R+  A FYLL TL++IPISFKVGGL CGLSFTVTLF LY ITTTL+++
Sbjct: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVL 60

Query: 61  AQSYGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPEQSLVNVLRN 120
           A+  G + YI  T+ +YY QHF+IASLL+LFLSGFSN+EL  VL++ S   +S +  L+N
Sbjct: 61  ARRNGGRLYIFLTSCLYYSQHFVIASLLFLFLSGFSNDELGNVLKNRSNESESFLEALKN 120

Query: 121 NVFSNHSSWMLXXXXXXXVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDEM 180
           ++ SN  +++L       VVQPWQ +LT ST FF LSEGFFT+L IQA+GETNRWL +++
Sbjct: 121 SLNSNQINYVLYYYYYRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180

Query: 181 NSNTWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLFGIVS 240
           NSNTWII+SLL SGGVITASLYYLYRIYVTPIW LS+QTASLLGF LS+VCG+GL+GIVS
Sbjct: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240

Query: 241 KNGSVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYYQ 300
           + GSVIESSLFFAYIVRCIYEISPKLATTATDEIL++ K  WQKHQ+NL T +NLL Y+ 
Sbjct: 241 QRGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300

Query: 301 DVVLKNAEMVWESIVLRTKNSDAT---TFTAIQPLNKLWHAFTPIWKFFKGFVLSVPSSI 357
           +V+LKNAE++W S + R + + +       +I    K+     P W+F K F  SVP SI
Sbjct: 301 NVILKNAEVLWGSFIPRRRKTTSDLHEKIISILSFEKVSLISKPFWRFCKNFTFSVPLSI 360

Query: 358 GGVFQVTLKLASESVSPAIVLNLCFRVLVFYSATRIIPALQRKNTRELRKSRRIMNVLYW 417
               QVT+K+ASESVSPAIV+NLCFRVL+FYSATRIIPALQRKN ++LRKSRRIM  LYW
Sbjct: 361 NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYW 420

Query: 418 YSPCILIAMYTHLILQYSGELNSDLCLWGCSEKWFGSGQPKIEINTWVFWNWCNIFWTVL 477
           YSPCILIAMYTHLILQYSGEL  DLC+WGCSEKWFG  QP+I +++W FWNWCNIF T+L
Sbjct: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGPDQPEIIVDSWGFWNWCNIFCTIL 480

Query: 478 IYGSELIG 485
           +Y +EL+G
Sbjct: 481 VYATELVG 488

>NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa]
           {ON} Anc_2.293 YIL090W
          Length = 486

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/483 (65%), Positives = 392/483 (81%), Gaps = 6/483 (1%)

Query: 4   ISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMVAQS 63
           IS SF++G R+  A FYLL TL++IPISFK+GGL+CGL+FTV+LF LY ++TTLS+ A+ 
Sbjct: 2   ISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWARK 61

Query: 64  YGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPEQSLVNVLRNNVF 123
           YG++ +I+ T  +YY QHF+IASLLYLFLSGFSNE+L+ +L DG++P  S+ ++ + NV 
Sbjct: 62  YGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNVA 121

Query: 124 SN-HSSWMLXXXXXXXVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDEMNS 182
           S+  ++W+L        VQPWQ +L++ST FF LSEGFFT+L IQAIGETN+WL+ E+NS
Sbjct: 122 SSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEINS 181

Query: 183 NTWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLFGIVSKN 242
           NTW+I+SLL SGGVITASLYYLYRIYVTPIW LSVQTASLLGFTLS+V G+G++GIV+  
Sbjct: 182 NTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTDK 241

Query: 243 GSVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYYQDV 302
           GSVIESS+FFAYIVRCIYEISPKLATTAT+EILEV K  WQ+HQ NL++ NNLLSYY +V
Sbjct: 242 GSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHNV 301

Query: 303 VLKNAEMVWESIVLRTKNSDATTFTAIQPLNKLWHAFTPIWKFFKGFVLSVPSSIGGVFQ 362
           VLKN E +WES  +   NS  T+F+      ++   F PIWK  K F ++VPSSI  +  
Sbjct: 302 VLKNIETIWESFKIN-DNSFITSFST----ERVITIFMPIWKLLKTFTITVPSSINELCF 356

Query: 363 VTLKLASESVSPAIVLNLCFRVLVFYSATRIIPALQRKNTRELRKSRRIMNVLYWYSPCI 422
           VT K+A ES+SPA+++NLCFRVL+FYSATRIIPALQR++  ELRKSRRIM VLYWYSPCI
Sbjct: 357 VTYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYSPCI 416

Query: 423 LIAMYTHLILQYSGELNSDLCLWGCSEKWFGSGQPKIEINTWVFWNWCNIFWTVLIYGSE 482
           LIAMY HLILQYSGEL  +LCLWGC+ K F S QPKI +++W FWNWCNIF+T+L+Y SE
Sbjct: 417 LIAMYAHLILQYSGELKDELCLWGCNSKIFPSDQPKIIVDSWGFWNWCNIFFTILVYASE 476

Query: 483 LIG 485
           LIG
Sbjct: 477 LIG 479

>NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {ON}
           Anc_2.293 YIL090W
          Length = 501

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/492 (62%), Positives = 382/492 (77%), Gaps = 10/492 (2%)

Query: 4   ISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMVAQS 63
           IS SF++G R   A FYLL TL++IPISFK+GGL CGL+FT TLF +Y ++TTLS++A+ 
Sbjct: 2   ISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLARK 61

Query: 64  YGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPEQSLVNVLRNNVF 123
           YG+   I  T F+YY QH +IASLLYLFLSGFS+E+LT  L D +Q    + +V+R N+ 
Sbjct: 62  YGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNLS 121

Query: 124 SNHSSWMLXXXXXXXVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDEMNSN 183
           S +S+W L        VQPW+ +L++ST FF LSEGFFT+L IQA+GETN+WL++E+NSN
Sbjct: 122 STNSNWNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGETNKWLVNEINSN 181

Query: 184 TWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLFGIVSKNG 243
           TWII+SLLTSGGVITASLYYLYRIYVTPIW LS+QTASLLGFTLS+V G+GL+GIV++ G
Sbjct: 182 TWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGGLGLYGIVTEKG 241

Query: 244 SVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYYQDVV 303
           SVIESSLFFAYIVRCIYEISPKLATTATDEILE+ K  WQ+HQ NL TT+NLL YY + V
Sbjct: 242 SVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTTDNLLFYYNNFV 301

Query: 304 LKNAEMVWESIVLRTKNSDATT----------FTAIQPLNKLWHAFTPIWKFFKGFVLSV 353
           L++ +M+WE +V +   +D              T     + L     PIWK FK F +SV
Sbjct: 302 LRHIDMLWELLVSKINQNDPNNTLPSSFNINFLTTFLSKDLLLRICKPIWKLFKNFTVSV 361

Query: 354 PSSIGGVFQVTLKLASESVSPAIVLNLCFRVLVFYSATRIIPALQRKNTRELRKSRRIMN 413
           PSSI  +  VT ++A ESVSPA+V+NLCFRVL+FYSATRIIPALQR+N  EL+KSRRIM 
Sbjct: 362 PSSISELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRRNDSELKKSRRIMK 421

Query: 414 VLYWYSPCILIAMYTHLILQYSGELNSDLCLWGCSEKWFGSGQPKIEINTWVFWNWCNIF 473
           +LYWYSPC+LIAMYTHLILQYSGEL  DLCLWGC+ KW    QP++ +++W FWNWCNIF
Sbjct: 422 ILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGCNLKWLIPNQPELIVDSWGFWNWCNIF 481

Query: 474 WTVLIYGSELIG 485
           +T++IY SEL G
Sbjct: 482 FTIIIYASELFG 493

>CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090w
          Length = 499

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/498 (61%), Positives = 383/498 (76%), Gaps = 16/498 (3%)

Query: 1   MTTISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMV 60
           M  I++   +  R++ A  YL+ TLV+IPISFK+GGL CGLSFTVTLFNLYLI+TTLS++
Sbjct: 1   MGLITEGVQRSIRISSAALYLVLTLVSIPISFKIGGLQCGLSFTVTLFNLYLISTTLSVL 60

Query: 61  AQSYGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLED-GS----QPEQSLV 115
           A+   N+ Y+  T+ +YY QH +IA LL+LFLSGFSNEE  + L   GS     P+ S +
Sbjct: 61  ARRSCNRGYVFATSILYYSQHLVIAPLLFLFLSGFSNEEFNRFLSPVGSYQELDPDGSFL 120

Query: 116 NVLRNNVF-----SNHSSWMLXXXXXXXVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIG 170
           ++L++ +       N  +W L       +VQPWQ +L++ST FF L EGFFT+L IQAIG
Sbjct: 121 DLLKHRILMATTAENSKNWTLYYYYFKFIVQPWQWLLSYSTPFFTLLEGFFTILAIQAIG 180

Query: 171 ETNRWLLDEMNSNTWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIV 230
           ETN+WL  EMNSNTWII SLL SGGVIT SLYYLYRIYVTPIW L++Q+ASLLGF LSIV
Sbjct: 181 ETNKWLSYEMNSNTWIITSLLVSGGVITGSLYYLYRIYVTPIWKLTIQSASLLGFVLSIV 240

Query: 231 CGIGLFGIVSKNGSVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLS 290
             +GL+GI+S+ GSVIESSLFFAYIVRCIYEISPKLAT AT+EIL+++K  WQ HQ+NL 
Sbjct: 241 FCLGLYGIISRKGSVIESSLFFAYIVRCIYEISPKLATRATEEILDLVKDVWQTHQRNLL 300

Query: 291 TTNNLLSYYQDVVLKNAEMVWESIVLRTKNSDATTFTAIQPLNKLWHAFTPIWKFFKGFV 350
             +NLL+YY +VVLKNAEMVWES +L    S      A++ + + W   TP+WKFFK F 
Sbjct: 301 NRDNLLAYYHNVVLKNAEMVWESFILPRSRS----LNAMEKI-RFWLDVTPVWKFFKNFT 355

Query: 351 LSVPSSIGGVFQVTLKLASESVSPAIVLNLCFRVLVFYSATRIIPALQRKNTRELRKSRR 410
           +SVPSSI  +  VT K+ASES+SPA+++NLCFR+L+FYSATRIIPALQR + +E R+SRR
Sbjct: 356 VSVPSSIVELVSVTYKMASESLSPAVIVNLCFRILIFYSATRIIPALQRSSYKEQRQSRR 415

Query: 411 IMNVLYWYSPCILIAMYTHLILQYSGELNSDLCLWGCSEKWFGS-GQPKIEINTWVFWNW 469
           I+ +LYWYSPC+LIAMYTHLILQYSGEL  +LCLWGC+  WFGS  QP+I  ++W FWNW
Sbjct: 416 ILKLLYWYSPCVLIAMYTHLILQYSGELKRELCLWGCTSNWFGSKDQPRIVTDSWSFWNW 475

Query: 470 CNIFWTVLIYGSELIGGK 487
           CNIFWTVL+Y +ELIG +
Sbjct: 476 CNIFWTVLVYANELIGTQ 493

>SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 479

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/487 (63%), Positives = 377/487 (77%), Gaps = 14/487 (2%)

Query: 4   ISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMVAQS 63
           + +S +Q  R  L  FYLL  L+TIPISF+VGGLYCGLSFTVTLFNLY +TTTL +V++ 
Sbjct: 2   LPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSFTVTLFNLYFLTTTLKIVSKK 61

Query: 64  YGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLE-DGSQPEQSLVNVLRNNV 122
           Y N+ Y   T+F+YYLQHF+I SLL+LFLSGF+N+EL + ++ D + P +SLVN LRN  
Sbjct: 62  Y-NRLYYSITSFVYYLQHFIIPSLLFLFLSGFNNDELKRQIDGDVNLPRESLVNFLRNK- 119

Query: 123 FSNHSSWMLXXXXXXXVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDEMNS 182
            S   SW+         V+PWQ VL HST +F L EGFFTVLGIQAIGETN+WL    NS
Sbjct: 120 -SGKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKNS 178

Query: 183 NTWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLFGIVSKN 242
           NTWII SLL SGGVIT SLYYLYRIYVTP+W LS+QTASLLGFTLSIVCG+GL+GIVS  
Sbjct: 179 NTWIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSGK 238

Query: 243 GSVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYYQDV 302
           GSVIESSLFFAYIVRCIYEISP+LAT+A DEI +++K  WQKHQ NL  T+NLLSYY++V
Sbjct: 239 GSVIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLP-TDNLLSYYRNV 297

Query: 303 VLKNAEMVWESIVLRTKNSDATTFTAIQPLNKLWHAFTPIWKFFKGFVLSVPSSIGGVFQ 362
           VLKN EM+W++IV +T  +  +T   +      W    P+WKF K F +SVPSSI  +F+
Sbjct: 298 VLKNGEMIWDAIVQKTGTTSPSTTQMV------WLRLQPLWKFTKNFTISVPSSIREIFR 351

Query: 363 VTLKLASESVSPAIVLNLCFRVLVFYSATRIIPALQRKNTRELRKSRRIMNVLYWYSPCI 422
           VTLK+A+ESV+P +V+NL FR+LVFYSATRIIPALQ+ ++   + SRR+M ++YWYSPCI
Sbjct: 352 VTLKMATESVTPTVVINLVFRILVFYSATRIIPALQKDDSNGRKSSRRLMRLIYWYSPCI 411

Query: 423 LIAMYTHLILQYSGELNSDLCLWGCSEKWFGSGQP--KIEINTWVFWNWCNIFWTVLIYG 480
           +IAMYTHLILQYSGELN+DLCLWGC   W  +  P  K+ ++ W FWNWCN+F T+ IYG
Sbjct: 412 VIAMYTHLILQYSGELNNDLCLWGCFP-WSHTNDPSSKVVVDAWGFWNWCNVFCTLAIYG 470

Query: 481 SELIGGK 487
            ELIGGK
Sbjct: 471 LELIGGK 477

>KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {ON}
           Anc_2.293 YIL090W
          Length = 491

 Score =  612 bits (1579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/488 (61%), Positives = 375/488 (76%), Gaps = 5/488 (1%)

Query: 1   MTTISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMV 60
           MT +SKS ++G R+    FYLL TL++IP+SFK+GG++CGLSFTVTLF  Y ++TTLS++
Sbjct: 1   MTLLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSIL 60

Query: 61  AQSYGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPEQSLVNVLRN 120
           A+  G++ YIV T+ IYY QH +IASLLY FLSGFSN+EL +VL+DG++  + LV     
Sbjct: 61  ARQSGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDGTEKIEVLVA--NQ 118

Query: 121 NVFSNHSSWMLXXXXXXXVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDEM 180
           ++  + S+W+L       VV+PW+ VL++ST FFAL+EGFFT+L IQAIGETNRWL DE 
Sbjct: 119 DLMVSESNWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDEK 178

Query: 181 NSNTWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLFGIVS 240
           NSN+WII+SLL S GV+TASLYYLYRIYVTPIW LS QTA+LLG  LS+  G+G+ GI+S
Sbjct: 179 NSNSWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGIIS 238

Query: 241 KNGSVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYYQ 300
           + GSV+ESSLFFAYIVRCIYEISPKLATTATDEILE+ K  WQ+HQ  L  T+N+L+YY+
Sbjct: 239 ERGSVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYYR 298

Query: 301 DVVLKNAEMVWESIVLRTKNSDATTFTAIQPLNKLWHAFTPIWKFFKGFVLSVPSSIGGV 360
            V+LKN EM+WE+ + +TK     T  +       W  F P+WKFFK F +SVP SI  +
Sbjct: 299 SVILKNTEMIWEAFLSKTKQHSNHTLNSFFTAENFWIHFNPLWKFFKNFTISVPFSISEL 358

Query: 361 FQVTLKLASESVSPAIVLNLCFRVLVFYSATRIIPALQRKNTRELRKSRRIMNVLYWYSP 420
             + L++ASES+SPA+V+NLCFRVL+FYSATRIIP+LQRK  R+ RKSRRIM VLYWYSP
Sbjct: 359 SGMMLQMASESISPAVVVNLCFRVLIFYSATRIIPSLQRKEVRDSRKSRRIMKVLYWYSP 418

Query: 421 CILIAMYTHLILQYSGELNSDLCLWGCSEK---WFGSGQPKIEINTWVFWNWCNIFWTVL 477
           CILIAMYTHLILQYSGEL  +L LWG   K        +  I +++W FWNWCNIFWT+L
Sbjct: 419 CILIAMYTHLILQYSGELKRELYLWGPDSKLSFLVDKEENNIVVDSWSFWNWCNIFWTIL 478

Query: 478 IYGSELIG 485
           IYG EL G
Sbjct: 479 IYGGELFG 486

>KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {ON}
           Anc_2.293 YIL090W
          Length = 497

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/487 (60%), Positives = 374/487 (76%), Gaps = 3/487 (0%)

Query: 3   TISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMVAQ 62
           T++  F++G R+     YLL TL++IPISFKVGGLYCGL+FT TLF LY ++TTLS++A+
Sbjct: 4   TLTSGFIRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIAR 63

Query: 63  SYGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPEQSLVNVLRNNV 122
             GN+ YIV ++ +YY QHF+IASLL+LFLSGFSN EL K++E+ + P +SL ++L  ++
Sbjct: 64  KNGNRIYIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIENDAIPIESLTSILNVSM 123

Query: 123 FSNHSSWMLXXXXXXXVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDEMNS 182
            S+ ++W+        VV PW+ VL+HST FF LSEGFFT+L IQAIGETN+WL  E NS
Sbjct: 124 SSSEANWIFYYYYYKYVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYEKNS 183

Query: 183 NTWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLFGIVSKN 242
           N WII+SLLTS  VI+A+LYYLYRIYVTPIW L+VQTASLLGF LS+V G+G++GIVS +
Sbjct: 184 NAWIISSLLTSSAVISAALYYLYRIYVTPIWELTVQTASLLGFVLSLVSGLGIYGIVSDS 243

Query: 243 GSVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYYQDV 302
           GSVIESSLFFAYIVRCIYEISPKLATTATDE+LE+ K  WQK Q NL   NNL+ YY +V
Sbjct: 244 GSVIESSLFFAYIVRCIYEISPKLATTATDELLELFKDVWQKRQGNLPIRNNLIFYYNNV 303

Query: 303 VLKNAEMVWESIVLRTKNSDATTFTAIQPLNKLWHAFTPIWKFFKGFVLSVPSSIGGVFQ 362
           +LKN EM W++ +LRT  S    +     LN  W    PIWKFFK F LSVP SI  +  
Sbjct: 304 ILKNIEMAWDNFILRTGTSGTFNYNPSLLLNNTWKFCKPIWKFFKNFTLSVPFSIREILL 363

Query: 363 VTLKLASESVSPAIVLNLCFRVLVFYSATRIIPALQRKNTRELRKSRRIMNVLYWYSPCI 422
           +T K++ ESVSPA+V+NLCFR+L+FYSATRI+P+LQRK+ RE R+SR++M ++YWYSPCI
Sbjct: 364 MTWKMSLESVSPAVVINLCFRILIFYSATRIVPSLQRKDAREQRRSRKVMELVYWYSPCI 423

Query: 423 LIAMYTHLILQYSGELNSDLCLWGCSEKWFGSGQPKIE---INTWVFWNWCNIFWTVLIY 479
           LIAMY HLILQYS EL ++LCLWGC+    G    + E   ++ W FWNWCN+F T+L+Y
Sbjct: 424 LIAMYAHLILQYSSELKNELCLWGCNNILLGYNTDQNETVVVDAWRFWNWCNVFCTILVY 483

Query: 480 GSELIGG 486
            +ELIG 
Sbjct: 484 ANELIGD 490

>Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON}
           (100704..102176) [1473 nt, 491 aa]
          Length = 490

 Score =  569 bits (1467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/490 (56%), Positives = 357/490 (72%), Gaps = 2/490 (0%)

Query: 1   MTTISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMV 60
           M  + K+ ++  ++ L  FYLL+ + TIPISFK+GGLYCGL+FTVTLF LY  +TTL+++
Sbjct: 1   MRRVLKNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGLTFTVTLFYLYFTSTTLNII 60

Query: 61  AQSYGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPEQSLVNVLRN 120
           A+ +G+K  I+ T+  +Y Q+F+I SLL+LFL+GF+NE+L K +  G QP+++ +++LR 
Sbjct: 61  ARRWGSKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPKETFLDLLRG 120

Query: 121 NVFSNHSSWMLXXXXXXXVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDEM 180
           ++  +  +W+L        V+PWQ +L++ST  F L EGFFT+LGIQ IGE N WL  E 
Sbjct: 121 DIPVSVKNWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHER 180

Query: 181 NSNTWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLFGIVS 240
           NSN WII+SLLTSGG+IT SLYYLYRIY TPIWNLSV  A+LLGFTLS+V  +G++GIVS
Sbjct: 181 NSNIWIISSLLTSGGLITGSLYYLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIVS 240

Query: 241 KNGSVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYYQ 300
            NGSVIESSLFFAYIVRCIYEI+P+LATTAT+E LE IK  WQ H  NL+  +  +SY+ 
Sbjct: 241 HNGSVIESSLFFAYIVRCIYEIAPELATTATEEFLEGIKEVWQSHHANLNVADGFISYFY 300

Query: 301 DVVLKNAEMVWESIVLRTKNSD-ATTFTAIQP-LNKLWHAFTPIWKFFKGFVLSVPSSIG 358
           D     A   W     RT        +    P L  +   F PIW+  K    SVP+SI 
Sbjct: 301 DSFHMQAHKFWTLFTSRTPYYGYLHNYCMDYPSLVMIRSNFYPIWETLKTLTFSVPTSIS 360

Query: 359 GVFQVTLKLASESVSPAIVLNLCFRVLVFYSATRIIPALQRKNTRELRKSRRIMNVLYWY 418
            +F +T+++A +SVSPAI++NLCFR+++FYSATRIIPA+Q++   E RK R IM  LYWY
Sbjct: 361 ELFHLTVRMAIDSVSPAIIINLCFRLMIFYSATRIIPAIQKRTRSETRKIRGIMKALYWY 420

Query: 419 SPCILIAMYTHLILQYSGELNSDLCLWGCSEKWFGSGQPKIEINTWVFWNWCNIFWTVLI 478
           SPCILIAMYTHLILQYSGEL  DLCLWGC   WFG  Q +I ++ W FWNWCNIFWT++I
Sbjct: 421 SPCILIAMYTHLILQYSGELKKDLCLWGCDSTWFGEDQERINVDAWSFWNWCNIFWTIII 480

Query: 479 YGSELIGGKR 488
           YGSELIGGK+
Sbjct: 481 YGSELIGGKK 490

>KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 474

 Score =  559 bits (1441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/482 (58%), Positives = 363/482 (75%), Gaps = 12/482 (2%)

Query: 6   KSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMVAQSYG 65
           +S +Q  R+ L  FYLL  L+TIPISF+VGGLYCGLSFTVTLFNLYLITTTL + A++ G
Sbjct: 4   RSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAARARG 63

Query: 66  NKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPEQSLVNVLRNNVFSN 125
                      YY QHF I SLL+LFLSGFSN+EL + ++  ++P++SL+++LR+   + 
Sbjct: 64  LAKLASAA---YYAQHFFIPSLLFLFLSGFSNDELKRQIDTNTRPDESLIDLLRST--TQ 118

Query: 126 HSSWMLXXXXXXXVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDEMNSNTW 185
             +W+        VV+PWQ +L  ST +F L EGFFTVLGIQA+GETNRWL     SN W
Sbjct: 119 SQTWVFYYYYYQYVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGNGSNMW 178

Query: 186 IIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLFGIVSKNGSV 245
           +I+ L+ SGGVITA+LYYLYRIYVTPIW LSVQTASLLGFT SIV G+G++GIVS  GS 
Sbjct: 179 VISGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIVSGRGST 238

Query: 246 IESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYYQDVVLK 305
           IESSLFFAYIVRC+YEISP+LAT+A DEI  ++K  W    ++L +++ LL+YY+D++LK
Sbjct: 239 IESSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYYRDIILK 298

Query: 306 NAEMVWESIVLRTKNSDATTFTAIQPLNKLWHAFTPIWKFFKGFVLSVPSSIGGVFQVTL 365
           N EMVW++I+ RT  +   + T   P+   W+   P+WKF K F  SVPSSI  +F +TL
Sbjct: 299 NGEMVWDAILARTNVNVGASGT---PVWASWNRVQPLWKFVKHFTSSVPSSIQEIFYLTL 355

Query: 366 KLASESVSPAIVLNLCFRVLVFYSATRIIPALQRKNTRELRKSRRIMNVLYWYSPCILIA 425
           ++A E+++PA+V+NLCFR+L+FYSATRIIPALQ+K+    R+SRR M +LYWYSPCI+IA
Sbjct: 356 EMAREAIAPAVVINLCFRILIFYSATRIIPALQKKHK---RRSRRFMRMLYWYSPCIVIA 412

Query: 426 MYTHLILQYSGELNSDLCLWGCSEKWFGSGQPKIEINTWVFWNWCNIFWTVLIYGSELIG 485
           MYTHLILQYSG++++DLCLWGC   W     PK+ +++W FWNWCNIF T+ IY SEL+G
Sbjct: 413 MYTHLILQYSGQISNDLCLWGCF-PWSVPDTPKVVVDSWGFWNWCNIFCTMAIYASELLG 471

Query: 486 GK 487
            K
Sbjct: 472 SK 473

>Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {ON}
           YIL090W - Hypothetical ORF [contig 27] FULL
          Length = 475

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/485 (57%), Positives = 361/485 (74%), Gaps = 14/485 (2%)

Query: 4   ISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMVAQS 63
           I +S LQ  R+ L  FYLL  L+TIPI+F+VGGLYCGLSFTVTLFNLYLITTTL + A++
Sbjct: 2   IPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAARA 61

Query: 64  YGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPEQSLVNVLRNNVF 123
            G   +    +  YY QHF I SLL+LFLSGFSN+EL   ++  ++P++SL+++LR++  
Sbjct: 62  RG---FAKLASAAYYAQHFFIPSLLFLFLSGFSNDELKHQIDTNTRPDESLIDLLRSSTH 118

Query: 124 SNHSSWMLXXXXXXXVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDEMNSN 183
           S    W+        VV+PWQ +L  ST +F L EGFFTVLGIQA+GETNRWL     SN
Sbjct: 119 SQ--PWIFYYYYYHYVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHGSN 176

Query: 184 TWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLFGIVSKNG 243
            W+I+ L+TSGGVITA+LYYLYRIYVTPIW LSVQTASLLGFT SIV G+G+FGIVS  G
Sbjct: 177 VWVISGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSGRG 236

Query: 244 SVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYYQDVV 303
           S IESSLFFAYIVRC+YEISP+LAT+A DEI  ++K  W    ++L +++  L+YY+D++
Sbjct: 237 STIESSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRDII 296

Query: 304 LKNAEMVWESIVLRTKNSDATTFTAIQPLNKL-WHAFTPIWKFFKGFVLSVPSSIGGVFQ 362
           LKN EM+W++++ RT        +   P+  + WH   P+WKF K F  SVPSSI  +F 
Sbjct: 297 LKNGEMIWDAVLARTN----VNVSGAGPVAWISWHRVQPLWKFVKHFTSSVPSSIQEIFL 352

Query: 363 VTLKLASESVSPAIVLNLCFRVLVFYSATRIIPALQRKNTRELRKSRRIMNVLYWYSPCI 422
           +TL +A E+++PA+V+NLCFR+L+FYSATRIIPALQRK+    R+SRR M +LYWYSPCI
Sbjct: 353 LTLSMAREAIAPAVVINLCFRILIFYSATRIIPALQRKHK---RRSRRFMRMLYWYSPCI 409

Query: 423 LIAMYTHLILQYSGELNSDLCLWGCSEKWFGSGQPKIEINTWVFWNWCNIFWTVLIYGSE 482
           +IAMYTHLI+QYSG++++DLCLWGC   W      K+ +++W FWNWCNIF T+ IY SE
Sbjct: 410 VIAMYTHLIMQYSGQISNDLCLWGCF-PWSPPEGSKVVVDSWGFWNWCNIFCTMAIYASE 468

Query: 483 LIGGK 487
           L G K
Sbjct: 469 LFGSK 473

>ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL090W
          Length = 502

 Score =  480 bits (1236), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 260/510 (50%), Positives = 344/510 (67%), Gaps = 35/510 (6%)

Query: 4   ISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMVAQS 63
           + K  L+  R ALA FYL   L+T+PISF++GGLYCGLSFTVTLF LY +TTTL + A +
Sbjct: 2   VPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAAT 61

Query: 64  YGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPE------------ 111
            G++   + +T +YYLQHF++ S+L+LFLSGF+N++L K L  GS P+            
Sbjct: 62  RGDEWKHIAST-LYYLQHFLMPSILFLFLSGFNNDQLQKKLV-GSDPKGARGGFIFDGNM 119

Query: 112 -QSLVNVLRNNVFSNHSSWMLXXXXXXXVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIG 170
            +SL+ +L  +   +  + M        VV+PWQ +L H+T  F L+EGFFTVL IQ IG
Sbjct: 120 NESLLQLLGRS--RDDRATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIG 177

Query: 171 ETNRWLLDEMNSNTWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIV 230
           ET RWL  + NS  W+I+SL+ SG VIT S+YYLYRIYVTPIW LSV TA+LLGFTLS+V
Sbjct: 178 ETGRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLV 237

Query: 231 CGIGLFGIVSKNGSVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLS 290
            G+GL+GI+S  GS IESSLFFAY+V CIYEISP+LA TA  EI +V+   WQ  Q  L 
Sbjct: 238 FGLGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLP 297

Query: 291 TTNNLLSYYQDVVLKNAEMVWE----------SIVLRTKNSDATTFTAIQPLNKL-WHAF 339
             N+LL+YY++ +L NAE +W+          S+ L    S      A+  + +  W+  
Sbjct: 298 -KNSLLAYYKNFIL-NAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKS 355

Query: 340 TPIWKFFKGFVLSVPSSIGGVFQVTLKLASESVSPAIVLNLCFRVLVFYSATRIIPALQR 399
             +W F K F   +P SI  +F VTL LA ES++ A+V NL FRV+VFYSATRIIPALQR
Sbjct: 356 QQLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQR 415

Query: 400 KNTRELRKSRRIMNVLYWYSPCILIAMYTHLILQYSGELNSDLCLWGCSEKWFGS--GQP 457
                  +SR++M ++YWYSPCI+IAMYTH+IL+YSGELN++LC+WGC   W  S   + 
Sbjct: 416 ATGGT--QSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFP-WLQSEANRD 472

Query: 458 KIEINTWVFWNWCNIFWTVLIYGSELIGGK 487
           +  ++ W FWNWCN+F+T+LIY  ELIG +
Sbjct: 473 RWVVDAWGFWNWCNLFFTLLIYAVELIGSR 502

>Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar to
           Ashbya gossypii ADL208W
          Length = 513

 Score =  479 bits (1233), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 264/517 (51%), Positives = 340/517 (65%), Gaps = 38/517 (7%)

Query: 4   ISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMVAQS 63
           +S+  L+  R +LA FYL   L+TIPISF+VGGLYCGLSFTVTLF LY  TTTL +   +
Sbjct: 2   LSRGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSFTVTLFILYFTTTTLKITTTN 61

Query: 64  YGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPEQSLVNVLRNNV- 122
            G+  + +  + IYYLQHF+I S+L+LFLS F++++L ++++  +    S   +   NV 
Sbjct: 62  -GSGKFKLLASLIYYLQHFLIPSILFLFLSAFNSDQLQRLVDSDAVGASSKGFIFEGNVN 120

Query: 123 ----------FSNHSSWMLXXXXXXXVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGET 172
                       N  S          +V+PWQ +L H+T +F L+EGFFTVL IQAIGET
Sbjct: 121 ESLLQLLSLPPGNEGSVASYYYYYKYIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGET 180

Query: 173 NRWLLDEMNSNTWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCG 232
            RWL  + NSNTW+I SLL SG VIT S++YLYRIYVTPIW LSVQTA+LLGFTLS+V G
Sbjct: 181 GRWLRYKKNSNTWVILSLLVSGVVITTSMFYLYRIYVTPIWPLSVQTATLLGFTLSLVFG 240

Query: 233 IGLFGIVSKNGSVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTT 292
           +GL+GI+S  GS IESSLFFAY+VRCIYEISP+LA TA  EI +V+   WQ  Q  LS  
Sbjct: 241 LGLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTLS-K 299

Query: 293 NNLLSYYQDVVLKNAEMVWESIVLRTKNSDA-------TTFTAIQPL------------- 332
           NNLL+YY   V  NAE  W+S++ +T    A       T F    P              
Sbjct: 300 NNLLTYYNTFV-SNAESFWDSLLKKTAIGTAAAAEETYTIFGYSMPFTSTIAKDTLIILQ 358

Query: 333 NKLWHAFTPIWKFFKGFVLSVPSSIGGVFQVTLKLASESVSPAIVLNLCFRVLVFYSATR 392
            + W     IW F K F + +P SI  +  VTLK+A ES++PA++ NL FRVLVFYSATR
Sbjct: 359 TQWWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYSATR 418

Query: 393 IIPALQRKNTRELRKSRRIMNVLYWYSPCILIAMYTHLILQYSGELNSDLCLWGCSE--K 450
           IIPALQ+       +SR++M ++YWYSPCI+IAMYTHLIL+YSGELN+DLC+WGC     
Sbjct: 419 IIPALQKATGAT--QSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGCFPWLN 476

Query: 451 WFGSGQPKIEINTWVFWNWCNIFWTVLIYGSELIGGK 487
           +    + K  ++ W FWNWCN+F+T+LIY  ELIG +
Sbjct: 477 FSAKTRSKWVVDAWSFWNWCNLFFTLLIYAVELIGSR 513

>KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 486

 Score =  470 bits (1209), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 251/488 (51%), Positives = 316/488 (64%), Gaps = 41/488 (8%)

Query: 1   MTTISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMV 60
           M  I KS LQ  R+ L   YL   L+TIPISF+VGGL CGLSFTVTLF LY ++TT  +V
Sbjct: 40  MPLIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLV 99

Query: 61  AQSYGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPEQSLVNVLRN 120
               G+      +T IYYLQH +I S+L++FLS F N        D    +     V  N
Sbjct: 100 LLDRGSAL----STLIYYLQHLLIPSILFMFLSYFENI-------DSDTVDSEYFKVFWN 148

Query: 121 NVFSNHSSWMLXXXXXXXVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDEM 180
                             +V+PWQ  L HST  F L EG FT+L IQAIGET RWL    
Sbjct: 149 -----------------VMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSR 191

Query: 181 NSNTWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLFGIVS 240
            SN W+I SLL SGG+IT SL+Y YRIYVTP+W LS  +ASLLGFT SIVCGIGL+GI +
Sbjct: 192 RSNQWVILSLLISGGIITLSLFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-N 250

Query: 241 KNGSVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYYQ 300
            +GSV+ESSLFFAY+VR +YEISPK+A  A DEI +++K  W+ HQ NL   +NLL    
Sbjct: 251 GSGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLL---- 306

Query: 301 DVVLKNAEMVWESIVLRTKNSDATTFTAIQPLNKLWHAFTPIWKFFKGFVLSVPSSIGGV 360
           +++ KN   +W  IV  T  +       I+ +++      P+W   K F  SVP SI  +
Sbjct: 307 ELMTKNYRAIWSQIVEHTPRNHK----YIKMMDQCKWILNPLWNSVKNFTKSVPISIQEI 362

Query: 361 FQVTLKLASESVSPAIVLNLCFRVLVFYSATRIIPALQRKNTRELRKSRRIMNVLYWYSP 420
           F VT K+A ES+ PA+V+NL FR+L+FYSATRIIP LQR NT+E R  RRIMN +YWYSP
Sbjct: 363 FVVTFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQR-NTKERRSFRRIMNFVYWYSP 421

Query: 421 CILIAMYTHLILQYSGELNSDLCLWGCSEKWFGSGQPKIEINTWVFWNWCNIFWTVLIYG 480
           CI+IAMYTHLIL+YSG+L +DLC+WGC        +PKI +++W FWNWCNI+ T+LIY 
Sbjct: 422 CIIIAMYTHLILRYSGQLKNDLCIWGCFPY---ETEPKIVVDSWSFWNWCNIYSTMLIYA 478

Query: 481 SELIGGKR 488
            EL+G  +
Sbjct: 479 LELMGSNK 486

>TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON} 
          Length = 536

 Score =  460 bits (1183), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 253/535 (47%), Positives = 350/535 (65%), Gaps = 50/535 (9%)

Query: 1   MTTISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMV 60
           M  + KS  Q  RM    FYL+S L+TIP +FK+GGLYCGLSFT+TLF+LY ++TT+ ++
Sbjct: 1   MPWVVKSVKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLI 60

Query: 61  AQSYGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPE-QSLVNVLR 119
           A+   N  YI+ +T +YYLQH +IASLLY+F++ FS+  L ++L +    +  SL+  ++
Sbjct: 61  AKRTLNNFYILLSTLVYYLQHIVIASLLYIFITIFSDGNLNEILSNNKTDQLPSLLYYIK 120

Query: 120 NNV---FSNHSSWMLXXXXXXXVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWL 176
           N+     S +  ++L        VQPW  +L+HST FF L EGFFT+LGIQAIGET  WL
Sbjct: 121 NDTSKSVSQNFHYLLFYYYYYYAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYCWL 180

Query: 177 LDEMNSNTWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLF 236
           L +     + + + L S GVI  ++++LY+IY   +W LS+QTASLLG T+S+V  +G+F
Sbjct: 181 LLKKQKKIFKLLTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVGIF 240

Query: 237 GIVSKNGSVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLL 296
           GI S NGS+IESSLF  YI+RC YEISP+L+T+AT EIL+ IK AWQ HQ +++ T ++L
Sbjct: 241 GIFSTNGSLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEHIL 300

Query: 297 SYYQDVVLK--NAEMVWESIVLRTKNSDAT--------------TFTAIQPLNKLWHAF- 339
            YY +V+LK  N+  ++ S   ++ ++ A               T T I   + L H   
Sbjct: 301 FYYNNVLLKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKPSDLIHLIG 360

Query: 340 ------------TPIWKFFKGFVLSVPSSIGGVFQVTLKLASESVSPAIVLNLCFRVLVF 387
                       TPI++  K FVL++P+S+  + QVT KLA +SVSP+IV+NLCFRVL+F
Sbjct: 361 FKSIYQNWLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRVLIF 420

Query: 388 YSATRIIPALQRKNTRELRKSRRIMNVLYWYSPCILIAMYTHLILQYSGELNSDLCLWGC 447
           YSATRIIPA+QRKN  E ++SR  +   Y +SPCI+IAMYT+LILQYSGEL +DLC+WGC
Sbjct: 421 YSATRIIPAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCIWGC 480

Query: 448 -------SEKW------FGSGQ--PKIE--INTWVFWNWCNIFWTVLIYGSELIG 485
                  S++        GS    P  E  +N+W FWNWCNIF T+ IYG EL+G
Sbjct: 481 DIISKSISQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGCELMG 535

>TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON}
           Anc_2.293 YIL090W
          Length = 493

 Score =  457 bits (1176), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 240/499 (48%), Positives = 344/499 (68%), Gaps = 17/499 (3%)

Query: 1   MTTISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMV 60
           M+ + K+  + TR   AG YLLS L+T+PI+F++GGL CGL+FT+TLF+ Y ITTTL+ +
Sbjct: 1   MSQVLKNLGESTRFFFAGIYLLSVLMTVPIAFQLGGLQCGLAFTLTLFSSYFITTTLNAI 60

Query: 61  AQSYGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPEQSLVNVLRN 120
           A+    + +I  T F+YY Q+F I  +L++FLS FS+ EL+  + D +   +++ ++L+N
Sbjct: 61  ARKLRWQRFIAWTNFLYYFQNFNIIGILHIFLSLFSHTELSISMSDENPSMETITSILKN 120

Query: 121 N-VFSNHSSWMLXXXXXXXVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDE 179
           N  + + +   +        +  W+  L++ST  FAL EGFFT+L IQ IGETN WL   
Sbjct: 121 NDTYPSKTISFIYKYFFYYAMPRWKFCLSYSTPLFALVEGFFTILAIQVIGETNIWLTTV 180

Query: 180 MNSNTWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLFGIV 239
            NS+ WII SL+ S  ++T S+YY+Y+IYVTP+W+LS Q ASLL FT S+V G+ ++GIV
Sbjct: 181 KNSSIWIILSLIMSSSMVTTSIYYIYKIYVTPLWHLSNQVASLLSFTFSLVGGVAIYGIV 240

Query: 240 SKNGSVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYY 299
           S  GSV+ESSLFFAYIV CIYEISP +ATTA D+I + +K +WQ HQ+N   ++NLL YY
Sbjct: 241 SHRGSVVESSLFFAYIVCCIYEISPIMATTAMDDIFDTLKESWQIHQRNFFISDNLLIYY 300

Query: 300 QDVVLKNAE--MVWESIVLRTKNSDATTFTAI--QPLNKLWHAFTPIWKFFKGFVLSVPS 355
            + ++KN +  +  + I L TK++ +  F ++  Q +     +F  I K  K F L +PS
Sbjct: 301 YNSLIKNVDEFIKLKIIKLTTKDNFSNKFNSLLFQCVKISKKSFKFILKLSKRFTLGIPS 360

Query: 356 SIGGVFQVTLKLASESVSPAIVLNLCFRVLVFYSATRIIPALQRK------NTRELRKSR 409
           SI  ++ +TLK+ASES+SP I++NLC+RVL+FY+ATRIIPAL+ +      N  + + + 
Sbjct: 361 SIYELYSITLKMASESISPVILVNLCYRVLIFYAATRIIPALESRSNGFSNNNIKTKSNS 420

Query: 410 RIMNVLYWYSPCILIAMYTHLILQYSGELNSDLCLWGCSEKWFGSGQPKIEINTWVFWNW 469
           + M VLYWYSPCILIAMYT+LILQYSGEL S+  LW        S   ++ +++W FWNW
Sbjct: 421 KFMKVLYWYSPCILIAMYTNLILQYSGELKSEFKLWN------NSNNNEVVVDSWRFWNW 474

Query: 470 CNIFWTVLIYGSELIGGKR 488
           CNIFWT+ +YGSELIGG++
Sbjct: 475 CNIFWTITLYGSELIGGRK 493

>TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.293
           YIL090W
          Length = 579

 Score =  449 bits (1156), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 243/552 (44%), Positives = 342/552 (61%), Gaps = 92/552 (16%)

Query: 4   ISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMVAQS 63
           I +  +      L  FYLL+ +VTIPISFK+GG+YCGLSFT TLF LY I+T+++++ + 
Sbjct: 51  IPRGVINSGHAVLVAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITKR 110

Query: 64  Y-GNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVL----------EDGSQPEQ 112
              N    +  + ++Y+Q+F+I+SLL ++L GF+N++L   L          ++G+  + 
Sbjct: 111 LTHNTTLRLLASSLFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTKY 170

Query: 113 SL--------VNVLRNNVFSNHS------------------------SWMLXXXXXXXVV 140
            +        VN++   +F   +                        SW+L        +
Sbjct: 171 QILFIIKDYFVNIMNLILFREDNGLNKMLQLALKSEGNSVPDPQKLNSWILFFYYYYIFI 230

Query: 141 QPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDEMNSNTWIIASLLTSGGVITAS 200
           +PW+ +L +ST FF L EGFFT+LGIQ IGETN WL  + +S+ W+I SLL+SGGVITA+
Sbjct: 231 KPWKFLLINSTPFFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITAT 290

Query: 201 LYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLFGIVSKNGSVIESSLFFAYIVRCIY 260
           LYYL RIYVTP W+L+V TAS+LGFTLSIV G+G+FGIVSKNGS IESSLFFAYIVRCIY
Sbjct: 291 LYYLNRIYVTPFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCIY 350

Query: 261 EISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYYQDVVLKNAEMVWESIVLRTKN 320
           E+SP+LA +ATDE LE     WQ +Q  ++  +N+L+Y +  ++                
Sbjct: 351 EMSPELAISATDEFLEGFNEVWQMNQNRITVADNVLTYCKKYIM---------------- 394

Query: 321 SDA-TTFTAIQPLNKLWHAFTP---------------IWKFFKGFVLSVPSSIGGVFQVT 364
            DA ++F++I+      H   P                W F K F ++VPSSI  + Q+T
Sbjct: 395 -DAFSSFSSIE------HHLFPKTIELGISKNLIVKQFWVFLKNFTINVPSSINDLIQIT 447

Query: 365 LKLASESVSPAIVLNLCFRVLVFYSATRIIPALQRKNTRELRKSRRIMNVLYWYSPCILI 424
            ++A +S+SPAI++NL FR+++FYSATRIIPA+QR+   +       M+ +YW+SPC+LI
Sbjct: 448 AQMAVDSISPAIIINLSFRLMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCMLI 507

Query: 425 AMYTHLILQYSGELNSDLCLWGCSEKWFGS---------GQPKIEINTWVFWNWCNIFWT 475
           AMYTHLILQ+SGEL  ++CLW C E W  S         G   I +++W FWNWCNIFWT
Sbjct: 508 AMYTHLILQFSGELKKNICLWNC-ENWLSSSSDVKSTNLGDNSIIVDSWSFWNWCNIFWT 566

Query: 476 VLIYGSELIGGK 487
           ++IY SELIGG+
Sbjct: 567 IIIYASELIGGR 578

>SAKL0F00748g Chr6 (64800..66923) [2124 bp, 707 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 707

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 23/106 (21%), Positives = 48/106 (45%), Gaps = 21/106 (19%)

Query: 240 SKNGSVIESSLFFAYIVRCIYEISPKLATTAT--------DEILEVIKVAWQ-KHQKNLS 290
           S+N   +E +L +A+  + I  ++P+              D++ +  K+  + KH+KN  
Sbjct: 485 SRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKHKKNPD 544

Query: 291 TTNNLLSYYQDVVLKNAE------------MVWESIVLRTKNSDAT 324
                + YY+DV++   +            M W ++++  KNSD +
Sbjct: 545 VGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGS 590

>YLR171W Chr12 (500733..501122) [390 bp, 129 aa] {OFF} Dubious open
           reading frame unlikely to encode a functional protein,
           based on available experimental and comparative sequence
           data
          Length = 129

 Score = 29.6 bits (65), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 49/93 (52%), Gaps = 10/93 (10%)

Query: 168 AIGETNRWLLDEMNSNTWIIASLLTSGGVITASLYYL-YRIYVTPIWNLSVQTASLLGFT 226
           +I  TNRW++ ++       +S L++ GVI    Y L YR+Y T +W+L      +LGF 
Sbjct: 12  SIVSTNRWIISKV-------SSSLSTSGVIPTIKYRLAYRLYTT-LWSLYSMMLHILGFL 63

Query: 227 LSIVCGIGLFGIVSKNGSVIESSLFFAYIVRCI 259
            +IV G+  F I + + + I    FF  I  C+
Sbjct: 64  ANIV-GVKSFTIFAFSPADIAVYHFFNLIFPCL 95

>TBLA0B01730 Chr2 complement(385644..386711) [1068 bp, 355 aa] {ON} 
          Length = 355

 Score = 30.4 bits (67), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 92/204 (45%), Gaps = 39/204 (19%)

Query: 78  YLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPEQSLVNVLRNNVFSNHSSWMLXXXXXX 137
           + Q++  AS L     G++N +     ED S P   L   +R   ++ + +W L      
Sbjct: 83  FFQYYTYASNL-----GWTNIQAEFRGEDVSHPVTDLYPNVRQIFYAKYVAWFLCWPIQL 137

Query: 138 XVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDEMNSNTWIIASLLTSGGVI 197
            +++     + HS   F+  E   ++L +Q IG              W+I+ L+  G +I
Sbjct: 138 FLLELAGITINHSGEVFSTWELIHSLL-VQMIG-----------YEYWVISLLV--GALI 183

Query: 198 TASL---YYLYRIYVT----------PIWNLSVQTASLLGFTLSIVCGIGLFGI---VSK 241
            ++    Y++  I+V+           I++L ++  SL+ + LSI+C + L+ +   +S 
Sbjct: 184 HSTYKWGYWVMGIFVSFCVLGVQFKRQIFDLKIRGVSLIVYLLSIICTL-LYNVCWGLSD 242

Query: 242 NGSVIE---SSLFFAYIVRCIYEI 262
            G+ I     ++F+  +  CI+ I
Sbjct: 243 GGNAISPNGEAVFYGILDYCIFAI 266

>Kpol_1039.41 s1039 complement(126117..128087) [1971 bp, 656 aa]
           {ON} complement(126117..128087) [1971 nt, 657 aa]
          Length = 656

 Score = 30.8 bits (68), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 35/75 (46%), Gaps = 5/75 (6%)

Query: 241 KNGSVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYYQ 300
           KNG+  E  L  A+    I + +        D +++  ++ W  H     T   LL  Y+
Sbjct: 516 KNGNTTEDDLKQAFTAADIKDFNSNQIVLFLDTLVQNKEIQWNNHHTAAKT---LLKIYE 572

Query: 301 DVVLK--NAEMVWES 313
           D ++K  NAE+V+ +
Sbjct: 573 DSIVKSRNAEVVFRT 587

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.137    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,302,619
Number of extensions: 1975999
Number of successful extensions: 7368
Number of sequences better than 10.0: 41
Number of HSP's gapped: 7487
Number of HSP's successfully gapped: 41
Length of query: 488
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 374
Effective length of database: 40,409,475
Effective search space: 15113143650
Effective search space used: 15113143650
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)