Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G022202.292ON71071034140.0
Skud_9.822.292ON72271523140.0
YIL091C (UTP25)2.292ON72171423060.0
Smik_9.882.292ON72472723010.0
Suva_9.1082.292ON72272522840.0
ZYRO0A02002g2.292ON70972922620.0
SAKL0E07546g2.292ON71871622380.0
Kpol_1039.462.292ON70470722300.0
NDAI0B035302.292ON73971622190.0
TBLA0B059702.292ON71971322080.0
KAFR0J013402.292ON72856222080.0
NCAS0B062302.292ON72371422060.0
KNAG0A054002.292ON72172021760.0
CAGL0D04180g2.292ON70070321300.0
TPHA0D015202.292ON71656221260.0
KLTH0G10494g2.292ON74756121280.0
KLLA0E08229g2.292ON70470821210.0
Kwal_27.115032.292ON72756021110.0
Ecym_33312.292ON70871020360.0
ADL209C2.292ON70470520220.0
TBLA0C055802.164ON540203800.50
TDEL0F011902.164ON549113733.3
YGL015Cna 1ON13059684.7
Kpol_1005.115.337ON506111715.8
KNAG0B046605.337ON49493707.2
Kwal_33.143255.337ON50093707.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G02220
         (710 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {O...  1319   0.0  
Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}...   895   0.0  
YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}  ...   892   0.0  
Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}...   890   0.0  
Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON...   884   0.0  
ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {...   875   0.0  
SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} simila...   866   0.0  
Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa] ...   863   0.0  
NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.2...   859   0.0  
TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa] ...   855   0.0  
KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2....   855   0.0  
NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON} Anc_2...   854   0.0  
KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.2...   842   0.0  
CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {...   825   0.0  
TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.2...   823   0.0  
KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {...   824   0.0  
KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} simila...   821   0.0  
Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091...   817   0.0  
Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}...   788   0.0  
ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON} S...   783   0.0  
TBLA0C05580 Chr3 (1351338..1352610,1353450..1353799) [1623 bp, 5...    35   0.50 
TDEL0F01190 Chr6 (211677..212937,213454..213842) [1650 bp, 549 a...    33   3.3  
YGL015C Chr7 complement(465043..465435) [393 bp, 130 aa] {ON} Pu...    31   4.7  
Kpol_1005.11 s1005 complement(18157..19677) [1521 bp, 506 aa] {O...    32   5.8  
KNAG0B04660 Chr2 complement(900857..902341) [1485 bp, 494 aa] {O...    32   7.2  
Kwal_33.14325 s33 (619599..621101) [1503 bp, 500 aa] {ON} YHR065...    32   7.9  

>TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {ON}
           Anc_2.292 YIL091C
          Length = 710

 Score = 1319 bits (3414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 651/710 (91%), Positives = 651/710 (91%)

Query: 1   MVKDKSNGDEARRNGTLKRGRKELRSIRRPQRNKAHEEPEHLNESSEGEVKNHHNGMQHX 60
           MVKDKSNGDEARRNGTLKRGRKELRSIRRPQRNKAHEEPEHLNESSEGEVKNHHNGMQH 
Sbjct: 1   MVKDKSNGDEARRNGTLKRGRKELRSIRRPQRNKAHEEPEHLNESSEGEVKNHHNGMQHN 60

Query: 61  XXXXXXXXXXXXKRRKVYGALLTILNSEHPKPKPKQEVTVQSRKXXXXXXXXXXXXXXXX 120
                       KRRKVYGALLTILNSEHPKPKPKQEVTVQSRK                
Sbjct: 61  EEIANVEEDEENKRRKVYGALLTILNSEHPKPKPKQEVTVQSRKEDSESDVEEDERDEVE 120

Query: 121 XXXXNLARVDENPXXXXXXXXXXXXXXXXXXTFDSHFNQVPENVVDKLDAAFKERQLKYK 180
               NLARVDENP                  TFDSHFNQVPENVVDKLDAAFKERQLKYK
Sbjct: 121 QLEDNLARVDENPSEDDLSEDADEESDDEQDTFDSHFNQVPENVVDKLDAAFKERQLKYK 180

Query: 181 SAKVPIGENESMVYSKPLLLEDQSKKLEIPSRHESLKSYVFKQRLKIQNDLEHENLTSTQ 240
           SAKVPIGENESMVYSKPLLLEDQSKKLEIPSRHESLKSYVFKQRLKIQNDLEHENLTSTQ
Sbjct: 181 SAKVPIGENESMVYSKPLLLEDQSKKLEIPSRHESLKSYVFKQRLKIQNDLEHENLTSTQ 240

Query: 241 RTLVDPMLQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYKTRDKILKNNQRISDNPDAD 300
           RTLVDPMLQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYKTRDKILKNNQRISDNPDAD
Sbjct: 241 RTLVDPMLQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYKTRDKILKNNQRISDNPDAD 300

Query: 301 YLDQGFTRPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKGKFRDQFFEESLXXXXXXXX 360
           YLDQGFTRPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKGKFRDQFFEESL        
Sbjct: 301 YLDQGFTRPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKGKFRDQFFEESLPPSSKPKS 360

Query: 361 FQHVFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFL 420
           FQHVFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFL
Sbjct: 361 FQHVFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFL 420

Query: 421 SSIEISIFDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDFGRVRLWYINEQAKLFRQTM 480
           SSIEISIFDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDFGRVRLWYINEQAKLFRQTM
Sbjct: 421 SSIEISIFDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDFGRVRLWYINEQAKLFRQTM 480

Query: 481 IFTKYVSPTANALINNKCQNMTGRWKNHHFIEPNQSSIGKLGLKVRQIFQRIDLGAASIL 540
           IFTKYVSPTANALINNKCQNMTGRWKNHHFIEPNQSSIGKLGLKVRQIFQRIDLGAASIL
Sbjct: 481 IFTKYVSPTANALINNKCQNMTGRWKNHHFIEPNQSSIGKLGLKVRQIFQRIDLGAASIL 540

Query: 541 EESDFRFKFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRVRNYMKEKTTIIFGDINEYS 600
           EESDFRFKFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRVRNYMKEKTTIIFGDINEYS
Sbjct: 541 EESDFRFKFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRVRNYMKEKTTIIFGDINEYS 600

Query: 601 NQKQLNSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVFYQPPTNPEFYSEVVRFIA 660
           NQKQLNSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVFYQPPTNPEFYSEVVRFIA
Sbjct: 601 NQKQLNSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVFYQPPTNPEFYSEVVRFIA 660

Query: 661 KSAALGTTDLNISTVRTIYSKLDGISLERIVGTKRAAILTHGQNEVYEFK 710
           KSAALGTTDLNISTVRTIYSKLDGISLERIVGTKRAAILTHGQNEVYEFK
Sbjct: 661 KSAALGTTDLNISTVRTIYSKLDGISLERIVGTKRAAILTHGQNEVYEFK 710

>Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score =  895 bits (2314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/715 (61%), Positives = 533/715 (74%), Gaps = 14/715 (1%)

Query: 9   DEARRNGTLKRGRKELRSIRRPQRNKAHE-EPEHLNESSEGEVKNHHNGMQHXXXXXXX- 66
           +E    G  KRGR+ELR I+R    +  + + + ++  +E  V  + N            
Sbjct: 9   NEDHHRGHRKRGRQELRKIKRSSGRRTEDVDADKIDYVAEEPVGRNDNDAVSDVGSEDDL 68

Query: 67  -XXXXXXKRRKVYGALLTILNSEHPKPKPKQEVTVQSRKXXXXXXXXXXXXXXXXXXXXN 125
                  K++KVY ALLTIL SEHP+PK  +    +S                       
Sbjct: 69  DVGDEDEKKKKVYDALLTILKSEHPEPKRMKTKAEESSDRTTQSDGNENAESEPVDDQLE 128

Query: 126 LA------RVDENPXXXXXXXX-XXXXXXXXXXTFDSHFNQVPENVVDKLDAAFKERQLK 178
           +       R DE+                     F+SHFNQVPE  VD L  AFK + ++
Sbjct: 129 IENGLLGDREDESEDDGSEDEKHDDVDSEDEQDPFESHFNQVPEKDVDDLSNAFKSKNIR 188

Query: 179 YKSAKVPIGENESMVYSKPLLLEDQSKKLEIPSRHESLKSYVFKQRLKIQNDLEHEN--- 235
           YKS K P+  +ES +Y++P+++ ++S  +E P +  S+ SY  KQRLKIQN L+ +    
Sbjct: 189 YKSVKAPLNGDESYIYAQPVVVGEESS-VESPYKSSSIYSYFLKQRLKIQNGLQDKKIDP 247

Query: 236 LTSTQRTLVDPMLQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYKTRDKILKNNQRISD 295
           L + QR LVDPM QY D+LYEY+SYEKDEDEYRDLY LHVLNH+YKTRD+ILKNNQR+ D
Sbjct: 248 LNALQRKLVDPMFQYKDILYEYDSYEKDEDEYRDLYTLHVLNHIYKTRDRILKNNQRLQD 307

Query: 296 NPDADYLDQGFTRPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKGKFRDQFFEESLXXX 355
           NPD ++LDQGFTRPKVLIVVPTRD AY+V++KII KSGIDQ+DKKGKF DQF ++SL   
Sbjct: 308 NPDTEHLDQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPK 367

Query: 356 XXXXXFQHVFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQLILENTDKKKR 415
                FQH+FKGNTNDFFV+G+KFTRKAIKLYSNFYQSDII+CSPLGIQ+ILENTDKKKR
Sbjct: 368 SKPRSFQHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKR 427

Query: 416 QDDFLSSIEISIFDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDFGRVRLWYINEQAKL 475
           QDDFLSSIEI + DQLHSIEYQN+SH++TIFDHLN IP +QH+ DF R+R+WYINEQAK 
Sbjct: 428 QDDFLSSIEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSRIRMWYINEQAKF 487

Query: 476 FRQTMIFTKYVSPTANALINNKCQNMTGRWKNHHFIEPNQSSIGKLGLKVRQIFQRIDLG 535
           FRQTM+FTKY+SPT N+LIN +C+NM GRWKNH  I P  SSIG+LGLK+RQIFQR D  
Sbjct: 488 FRQTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQIFQRFDTI 547

Query: 536 AASILEESDFRFKFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRVRNYMKEKTTIIFGD 595
             SI+EE D+RFKFFTSV+IPSI+KSTGYEDGIL+YIPDY DFIR+RNYMKEKTTI+FGD
Sbjct: 548 GNSIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGD 607

Query: 596 INEYSNQKQLNSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVFYQPPTNPEFYSEV 655
           INEYS+Q+QLN+NR+LFQQGR KV+LYTERLHH+RRY+IKGVKSV+FY+PP NPEFYSE 
Sbjct: 608 INEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNPEFYSET 667

Query: 656 VRFIAKSAALGTTDLNISTVRTIYSKLDGISLERIVGTKRAAILTHGQNEVYEFK 710
           VRFI K+A  G TDLNISTVR IYSKLDGISLERIVGTKRAA+L+H Q EVYEFK
Sbjct: 668 VRFIGKNAFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQKEVYEFK 722

>YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}
           UTP25Nucleolar protein required for 35S pre-RNA
           processing and 40S ribosomal subunit biogenesis
          Length = 721

 Score =  892 bits (2306), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/714 (62%), Positives = 533/714 (74%), Gaps = 25/714 (3%)

Query: 15  GTLKRGRKELRSIRRPQRNKAHEEPEHLNE--------SSEGEVKNHHNGMQHXXXXXXX 66
           G  KRGR+ELR I+R          E L +        S E EV +  +G          
Sbjct: 15  GYRKRGRQELRKIKRSSARTEGGSTETLEDVAEDIDHRSDEDEVSDVDSG------DDFD 68

Query: 67  XXXXXXKRRKVYGALLTILNSEHPKPKPKQEVTVQSRKXXXXXXXXXXXXXXXXXXXXNL 126
                 K+ KVY ALLTIL SEHP+PK ++    +S K                     L
Sbjct: 69  IEDEEGKKEKVYDALLTILKSEHPEPKRRRREADESNKAPAEVGEDEHENTEHGPVDDQL 128

Query: 127 -------ARVDENPXXXXXXXXXXXXXXXXXXTFDSHFNQVPENVVDKLDAAFKERQLKY 179
                     +++                    F+SHFNQVPE  VDKL  AFK + +KY
Sbjct: 129 EIENGLLGNHEDDNDDDSSGDEKDIDSEDEQDPFESHFNQVPEKFVDKLSNAFKTKSVKY 188

Query: 180 KSAKVPIGENESMVYSKPLLLEDQSKKLEIPSRHESLKSYVFKQRLKIQNDL---EHENL 236
           KS K  + ++ES +Y+KP+++ +++  +E P R  S+ SY  KQRLK+QN L   + + L
Sbjct: 189 KSVKGSLSDSESYIYAKPVVIGEEAL-VESPYRSSSIYSYFLKQRLKVQNGLLDKKTDPL 247

Query: 237 TSTQRTLVDPMLQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYKTRDKILKNNQRISDN 296
           T+ Q+ LVDPM QY D+LYEY+SYEKDEDEYRDLYALHVLNH+YKTRD+ILKNNQR+ DN
Sbjct: 248 TALQKKLVDPMFQYKDILYEYDSYEKDEDEYRDLYALHVLNHIYKTRDRILKNNQRLQDN 307

Query: 297 PDADYLDQGFTRPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKGKFRDQFFEESLXXXX 356
           PD ++LDQGFTRPKVLIVVPTR+ AY+V++KII KSGIDQ+DKKGKF DQF ++SL    
Sbjct: 308 PDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPKS 367

Query: 357 XXXXFQHVFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQ 416
               FQH+F+GNTNDFFV+G+KFTRKAIKLYSNFYQSDII+CSPLGIQ+ILENTDKKKRQ
Sbjct: 368 KPKSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQ 427

Query: 417 DDFLSSIEISIFDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDFGRVRLWYINEQAKLF 476
           DDFLSSIE+ + DQLHSIEYQN+SH+ TIFDHLN IP +QH+ DF R+R+WYINEQAKLF
Sbjct: 428 DDFLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQHEADFSRIRMWYINEQAKLF 487

Query: 477 RQTMIFTKYVSPTANALINNKCQNMTGRWKNHHFIEPNQSSIGKLGLKVRQIFQRIDLGA 536
           RQTM+FTKY+SP AN+LIN +C+NM GRWKNH  I    SSIG+ GLK+RQIFQR D+  
Sbjct: 488 RQTMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGLKIRQIFQRFDIIG 547

Query: 537 ASILEESDFRFKFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRVRNYMKEKTTIIFGDI 596
            SI+EE D+RFKFFTSVIIP I+KSTGYEDGIL+YIPDY DFIR+RNYMKEKTTI+FGDI
Sbjct: 548 NSIIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDI 607

Query: 597 NEYSNQKQLNSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVFYQPPTNPEFYSEVV 656
           NEYS+Q+QLN+NR+LFQQGR KV+LYTERLHH+RRYEIKGVKSVVFY+PP NPEFY+EVV
Sbjct: 608 NEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNPEFYNEVV 667

Query: 657 RFIAKSAALGTTDLNISTVRTIYSKLDGISLERIVGTKRAAILTHGQNEVYEFK 710
           RFI K+A LG TDLNISTVR IYSKLDG+SLERIVGTKRAA+L+H Q E+YEFK
Sbjct: 668 RFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEIYEFK 721

>Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}
           YIL091C (REAL)
          Length = 724

 Score =  890 bits (2301), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/727 (61%), Positives = 537/727 (73%), Gaps = 27/727 (3%)

Query: 7   NGDEARRN-----GTLKRGRKELRSIRRPQ----RNKAHEEPEHLNES---SEGEVKNHH 54
           NG+  R       G  KRGR+ELR I+R      ++++  E +H+ +    S GE K   
Sbjct: 2   NGESVREKNDHFRGYRKRGRQELRKIKRSSVRRTKDESVNEVDHVADEIVHSTGEDKISD 61

Query: 55  NGMQHXXXXXXXXXXXXXKRRKVYGALLTILNSEHPKPKPKQEVTVQSRKXXXXXXXXXX 114
            G +              K+ KVY ALLTIL SEHP+PK ++    +  K          
Sbjct: 62  IGSEEDNLDVEDEEG---KKEKVYDALLTILKSEHPEPKRRKTQADEDNKAAAKPAGNEN 118

Query: 115 XXXXXXXXXXNL--------ARVDENPXXXXXXXXXXXXXXXXXXTFDSHFNQVPENVVD 166
                      L         R D+N                    F+SHFNQV E  VD
Sbjct: 119 VNVEYEPVDEQLEIENGLLGDREDDNDDDSNENEKDDMDSEDEQDPFESHFNQVSEKYVD 178

Query: 167 KLDAAFKERQLKYKSAKVPIGENESMVYSKPLLLEDQSKKLEIPSRHESLKSYVFKQRLK 226
            L  AFK + +KYKS K  +G++ES +Y+KP ++ +++  +E P R  S+ SY  KQRLK
Sbjct: 179 DLSNAFKSKSIKYKSVKASLGDDESYIYAKPFMVGEEAL-VESPYRSSSIYSYFLKQRLK 237

Query: 227 IQNDL---EHENLTSTQRTLVDPMLQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYKTR 283
           +QN L   + + LT  Q+ L+DPM QY D+LYEY+SYEKDE EYRDLYALHVLNH+YKTR
Sbjct: 238 VQNGLLDKKIDPLTCMQKKLIDPMFQYKDILYEYDSYEKDESEYRDLYALHVLNHIYKTR 297

Query: 284 DKILKNNQRISDNPDADYLDQGFTRPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKGKF 343
           D+ILKNNQR+ DNPD ++LDQGFTRPKVLIVVPTR+ AY+V++KII KSGIDQ+DKKGKF
Sbjct: 298 DRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKF 357

Query: 344 RDQFFEESLXXXXXXXXFQHVFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGI 403
            DQF ++SL        FQH+FKGNT+DFFV+G+KFTRKAIKLYSNFYQSDIIICSPLGI
Sbjct: 358 YDQFRDDSLPPESKPKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIICSPLGI 417

Query: 404 QLILENTDKKKRQDDFLSSIEISIFDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDFGR 463
           Q+ILENTDKKKRQDDFLSSIE+ + DQLHSIEYQN+SH+ TIFDH+N IP +QH+ DF R
Sbjct: 418 QMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSR 477

Query: 464 VRLWYINEQAKLFRQTMIFTKYVSPTANALINNKCQNMTGRWKNHHFIEPNQSSIGKLGL 523
           +R+WYINEQAKLFRQTM+FTKY+SP AN+LIN +C NM GRWKNH  I    SSIG+LGL
Sbjct: 478 IRMWYINEQAKLFRQTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIGSESSSIGQLGL 537

Query: 524 KVRQIFQRIDLGAASILEESDFRFKFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRVRN 583
           KVRQIFQR D+   SI+EE D+RFKFFTSVIIPSI+KS GYEDGILVYIPDY DFIR+RN
Sbjct: 538 KVRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYIPDYTDFIRIRN 597

Query: 584 YMKEKTTIIFGDINEYSNQKQLNSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVFY 643
           YMKEKTTI+FGDINEYSNQ+QLN+NR+LFQQGR KV+LYTERLHH+RRYEIKGVKSVVFY
Sbjct: 598 YMKEKTTILFGDINEYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFY 657

Query: 644 QPPTNPEFYSEVVRFIAKSAALGTTDLNISTVRTIYSKLDGISLERIVGTKRAAILTHGQ 703
           +PP NPEFY+E VRFI K+A LG TDLNISTVR IYSKLDG+SLERIVGTKRAA+L+H Q
Sbjct: 658 KPPNNPEFYNETVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQ 717

Query: 704 NEVYEFK 710
            EVYEFK
Sbjct: 718 KEVYEFK 724

>Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score =  884 bits (2284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/725 (60%), Positives = 532/725 (73%), Gaps = 25/725 (3%)

Query: 7   NGDEARRN-----GTLKRGRKELRSIRRPQRNKAHE----EPEHLNESSEGEVKNHHNGM 57
           +G  AR N     G  KRGR+E+R I+R    +  +    E +H+ E S  E K      
Sbjct: 2   SGKSARENDEHFRGHRKRGRQEMRKIKRTTARRTEDVDTNEVDHVAEES-VETKAEDAIS 60

Query: 58  QHXXXXXXXXXXXXXKRRKVYGALLTILNSEHPKPKPKQEVTVQSRKXXXXXXXXXXXXX 117
                          K+ KVY ALLTIL SEHP+  PK++ T  + +             
Sbjct: 61  DAGSESDLDIGDEEEKQEKVYDALLTILKSEHPE--PKRKKTKATGENNEAVDQTGVNEN 118

Query: 118 XXXXXXXNLARVDEN---------PXXXXXXXXXXXXXXXXXXTFDSHFNQVPENVVDKL 168
                  +   ++                               F+SHFNQV E  VD +
Sbjct: 119 TDSEPVDDQLEIENGLLSDQEDDSDDDGDENEQDEVDSEDEQDPFESHFNQVSEKYVDDV 178

Query: 169 DAAFKERQLKYKSAKVPIGENESMVYSKPLLLEDQSKKLEIPSRHESLKSYVFKQRLKIQ 228
             AFK   +KYKS K P+G++ES +YSKP++  D++  +E P +  S+ SY  KQRLKIQ
Sbjct: 179 SNAFKANNIKYKSVKSPLGDDESCIYSKPVVNGDETP-VERPYKSSSIYSYFLKQRLKIQ 237

Query: 229 NDL---EHENLTSTQRTLVDPMLQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYKTRDK 285
           N L   + + LTS Q+ LVDPM QY D+LYEY+SYEKDEDEYRDLY LH LNH+YKTRD+
Sbjct: 238 NGLLDKKIDPLTSLQKKLVDPMFQYKDILYEYDSYEKDEDEYRDLYTLHALNHIYKTRDR 297

Query: 286 ILKNNQRISDNPDADYLDQGFTRPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKGKFRD 345
           ILKNNQR+ DNPD ++LDQGFTRPKVLIVVPTRD AY V++KII KSGIDQ+DKKGKF D
Sbjct: 298 ILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTRDAAYHVVDKIIKKSGIDQVDKKGKFYD 357

Query: 346 QFFEESLXXXXXXXXFQHVFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQL 405
           QF ++SL        FQH+F+GNT+DFFV+G+KFTRKAIKLYSNFYQSDII+CSPLGIQ+
Sbjct: 358 QFRDDSLPPSSKPKSFQHIFRGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQM 417

Query: 406 ILENTDKKKRQDDFLSSIEISIFDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDFGRVR 465
           ILENTDKKKRQDDFLSSIE+ + DQLHSIEYQN+SH+ TIFDH+N IP +QH+ DF R+R
Sbjct: 418 ILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIR 477

Query: 466 LWYINEQAKLFRQTMIFTKYVSPTANALINNKCQNMTGRWKNHHFIEPNQSSIGKLGLKV 525
           +WYINEQAKL RQTM+FTKY+SP AN+LIN +C+N+ GRWKNH  IE   SSIG+LGLK+
Sbjct: 478 MWYINEQAKLLRQTMVFTKYISPAANSLINGRCRNLAGRWKNHKVIESETSSIGQLGLKI 537

Query: 526 RQIFQRIDLGAASILEESDFRFKFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRVRNYM 585
           RQIFQR D+   SI+EE D+RFKFFTSVIIPSI+KSTGYEDGIL+YIPDY DFIR+RNYM
Sbjct: 538 RQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSTGYEDGILIYIPDYTDFIRIRNYM 597

Query: 586 KEKTTIIFGDINEYSNQKQLNSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVFYQP 645
           KEKTTI+FGDINEYS+QKQLN+NR+LFQQGR KVLLYTERLHH+RRYEIKGVK+V+FY+P
Sbjct: 598 KEKTTILFGDINEYSSQKQLNANRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVIFYKP 657

Query: 646 PTNPEFYSEVVRFIAKSAALGTTDLNISTVRTIYSKLDGISLERIVGTKRAAILTHGQNE 705
           P NPEFY+E VR+I K+A LG TDLNISTVR +YSKLDG+SLERIVGTKRA +L+H Q E
Sbjct: 658 PNNPEFYNETVRYIGKNAFLGNTDLNISTVRCVYSKLDGLSLERIVGTKRAGVLSHAQKE 717

Query: 706 VYEFK 710
           VYEFK
Sbjct: 718 VYEFK 722

>ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 709

 Score =  875 bits (2262), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/729 (60%), Positives = 541/729 (74%), Gaps = 39/729 (5%)

Query: 1   MVKDKSNGDEARRNGTLKRGRKELRSIRRPQRNK----------AHEEPEHLNESSEGEV 50
           MVK   NG +A  +G+ KRGRK+LRSIRR + +K          A EE   L+E SE + 
Sbjct: 1   MVKRTGNGTDAI-DGSRKRGRKDLRSIRRARNDKEPVEEPEIPVASEEDGELSEDSEEDA 59

Query: 51  KNHHNGMQHXXXXXXXXXXXXXKRRKVYGALLTILNSEHPKPKPKQEVTVQSRKXXXXXX 110
            N                     + K YGALLTIL SEHP+ + ++    + +K      
Sbjct: 60  TNE-------------VQEQEDSKEKAYGALLTILKSEHPEDRQRER---RKKKQDLQDP 103

Query: 111 XXXXXXXXXXXXXXNLARVDENPXXXXXXXXXXXXXXXXXXT------FDSHFNQVPENV 164
                           A + + P                  +      F+SHFN   E++
Sbjct: 104 SSSDDELSEDEKGEVEANLVDTPGEEEPQSEEELSEGDEDESEDERDPFESHFNMQSESI 163

Query: 165 VDKLDAAFKERQLKYKSAKVPIGENESMVYSKPLLLEDQSKKLEIPSRHESLKSYVFKQR 224
            D LD A+K++++  KS K+ + ++ES++Y+K L  + Q  + E+PS    L SY  K++
Sbjct: 164 -DSLDEAWKQKKIVNKSGKIRVDDDESLIYTKTLAGKGQ--EFELPSHKGHLSSYPLKRK 220

Query: 225 LKIQNDL---EHENLTSTQRTLVDPMLQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYK 281
           LKIQN+L   + + LT  QR +VDP+ QY DLLYEY  YE+DEDEYRDLY LHVLNH+YK
Sbjct: 221 LKIQNNLLESQDDVLTPLQRKIVDPIFQYRDLLYEYEDYEQDEDEYRDLYVLHVLNHIYK 280

Query: 282 TRDKILKNNQRISDNPDADYLDQGFTRPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKG 341
           TRD+ILK+NQR++ NPD ++LDQGFTRPKVLIV PTRDTAYQ++ K+I+KSG+DQ+DKK 
Sbjct: 281 TRDRILKDNQRLATNPDGEFLDQGFTRPKVLIVAPTRDTAYQIVSKVIEKSGLDQVDKKS 340

Query: 342 KFRDQFFEESLXXXXXXXXFQHVFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPL 401
           K RDQFFE+ L        F+H FKGNTNDFFVLGVKFTRKAI+LYSNFYQSD+I+CSPL
Sbjct: 341 KLRDQFFEDVLPPSSKPKSFRHTFKGNTNDFFVLGVKFTRKAIRLYSNFYQSDLIVCSPL 400

Query: 402 GIQLILENTDKKKRQDDFLSSIEISIFDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDF 461
           G+QLILENTD+KKRQDDFLSSIE+ I DQL+SIE+QNVSH+ TIF H+N IP+EQHDTDF
Sbjct: 401 GLQLILENTDRKKRQDDFLSSIELMIIDQLNSIEFQNVSHLFTIFAHMNKIPKEQHDTDF 460

Query: 462 GRVRLWYINEQAKLFRQTMIFTKYVSPTANALINNKCQNMTGRWKNHHFIEPNQSSIGKL 521
           GRVR+WYINEQAKL RQT+IFT+YV+PTAN L+N KC+N+ GRWKNHH I   QSS+ KL
Sbjct: 461 GRVRMWYINEQAKLLRQTLIFTRYVTPTANFLLNGKCRNIGGRWKNHHQITGEQSSVSKL 520

Query: 522 GLKVRQIFQRIDLGAASILEESDFRFKFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRV 581
           G +VRQIFQR+DLG AS+++E D+RF+FFTSVI+PSI KSTGYEDGIL+YIPDYADFIRV
Sbjct: 521 GFRVRQIFQRVDLGGASVVDEPDYRFRFFTSVIVPSITKSTGYEDGILLYIPDYADFIRV 580

Query: 582 RNYMKEKTTIIFGDINEYSNQKQLNSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVV 641
           RNY+K+KTTI+FGDINEYS+ +QL S R+LFQQGR KVLLYTERLHHFRRYEIKGVKSV+
Sbjct: 581 RNYLKDKTTILFGDINEYSDVRQLTSTRSLFQQGRIKVLLYTERLHHFRRYEIKGVKSVI 640

Query: 642 FYQPPTNPEFYSEVVRFIAKSAALGTTDLNISTVRTIYSKLDGISLERIVGTKRAAILTH 701
           FYQPP+NPEFY+EVVR+I KSA LG TDLNISTVR +YSKLDG++LERIV +KRAA+LTH
Sbjct: 641 FYQPPSNPEFYNEVVRYIGKSAFLGDTDLNISTVRCVYSKLDGLALERIVSSKRAAVLTH 700

Query: 702 GQNEVYEFK 710
           GQNE+YEFK
Sbjct: 701 GQNEIYEFK 709

>SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 718

 Score =  866 bits (2238), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/716 (59%), Positives = 520/716 (72%), Gaps = 8/716 (1%)

Query: 2   VKDKSNGDEARRN--GTLKRGRKELRSIRRPQRNKAHEEPEHLNESSEGEVKNHHNGMQH 59
           V  +SN DE+        K GRKELR+I R     A+E  +      +   +        
Sbjct: 4   VSKRSNRDESHGGYKKAKKTGRKELRTITRANARHANESKDDFENEPDMSSEEEELADNK 63

Query: 60  XXXXXXXXXXXXXKRRKVYGALLTILNSEHP--KPKPKQEVTVQSRKXXXXXXXXXXXXX 117
                        K++KVY ALLT+L SEHP  K K  +E   + +              
Sbjct: 64  PRSDEEEEEDIETKKQKVYNALLTLLESEHPHKKSKKNREGGKEKQGNLQEGVETYSDED 123

Query: 118 XXXXXXXNLARVDENPXXXXXXXXXXXXXXXXXXTFDSHFNQVPENVVDKLDAAFKERQL 177
                   L   +++                   +F+ HFN V E    KL +AF+++++
Sbjct: 124 EEEAIENALVETNDDEDDVGSDINGDEDDEDKADSFELHFNNVSELQATKLASAFRDKKI 183

Query: 178 KYKSAKVPIGENESMVYSKPLLLEDQSKKLEIPSRHESLKSYVFKQRLKIQNDL---EHE 234
           +YKS KVP+ E+E  +YS+P +  +    +  PS  +SL SY  KQ+LKIQN+L   + E
Sbjct: 184 RYKSVKVPVNEDEFFIYSRPTVEGEDGSSVVAPSCKKSLHSYFIKQKLKIQNNLLDDKKE 243

Query: 235 NLTSTQRTLVDPMLQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYKTRDKILKNNQRIS 294
            L   Q+ LVDPM QY DLLYEY SYE++E EYRDLYALHVLNHVYKTRD+IL+N+Q++ 
Sbjct: 244 ALAPLQKNLVDPMFQYQDLLYEYRSYEQEE-EYRDLYALHVLNHVYKTRDRILRNSQKLQ 302

Query: 295 DNPDADYLDQGFTRPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKGKFRDQFFEESLXX 354
           DN D + LDQGFTRPKVLIVVPTRD AYQ++ KII+KSG+DQ+DK+GKF+DQFF+ SL  
Sbjct: 303 DNSDQELLDQGFTRPKVLIVVPTRDVAYQIVTKIIEKSGLDQVDKRGKFQDQFFDASLPP 362

Query: 355 XXXXXXFQHVFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQLILENTDKKK 414
                 F+H+FKGNTNDFFVLG KFTRK +KLYSNFYQSD+I CSPLGIQLILENTDKKK
Sbjct: 363 SSKPKSFKHIFKGNTNDFFVLGAKFTRKTLKLYSNFYQSDVIFCSPLGIQLILENTDKKK 422

Query: 415 RQDDFLSSIEISIFDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDFGRVRLWYINEQAK 474
           RQDDFLSSIE+ + DQLHSIEYQN+SH+ TIF H+N IPQ+QHD DF R+R+WYINEQA 
Sbjct: 423 RQDDFLSSIELMVIDQLHSIEYQNLSHITTIFQHINKIPQQQHDADFSRIRMWYINEQAT 482

Query: 475 LFRQTMIFTKYVSPTANALINNKCQNMTGRWKNHHFIEPNQSSIGKLGLKVRQIFQRIDL 534
           LFRQTM+FTKY SP AN+LIN KC+N  GRWKNH+ + P +SSI +LGLKVRQIFQR DL
Sbjct: 483 LFRQTMVFTKYASPFANSLINGKCRNHAGRWKNHNIVLPEKSSINQLGLKVRQIFQRFDL 542

Query: 535 GAASILEESDFRFKFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRVRNYMKEKTTIIFG 594
              S ++E D+RFKFFTSVII SIIKSTGYEDGIL+YIPDY D++RVRN+++EKTT++FG
Sbjct: 543 VGGSAMDEPDYRFKFFTSVIIASIIKSTGYEDGILLYIPDYTDYVRVRNHLREKTTLLFG 602

Query: 595 DINEYSNQKQLNSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVFYQPPTNPEFYSE 654
           DINEYS QKQL SNRALFQQG+ KVLLYTERLHHFRRYEIKGVKSV+FY+PPTNPEFY E
Sbjct: 603 DINEYSEQKQLTSNRALFQQGKVKVLLYTERLHHFRRYEIKGVKSVIFYKPPTNPEFYRE 662

Query: 655 VVRFIAKSAALGTTDLNISTVRTIYSKLDGISLERIVGTKRAAILTHGQNEVYEFK 710
           VVR+I KSA LG+ DLNISTVR +Y KLDG+SLER+VGTKRAA+LTHGQNE+YEFK
Sbjct: 663 VVRYIGKSAFLGSADLNISTVRCVYCKLDGLSLERVVGTKRAAVLTHGQNEIYEFK 718

>Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa]
           {ON} complement(138925..141039) [2115 nt, 705 aa]
          Length = 704

 Score =  863 bits (2230), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/707 (59%), Positives = 528/707 (74%), Gaps = 11/707 (1%)

Query: 11  ARRNGTL----KRGRKELRSIRRPQRNKAHEEPEHLNESSEGEVKNHHNGMQHXXXXXXX 66
           AR +GT     KRGR ELRSIRRP R++  +  + +   SE E     +           
Sbjct: 2   ARHSGTSEGPKKRGRTELRSIRRPNRSQHSKHDQQVVHESENEDSLESS-SDDDEDIAQA 60

Query: 67  XXXXXXKRRKVYGALLTILNSEHPKPKPKQEVTVQSRKXXXXXXXXXXXXXXXXXXXXNL 126
                 ++ KVYGALLTILNSEH  P+ K+  +  S                        
Sbjct: 61  EAENSDRKEKVYGALLTILNSEH--PERKKHKS-HSTDFVKEIDEQEEIEQGMASESEEE 117

Query: 127 ARVDENPXXXXXXXXXXXXXXXXXXTFDSHFNQVPENVVDKLDAAFKERQLKYKSAKVPI 186
              ++                    TF+SHFN V +++VD + A FK++Q+KYKS K  +
Sbjct: 118 DEENDEEESNEGDEEEEEEPTDQLDTFESHFNDVSQDLVDDISAGFKDKQIKYKSMKYSL 177

Query: 187 GENESMVYSKPLLLEDQSKKLEIPSRHESLKSYVFKQRLKIQNDL---EHENLTSTQRTL 243
            + ES ++ KPLLL  Q + ++ P    S  SY  KQRLKIQNDL     ENLT  ++ L
Sbjct: 178 DKKESAIFGKPLLLTQQDETIDNPVLTSSYDSYFIKQRLKIQNDLLDSSKENLTPLKKKL 237

Query: 244 VDPMLQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYKTRDKILKNNQRISDNPDADYLD 303
           +DPM QY D+L EY +YE DE EYR+LY+LHVLNH+YKTRDKILK+NQR+ +N D + LD
Sbjct: 238 LDPMFQYKDVLCEYTNYENDEKEYRELYSLHVLNHIYKTRDKILKDNQRLQENDDLECLD 297

Query: 304 QGFTRPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKGKFRDQFFEESLXXXXXXXXFQH 363
           QGFTRPKVLIVVPTRDTAYQV+E II+KSG+DQIDKKGKF+DQFF++SL        F+H
Sbjct: 298 QGFTRPKVLIVVPTRDTAYQVVETIIEKSGLDQIDKKGKFKDQFFDDSLPPTSKPKSFRH 357

Query: 364 VFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSI 423
           VFKGNTNDFFVLG+KFTRKAIKLYSNFYQSDIIICSPLGIQ+ILENTDKKKRQDDFLSSI
Sbjct: 358 VFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSI 417

Query: 424 EISIFDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDFGRVRLWYINEQAKLFRQTMIFT 483
           E+ I DQLHSIEYQN+SHV TI +H+N IPQ+Q + DF R+R+WYIN+QAK  RQTM+FT
Sbjct: 418 EVMIVDQLHSIEYQNISHVYTILEHINKIPQQQREADFSRIRMWYINDQAKFLRQTMLFT 477

Query: 484 KYVSPTANALINNKCQNMTGRWKNHHFIEPNQSSIGKLGLKVRQIFQRIDLGAASILEES 543
           +Y+SPTANA+IN KC NM GRWKN+  I    SSIG+LG+K++QIFQR DL   ++++ES
Sbjct: 478 RYISPTANAIINGKCHNMAGRWKNNQIISSEDSSIGQLGIKIKQIFQRFDLVGGTVVDES 537

Query: 544 DFRFKFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRVRNYMKEKTTIIFGDINEYSNQK 603
           D+RFK+FTSV++ +I+KSTGYEDGILVYIP+Y D++R+RNYMKEKTTI+F +INEYS QK
Sbjct: 538 DYRFKYFTSVVMQNIVKSTGYEDGILVYIPEYTDYMRLRNYMKEKTTILFSEINEYSTQK 597

Query: 604 QLNSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVFYQPPTNPEFYSEVVRFIAKSA 663
           QL+SNR++FQQGR KVLLYTERLHH+RRYE+KG+KSV+FY+PPTNPEFY+EV+RF AK+A
Sbjct: 598 QLDSNRSMFQQGRTKVLLYTERLHHYRRYELKGIKSVIFYKPPTNPEFYNEVIRFTAKNA 657

Query: 664 ALGTTDLNISTVRTIYSKLDGISLERIVGTKRAAILTHGQNEVYEFK 710
            LG +D+NIST+RT+YSKLDG++L+RIVG+KRAAIL HGQNE Y+FK
Sbjct: 658 FLGKSDINISTIRTVYSKLDGLALQRIVGSKRAAILCHGQNESYDFK 704

>NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.292
           YIL091C
          Length = 739

 Score =  859 bits (2219), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/716 (60%), Positives = 523/716 (73%), Gaps = 25/716 (3%)

Query: 18  KRGRKELRSIRRPQRNKAHEEP---EHLNESSEGEVKNHHNGMQHXXXXXXXXXXXXXKR 74
           KRGR+ELR+IRR    K+  +    EH +     + ++                    +R
Sbjct: 26  KRGRQELRTIRRSAAKKSRYDSNVTEHNDTEELLQEESEEGEEDEEDDQSEQEEVDEDER 85

Query: 75  R-KVYGALLTILNSEHPKPKPKQEVTVQSRKXXXXXXXXXXXXXXXXXXXXNLARVDENP 133
           + KVYGALLTIL +EHP+  PK +   + +                     ++   DE  
Sbjct: 86  KGKVYGALLTILETEHPE--PKHKRQPKEKLLKEQVSDSNLNNTGDRETEDSIIEEDETE 143

Query: 134 X--------------XXXXXXXXXXXXXXXXXTFDSHFNQVPENVVDKLDAAFKERQLKY 179
                                            F+SHFN+  E  VDKL AAF+ R++KY
Sbjct: 144 QIENGLLDRDDEQSDDDQLNDSNDVESDDEQDPFESHFNKPTEQFVDKLHAAFESREIKY 203

Query: 180 KSAKVPIGENESMVYSKPLLL--EDQSKKLEIPSRHESLKSYVFKQRLKIQNDLEH---E 234
           K+ K+ I ++ S++ SKP +   E ++ +L      +S+ SY  KQRLKIQN+L +   +
Sbjct: 204 KATKIVIDDSHSVISSKPTIFGEELETNRLSSSKHGQSIFSYFIKQRLKIQNNLLNPKVD 263

Query: 235 NLTSTQRTLVDPMLQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYKTRDKILKNNQRIS 294
            LT  Q+ L+DPM QY D+LYEY+SY KDEDEYRDLYALH LNHVYKTRD+ILKNNQR+ 
Sbjct: 264 PLTPLQKELLDPMFQYKDILYEYDSYGKDEDEYRDLYALHALNHVYKTRDRILKNNQRLQ 323

Query: 295 DNPDADYLDQGFTRPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKGKFRDQFFEESLXX 354
           DN D +YLDQGFTRPKVLIVVPTRDTAY+V +KII KSG+DQ+DKKGKF DQF ++SL  
Sbjct: 324 DNTDTEYLDQGFTRPKVLIVVPTRDTAYEVTDKIIKKSGLDQVDKKGKFYDQFKDDSLPP 383

Query: 355 XXXXXXFQHVFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQLILENTDKKK 414
                 FQ +FKGNTNDFFVLG+KFTRKAIKLYSNFYQSDII+CSPLG+Q+I+ENTDKKK
Sbjct: 384 SSKPKSFQQIFKGNTNDFFVLGLKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTDKKK 443

Query: 415 RQDDFLSSIEISIFDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDFGRVRLWYINEQAK 474
           RQDDFLSSIE+ I DQLHS+EYQN++H+ TIFDHLN IP EQHD DF R+R+WYIN+QAK
Sbjct: 444 RQDDFLSSIELLIVDQLHSLEYQNLAHIFTIFDHLNKIPTEQHDADFSRIRMWYINDQAK 503

Query: 475 LFRQTMIFTKYVSPTANALINNKCQNMTGRWKNHHFIEPNQSSIGKLGLKVRQIFQRIDL 534
           LFRQTM+FTKYVSP ANA+INN+C+N  GRWKNH  + P  SSIGKLGLK++QIFQR D+
Sbjct: 504 LFRQTMVFTKYVSPAANAIINNRCRNWEGRWKNHKIVAPEVSSIGKLGLKIKQIFQRFDI 563

Query: 535 GAASILEESDFRFKFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRVRNYMKEKTTIIFG 594
              SI++E D+RFK FTSVIIPSI+KST Y+DGIL+YIPDY D++R+RNY+KEKT I+FG
Sbjct: 564 MGGSIVDEPDYRFKHFTSVIIPSIVKSTSYDDGILIYIPDYTDYVRIRNYLKEKTRILFG 623

Query: 595 DINEYSNQKQLNSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVFYQPPTNPEFYSE 654
           DINEYS Q++LNSNR+L QQGR KVLLYTERLHH+RRYEIKGVKSVVFY+PPTNPEFY+E
Sbjct: 624 DINEYSEQRELNSNRSLLQQGRVKVLLYTERLHHYRRYEIKGVKSVVFYKPPTNPEFYNE 683

Query: 655 VVRFIAKSAALGTTDLNISTVRTIYSKLDGISLERIVGTKRAAILTHGQNEVYEFK 710
           VVRFI K+A LG TDLNISTVRT+Y KLDG+SLERIVGTKRA IL H QNEVYEFK
Sbjct: 684 VVRFIGKNAFLGNTDLNISTVRTVYCKLDGLSLERIVGTKRAGILCHAQNEVYEFK 739

>TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa]
           {ON} Anc_2.292 YIL091C
          Length = 719

 Score =  855 bits (2208), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/713 (59%), Positives = 519/713 (72%), Gaps = 23/713 (3%)

Query: 15  GTLKRGRKELRSIRRPQRNKAHEEPEHL-------NESSEGEVKNHHNGMQHXXXXXXXX 67
           G  KRGR + RSI++    K  +  +         +ESS+ +V N               
Sbjct: 13  GYGKRGRSQKRSIKKSSGAKRFKTEDTRIVKETIEDESSDEDVSNT------SIDKEAEV 66

Query: 68  XXXXXKRRKVYGALLTILNSEHPKPKPKQEVTVQSRKXXXXXX---XXXXXXXXXXXXXX 124
                K+++VY AL+TIL SEH +PK +  +   S++                       
Sbjct: 67  TEDLEKKKQVYDALVTILKSEHKEPKMRDNLNETSKEEHLTDEDLDEDEKFETEEQEIEN 126

Query: 125 NLARV----DENPXXXXXXXXXXXXXXXXXXTFDSHFNQVPENVVDKLDAAFKERQLKYK 180
           NL  +    +E                     FDSHFNQ  E   +K   AFK +Q+KY+
Sbjct: 127 NLLSIKDDEEEGENNDDNAGESDDESDNKSDPFDSHFNQPTEQFTNKFADAFKNKQIKYR 186

Query: 181 SAKVPIGENESMVYSKPLLLEDQSKKLEIPSRHESLKSYVFKQRLKIQNDL---EHENLT 237
           S K  I E ES +YS+P +LED+  K++ P    S+ SY  K+RLKI NDL      NLT
Sbjct: 187 SIKYKINEYESSIYSEPRILEDEQTKVKSPVLKSSIHSYALKKRLKINNDLLDPAVNNLT 246

Query: 238 STQRTLVDPMLQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYKTRDKILKNNQRISDNP 297
           + Q+ LVDPM QY D+LYEY +Y KDE+EYR LY LHVLNH+YKTRD+ILKNN ++ DNP
Sbjct: 247 TIQKELVDPMFQYKDILYEYGNYGKDEEEYRSLYCLHVLNHIYKTRDRILKNNSKVQDNP 306

Query: 298 DADYLDQGFTRPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKGKFRDQFFEESLXXXXX 357
           DA++LDQGFTRPKVLIV PTRD  Y ++ +II KSGIDQIDKK KFRDQF+EESL     
Sbjct: 307 DAEFLDQGFTRPKVLIVAPTRDAGYSIVNEIIKKSGIDQIDKKSKFRDQFYEESLLPASK 366

Query: 358 XXXFQHVFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQD 417
              FQ VFKGN+ND+FVLG+KFTRKAIKLYSNFYQSDII+CSPLG+ +ILENTDKKKRQD
Sbjct: 367 PKSFQAVFKGNSNDYFVLGIKFTRKAIKLYSNFYQSDIIVCSPLGLHMILENTDKKKRQD 426

Query: 418 DFLSSIEISIFDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDFGRVRLWYINEQAKLFR 477
           DFLSSIE+ I DQLHS+E+QN+SHV +IF+H+N IP+EQHDTDF R+++WYIN+QAKLFR
Sbjct: 427 DFLSSIELMIIDQLHSMEFQNISHVTSIFEHINKIPKEQHDTDFSRIKMWYINDQAKLFR 486

Query: 478 QTMIFTKYVSPTANALINNKCQNMTGRWKNHHFIEPNQSSIGKLGLKVRQIFQRIDLGAA 537
           QTMIFTKY+SP+AN  +N KCQN +GRWKNH  I PN+SSIG+LGL+V+Q+F R D+   
Sbjct: 487 QTMIFTKYISPSANFFLNGKCQNWSGRWKNHKMITPNESSIGQLGLRVKQMFHRFDIIGG 546

Query: 538 SILEESDFRFKFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRVRNYMKEKTTIIFGDIN 597
           SI++E D+RFK+FTSVI+ SI KST YEDG+L+YI DY D++RVRNY+KEKTTI+FGDIN
Sbjct: 547 SIVDEPDYRFKYFTSVIVQSITKSTSYEDGMLIYITDYTDYVRVRNYLKEKTTILFGDIN 606

Query: 598 EYSNQKQLNSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVFYQPPTNPEFYSEVVR 657
           EYS+QKQ+NSNRALFQQ R KVLLYTERLHHFRRYEIKGVK++VFY+ PTNPEFY+EVVR
Sbjct: 607 EYSDQKQVNSNRALFQQRRVKVLLYTERLHHFRRYEIKGVKNIVFYKAPTNPEFYNEVVR 666

Query: 658 FIAKSAALGTTDLNISTVRTIYSKLDGISLERIVGTKRAAILTHGQNEVYEFK 710
           +I K+A  G TD+NIS VRTIYSKLDG++LERI+GTKRAA+LTHGQNE YEFK
Sbjct: 667 YIGKNAFTGNTDINISNVRTIYSKLDGLALERIMGTKRAAVLTHGQNETYEFK 719

>KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2.292
           YIL091C
          Length = 728

 Score =  855 bits (2208), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/562 (71%), Positives = 474/562 (84%), Gaps = 4/562 (0%)

Query: 153 FDSHFNQVPENVVDKLDAAFKERQLKYKSAKVPIGENESMVYSKPLLLEDQ-SKKLEIPS 211
           F++HFN V E   DKLD +FK   +KYKS K+PI E+E  ++SKP++  D+    +E+  
Sbjct: 167 FETHFNSVDEKFTDKLDVSFKNNDIKYKSTKLPISEDEYAIFSKPVIKSDEIESPVELSV 226

Query: 212 RHESLKSYVFKQRLKIQNDL---EHENLTSTQRTLVDPMLQYNDLLYEYNSYEKDEDEYR 268
              S+ SY  KQRLK+QN+L   + + LT  Q+ LVDPM QY D+LY+Y+SY KDEDEYR
Sbjct: 227 NKSSIHSYFLKQRLKMQNNLMDPKVDPLTPLQKQLVDPMFQYKDILYQYDSYGKDEDEYR 286

Query: 269 DLYALHVLNHVYKTRDKILKNNQRISDNPDADYLDQGFTRPKVLIVVPTRDTAYQVLEKI 328
           DLY+LHVLNH+YKTRDKILKNNQR+ DN D + LDQGFTRPKVLIVVPTRDTAYQV+EKI
Sbjct: 287 DLYSLHVLNHLYKTRDKILKNNQRLQDNNDTECLDQGFTRPKVLIVVPTRDTAYQVIEKI 346

Query: 329 IDKSGIDQIDKKGKFRDQFFEESLXXXXXXXXFQHVFKGNTNDFFVLGVKFTRKAIKLYS 388
           I KSGIDQ+DKKGKF+DQFFE+SL        FQ +FKGNTNDFFVLGVKFTRKAIKLYS
Sbjct: 347 IAKSGIDQVDKKGKFKDQFFEDSLPPSSKPKSFQDIFKGNTNDFFVLGVKFTRKAIKLYS 406

Query: 389 NFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIEISIFDQLHSIEYQNVSHVMTIFDH 448
           NFYQSDIIICSPLGIQ+ILENTDKKKRQDDFLSSIE+ I DQLHSIEYQN+SH+ TI +H
Sbjct: 407 NFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIELMIIDQLHSIEYQNISHLFTICNH 466

Query: 449 LNLIPQEQHDTDFGRVRLWYINEQAKLFRQTMIFTKYVSPTANALINNKCQNMTGRWKNH 508
           +N IPQEQHD DF RVR+WYIN+QAKLFRQTM+FTKY+SP AN+L+N KCQN +GRWKNH
Sbjct: 467 INKIPQEQHDADFSRVRMWYINDQAKLFRQTMLFTKYISPMANSLLNGKCQNWSGRWKNH 526

Query: 509 HFIEPNQSSIGKLGLKVRQIFQRIDLGAASILEESDFRFKFFTSVIIPSIIKSTGYEDGI 568
             I  N SSI K+G+K+RQIFQR +    S+++E D+RFKFFTSV +P+I+K+TGYEDG 
Sbjct: 527 KVISTNSSSISKVGIKIRQIFQRFETVNGSVVDEPDYRFKFFTSVTVPNIVKTTGYEDGT 586

Query: 569 LVYIPDYADFIRVRNYMKEKTTIIFGDINEYSNQKQLNSNRALFQQGRAKVLLYTERLHH 628
           L+YIP+Y D+IRVRNY+K+KTTI+FGDINEYS+QKQLNSNR+LFQQGR KVLLYTERLHH
Sbjct: 587 LIYIPEYTDYIRVRNYLKDKTTILFGDINEYSDQKQLNSNRSLFQQGRVKVLLYTERLHH 646

Query: 629 FRRYEIKGVKSVVFYQPPTNPEFYSEVVRFIAKSAALGTTDLNISTVRTIYSKLDGISLE 688
           +RRYEIKGVK+VVFYQPP NPEFY+EVVR+I K+A LG TDLNISTVR +YSKLD +SLE
Sbjct: 647 YRRYEIKGVKNVVFYQPPKNPEFYTEVVRYIGKNAFLGNTDLNISTVRCLYSKLDALSLE 706

Query: 689 RIVGTKRAAILTHGQNEVYEFK 710
            IVG+KRA +L H QNEVYEFK
Sbjct: 707 NIVGSKRAGVLCHAQNEVYEFK 728

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 41/85 (48%), Gaps = 9/85 (10%)

Query: 14 NGTLKRGRKELRSIRRPQRNKAHEEPEHLNESS----EGEVKNHHNGMQH-----XXXXX 64
          +G  KRGRKELR+IRR    K  +  E+ N  S     GEV+   +   +          
Sbjct: 12 DGVRKRGRKELRNIRRAGGRKPRDAQENGNGISVSENTGEVEEEPSSAANGDDVGDEVGD 71

Query: 65 XXXXXXXXKRRKVYGALLTILNSEH 89
                   +++VYGALLTIL SEH
Sbjct: 72 EASDDEEEMKKQVYGALLTILKSEH 96

>NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON}
           Anc_2.292 YIL091C
          Length = 723

 Score =  854 bits (2206), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/714 (59%), Positives = 517/714 (72%), Gaps = 21/714 (2%)

Query: 15  GTLKRGRKELRSIRRPQRNKAHEEPEHLNESSEGEVKNHHNGMQHXXXXXXXXXXXXXKR 74
           G+ KRGR+ELR+IRR    K   + E  N S   +        +              K+
Sbjct: 13  GSKKRGRQELRTIRRSAGAKVSSQ-EVFNSSIVDD--EEQELNESNESEQEEDIDEEEKK 69

Query: 75  RKVYGALLTILNSEHPKPKPKQEVTVQSRKXXXXXXXXXXXXX-------XXXXXXXNLA 127
            KVYGALLTIL SEHP+ K K++  V   K                            LA
Sbjct: 70  NKVYGALLTILKSEHPELKKKKKKRVDDSKSGEDKGSELASDDGKDDEIDEAQQIEDGLA 129

Query: 128 R------VDENPXXXXXXXXXXXXXXXXXXTFDSHFNQVPENVVDKLDAAFKERQLKYKS 181
           R       D+                     F+SHFNQV E   D L+ AF    +KYKS
Sbjct: 130 RGSDGQPSDDEEDNDAHSNVEDIDSEDEQDPFESHFNQVSEKTADDLNTAFNTGSVKYKS 189

Query: 182 AKVPIGENESMVYSKPLLL--EDQSKKLEIPSRHESLKSYVFKQRLKIQNDL---EHENL 236
            K  IG+N++++ S P ++  E+  ++ +   +  S+ SY  KQRL++ ND+   + + L
Sbjct: 190 TKSVIGDNKTVISSIPTIIGKENTEEEKDSAPKSSSIHSYFLKQRLRVANDMLDSKKDPL 249

Query: 237 TSTQRTLVDPMLQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYKTRDKILKNNQRISDN 296
              Q+ LVDPM QY D+L EY+SYEKDEDEYRDLYALH LNHVYKTRD+ILK+N R+ DN
Sbjct: 250 GPLQKELVDPMFQYRDILCEYSSYEKDEDEYRDLYALHALNHVYKTRDRILKDNGRLQDN 309

Query: 297 PDADYLDQGFTRPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKGKFRDQFFEESLXXXX 356
            D +Y DQGFTRPKVLIVVPTRDTAY+V+ KII KSG+DQ+DKKGKF DQF +E+L    
Sbjct: 310 SDTEYFDQGFTRPKVLIVVPTRDTAYEVISKIISKSGLDQVDKKGKFNDQFHDETLPPSS 369

Query: 357 XXXXFQHVFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQ 416
               FQH+FKGNTNDFFVLGVKFTRKAIKLYSNFYQSDII+CSPLG+Q+I+ENTDKK RQ
Sbjct: 370 KPKSFQHIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTDKKNRQ 429

Query: 417 DDFLSSIEISIFDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDFGRVRLWYINEQAKLF 476
           DDFLSSIE+ I DQLHSIEYQN++HV TIFDHLN IP++QH+ DF R+R+WYIN+QA+LF
Sbjct: 430 DDFLSSIEVLIIDQLHSIEYQNLAHVFTIFDHLNKIPEQQHEADFSRIRMWYINDQARLF 489

Query: 477 RQTMIFTKYVSPTANALINNKCQNMTGRWKNHHFIEPNQSSIGKLGLKVRQIFQRIDLGA 536
           RQTMIFTKYV+P ANALINN+C+N  GRWKNH  IEP  S+I +LGLKV+Q FQR D+  
Sbjct: 490 RQTMIFTKYVTPAANALINNRCRNWAGRWKNHEIIEPEASAISQLGLKVKQTFQRFDMMG 549

Query: 537 ASILEESDFRFKFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRVRNYMKEKTTIIFGDI 596
            S+++E D+RFK F+SVIIPSI+KST Y DGIL+YIPDY D++R+RNY+KEKTT++FGDI
Sbjct: 550 GSVIDEPDYRFKHFSSVIIPSIVKSTSYSDGILIYIPDYTDYVRIRNYLKEKTTLLFGDI 609

Query: 597 NEYSNQKQLNSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVFYQPPTNPEFYSEVV 656
           NEYS Q++LNSNR+LFQQGR KVLLYTERLHH+RRYE+KGVKSVVFY+PPTNPEFY+EVV
Sbjct: 610 NEYSEQRELNSNRSLFQQGRVKVLLYTERLHHYRRYELKGVKSVVFYKPPTNPEFYNEVV 669

Query: 657 RFIAKSAALGTTDLNISTVRTIYSKLDGISLERIVGTKRAAILTHGQNEVYEFK 710
           R+I KSA LG  DLNISTVRT+Y KLDG+SLERIVG+KRA IL H QNEVYEF+
Sbjct: 670 RYIGKSAFLGNADLNISTVRTLYCKLDGLSLERIVGSKRAGILCHAQNEVYEFQ 723

>KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.292
           YIL091C
          Length = 721

 Score =  842 bits (2176), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/720 (58%), Positives = 519/720 (72%), Gaps = 24/720 (3%)

Query: 14  NGTLKRGRKELRSIRRPQRNKAHEEPEHLNESSE----GEVKNHHNGMQHXXXXXXXXXX 69
           N + KRGRKELR ++R  +  A ++P   +   E    G      N              
Sbjct: 3   NRSGKRGRKELRHLKRTTKRPAIDDPPRESAPVEDDFVGPADQMVNVSDSAEDGDGSDSD 62

Query: 70  XXXKRRKVYGALLTILNSEHPKPKPKQEVTVQSRKXXXXXXXXXXXXXXXXXXXXNLARV 129
              ++ KVYGALLTIL SEHP+ K K++    S                         ++
Sbjct: 63  AEARKGKVYGALLTILKSEHPEAK-KRKTKKSSDGGEVDKILVHDDNHEELEEENEEEQI 121

Query: 130 DENPXXXXXXXXXXXXXXXXXXTFDS---------HFNQVPENVVDKLDAAFKERQLKYK 180
           D                      FDS         HFNQ PE  ++ LDAAFK +QL+Y+
Sbjct: 122 DNAILDNRTQSDSEDEQDVAAEEFDSEDEQDPFESHFNQFPETEINTLDAAFKSKQLQYR 181

Query: 181 S-----AKVPIGENESMVYSKPLLLEDQ--SKKLEIPSRHESLKSYVFKQRLKIQNDL-- 231
           S     AKV   ++E ++YS+P +   +  SKKL   +   S+ SY  K+RLKIQNDL  
Sbjct: 182 SVKLQPAKVTKVKDEYLIYSEPTVPGGKQLSKKLIESNTKCSIGSYFLKKRLKIQNDLLE 241

Query: 232 -EHENLTSTQRTLVDPMLQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYKTRDKILKNN 290
            + +NL S Q+ LVDPM QY D+LYEY +Y K EDEYR LYALH LNHVYKTRD+ILKNN
Sbjct: 242 NKPDNLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVYKTRDRILKNN 301

Query: 291 QRISDNPDADYLDQGFTRPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKGKFRDQFFEE 350
           QR+ +N D + LDQGFTRPKVLI+ PTRDTAY ++  II+KSGIDQ+DK+GKF+DQF+E+
Sbjct: 302 QRLQENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKRGKFKDQFYED 361

Query: 351 SLXXXXXXXXFQHVFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQLILENT 410
           SL        FQ +FKGNTNDFFVLG+KFTRKAIKLYSNFYQSDII+CSPLG+Q+I+ENT
Sbjct: 362 SLPPSSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENT 421

Query: 411 DKKKRQDDFLSSIEISIFDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDFGRVRLWYIN 470
           DKKKRQDDFLSSIEI+I DQLHSIEYQN+SH+ TIF+HLN IP EQHD DF R+R+WYIN
Sbjct: 422 DKKKRQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDADFSRIRMWYIN 481

Query: 471 EQAKLFRQTMIFTKYVSPTANALINNKCQNMTGRWKNHHFIEPNQSSIGKLGLKVRQIFQ 530
           +QA+ FRQTM+FTKY+SPTAN++IN KC+N +GRWKNH  +    S IGKL L+VRQIFQ
Sbjct: 482 DQARFFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVRQIFQ 541

Query: 531 RIDLGAASILEESDFRFKFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRVRNYMKEKTT 590
           R ++   SI++E D+RFKFFTSVIIP I+KSTGYEDGIL+YIP+Y D++RVRNY+KEKT 
Sbjct: 542 RFEVTGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLKEKTR 601

Query: 591 IIFGDINEYSNQKQLNSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVFYQPPTNPE 650
           I+FGDINEYS+QKQL +NR+LFQQGR KVLLYTERLHH+RRYEIKGVKSV+FY+PP++PE
Sbjct: 602 ILFGDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPPSDPE 661

Query: 651 FYSEVVRFIAKSAALGTTDLNISTVRTIYSKLDGISLERIVGTKRAAILTHGQNEVYEFK 710
           FY+EVVR I ++A LG TDLNISTVR IYSKLD ++LE +VGT+RA +L HGQNE+YEFK
Sbjct: 662 FYTEVVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLCHGQNEIYEFK 721

>CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091c
          Length = 700

 Score =  825 bits (2130), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/703 (58%), Positives = 506/703 (71%), Gaps = 15/703 (2%)

Query: 18  KRGRKELRSIRRPQRNKAHEEPEHLNESSEGEVKNHHNGMQHXXXXXXXXXXXXXKRRKV 77
           KRGRKELRSIRR +R K   E +   ESS G V      ++               + +V
Sbjct: 3   KRGRKELRSIRRAKRTKIEPEADAGVESS-GSVLEAGPAVEEKVQDDGEKEDD---KEQV 58

Query: 78  YGALLTILNSEHPKPKPKQEVTVQSRKXXXXXXXXXXXXXXXXXXXXNLARVDENPXXXX 137
           Y ALLTIL SEH + K K        +                         D++     
Sbjct: 59  YNALLTILKSEHKEDKVKTHRDHDEEESEAEEEEQAEDQYNDAFADGESDDEDDDEDEQA 118

Query: 138 XXXXXXXXXXXXXXTFDSHFN-QVPENVVDKLDAAFKERQLKYKSAKVPIGE------NE 190
                          FD+HFN +      + L  A K+ +L+YKS K+ +G        E
Sbjct: 119 QEQEEIESDDEEKDPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQE 178

Query: 191 SMVYSKPLLLEDQSKKLEIPSRHESLKSYVFKQRLKIQNDL---EHENLTSTQRTLVDPM 247
             ++S P + E ++ K+E P    SL SY  K+RL+IQN+L   E   LT  QR +VDPM
Sbjct: 179 DAIFSVPYI-EGETPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPM 237

Query: 248 LQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYKTRDKILKNNQRISDNPDADYLDQGFT 307
           +QY D+LYEY++Y KDEDEYRDLY LHVLNHVYKTRDKI+KNNQ++ DNPD+++LDQGFT
Sbjct: 238 MQYKDILYEYDTYGKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFT 297

Query: 308 RPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKGKFRDQFFEESLXXXXXXXXFQHVFKG 367
           RPKVLI+ PTRD+AYQ++ K+I+KSG+DQ+DKKGKFRDQF++ S         FQH+FKG
Sbjct: 298 RPKVLIIAPTRDSAYQIVTKLIEKSGLDQVDKKGKFRDQFYDPSFPPSSKPKSFQHIFKG 357

Query: 368 NTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIEISI 427
           NTND+FVLGVKFTRKAIKLYSNFYQSDII+CSPLG+Q+I+ENTDKKKRQDDFLSS+E++I
Sbjct: 358 NTNDYFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTI 417

Query: 428 FDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDFGRVRLWYINEQAKLFRQTMIFTKYVS 487
            DQ HSIEYQN +H+ TIFDHLN IPQEQHD DF R+R+WYIN+QAK FRQTMIFTKY+S
Sbjct: 418 IDQFHSIEYQNYTHLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYIS 477

Query: 488 PTANALINNKCQNMTGRWKNHHFIEPNQSSIGKLGLKVRQIFQRIDLGAASILEESDFRF 547
           P AN+L+N KC+N+ GRWKNH  +    SS+G +GLKVRQIFQR ++   S+ +E D+RF
Sbjct: 478 PVANSLLNIKCRNLEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRF 537

Query: 548 KFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRVRNYMKEKTTIIFGDINEYSNQKQLNS 607
           KFFTSV+I +I KSTGY+DG L+YIP+Y+D++RVRNYMKEKT+I+FGDINEYS Q+ L S
Sbjct: 538 KFFTSVVISNITKSTGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTS 597

Query: 608 NRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVFYQPPTNPEFYSEVVRFIAKSAALGT 667
           NR LF QGR KVLLYTERLHHFRRYE+KGVK+VVFY+PP++PEFY EVVR+I K+  LG 
Sbjct: 598 NRTLFNQGRLKVLLYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGD 657

Query: 668 TDLNISTVRTIYSKLDGISLERIVGTKRAAILTHGQNEVYEFK 710
            DLNISTVR  YSKLDG++LE+IVGTKR  +LTHGQNE YEFK
Sbjct: 658 ADLNISTVRCCYSKLDGLALEKIVGTKRTGVLTHGQNETYEFK 700

>TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.292
           YIL091C
          Length = 716

 Score =  823 bits (2126), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/562 (67%), Positives = 473/562 (84%), Gaps = 4/562 (0%)

Query: 153 FDSHFNQVPENVVDKLDAAFKERQLKYKSAKV--PIGENESMVYSKPLLLEDQSKKLEIP 210
           FD HFNQVPENVVDK+   F  +++KY S K+  P  E +  +YSKP++ +    K+E P
Sbjct: 155 FDIHFNQVPENVVDKISNGFDNKKIKYVSKKIQLPHHEKDFFIYSKPIVDDGNKHKVESP 214

Query: 211 SRHESLKSYVFKQRLKIQNDL--EHENLTSTQRTLVDPMLQYNDLLYEYNSYEKDEDEYR 268
            +  SL SY  K+RL+I N+L    +NLT  Q++LVDPM QY D+L+EY +Y  DE EYR
Sbjct: 215 IKKSSLDSYFIKKRLEITNNLLDGKDNLTKLQKSLVDPMFQYVDILHEYENYGSDEQEYR 274

Query: 269 DLYALHVLNHVYKTRDKILKNNQRISDNPDADYLDQGFTRPKVLIVVPTRDTAYQVLEKI 328
           +LY LH+LNH+YKTRDK+LK+NQR+ +N ++++LDQGFTRPKVLIVVPTRDTAY V+E I
Sbjct: 275 ELYTLHILNHLYKTRDKVLKDNQRLQENNESEFLDQGFTRPKVLIVVPTRDTAYNVVETI 334

Query: 329 IDKSGIDQIDKKGKFRDQFFEESLXXXXXXXXFQHVFKGNTNDFFVLGVKFTRKAIKLYS 388
           I KSG+DQ++KKGKF+ QFFE+SL        FQ +FKGNTNDFFVLG+KFTRKA+KLYS
Sbjct: 335 IRKSGLDQVEKKGKFKSQFFEDSLPPSSKPKSFQSIFKGNTNDFFVLGLKFTRKALKLYS 394

Query: 389 NFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIEISIFDQLHSIEYQNVSHVMTIFDH 448
           NFYQSD+IICSPLG+ +I ENTDKKK+QDDFLSSIEI+I DQLHS+EYQN+SH+M IF+H
Sbjct: 395 NFYQSDVIICSPLGLHMITENTDKKKKQDDFLSSIEITILDQLHSMEYQNISHIMNIFEH 454

Query: 449 LNLIPQEQHDTDFGRVRLWYINEQAKLFRQTMIFTKYVSPTANALINNKCQNMTGRWKNH 508
           LN IP+EQHD DF R+R+WYIN+QA+LFRQTMIFTKYVSPTANA+IN KC+N+ GRW+N 
Sbjct: 455 LNKIPREQHDADFSRIRMWYINDQARLFRQTMIFTKYVSPTANAMINGKCRNIAGRWRNK 514

Query: 509 HFIEPNQSSIGKLGLKVRQIFQRIDLGAASILEESDFRFKFFTSVIIPSIIKSTGYEDGI 568
             +   +SS+GKLGLK+RQIFQR DL   ++ +E DFRFKFF SV++ SI+KSTGYEDGI
Sbjct: 515 IQLTSEESSLGKLGLKIRQIFQRFDLVGGTLADEPDFRFKFFVSVVMNSILKSTGYEDGI 574

Query: 569 LVYIPDYADFIRVRNYMKEKTTIIFGDINEYSNQKQLNSNRALFQQGRAKVLLYTERLHH 628
           LVYIP+Y+D++RVRNYMKEKTT++FGDINEYS+Q++LNSNR+LFQQGR KVLLYTERLHH
Sbjct: 575 LVYIPNYSDYMRVRNYMKEKTTLLFGDINEYSDQRELNSNRSLFQQGRVKVLLYTERLHH 634

Query: 629 FRRYEIKGVKSVVFYQPPTNPEFYSEVVRFIAKSAALGTTDLNISTVRTIYSKLDGISLE 688
           +RRYEIKGVKSV+FY PPTNPEFY+EVVRFI K+A LG  D+NI+TVR +YSKLD +SLE
Sbjct: 635 YRRYEIKGVKSVIFYGPPTNPEFYNEVVRFIGKNAFLGNVDINIATVRMVYSKLDSLSLE 694

Query: 689 RIVGTKRAAILTHGQNEVYEFK 710
           RIVGT+RAA+L+  +NEVYEFK
Sbjct: 695 RIVGTQRAAVLSRAENEVYEFK 716

 Score = 40.8 bits (94), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 37/80 (46%), Gaps = 7/80 (8%)

Query: 18 KRGRKELRSIRRPQ----RNKAHE---EPEHLNESSEGEVKNHHNGMQHXXXXXXXXXXX 70
          KRGR +LR+I+R +    RN         +H +ES   +        +            
Sbjct: 9  KRGRSQLRTIQRSKYAKKRNSGRNYDTNTKHNDESKPADALVSGEEAESESDDAKDEEDV 68

Query: 71 XXKRRKVYGALLTILNSEHP 90
            KR +VYGALLTIL SEHP
Sbjct: 69 GKKRNQVYGALLTILKSEHP 88

>KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 747

 Score =  824 bits (2128), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/561 (67%), Positives = 458/561 (81%), Gaps = 3/561 (0%)

Query: 152 TFDSHFNQVPENVVDKLDAAFKERQLKYKSAKVPIGENESMVYSKPLLLEDQSKKLEIPS 211
           T + HFN V E   + LDAAFK ++++Y+S K+ + +N+  +YS+P L+ + +  +  P 
Sbjct: 188 TLEIHFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDKNQEFIYSRPTLVNEPASAVSAPD 247

Query: 212 RHESLKSYVFKQRLKIQNDL--EHENLTSTQRTLVDPMLQYNDLLYEYNSYEKDEDEYRD 269
             +SL SY  KQRLKIQNDL    + LT  Q+ +VDPM QY DLLYEY  Y+K E EYRD
Sbjct: 248 GSQSLNSYFIKQRLKIQNDLLDSQDKLTPLQKQIVDPMFQYQDLLYEYEDYDK-ETEYRD 306

Query: 270 LYALHVLNHVYKTRDKILKNNQRISDNPDADYLDQGFTRPKVLIVVPTRDTAYQVLEKII 329
           LYALHVLNH+YKTRD+ILKNNQR+ +NPD + LDQGFTRPKVLIV PTRD AY +L KII
Sbjct: 307 LYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVAPTRDAAYDILSKII 366

Query: 330 DKSGIDQIDKKGKFRDQFFEESLXXXXXXXXFQHVFKGNTNDFFVLGVKFTRKAIKLYSN 389
            KSG+DQ+DKK KF+DQFF+E+L        FQ +FKGNTNDFFVLG KFTRK IKLYSN
Sbjct: 367 QKSGLDQVDKKAKFKDQFFQEALPPSYKPKSFQQLFKGNTNDFFVLGAKFTRKTIKLYSN 426

Query: 390 FYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIEISIFDQLHSIEYQNVSHVMTIFDHL 449
           FYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIE+ + DQLHSIE+QN+ H+ +IF+H+
Sbjct: 427 FYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIEFQNMLHLTSIFEHI 486

Query: 450 NLIPQEQHDTDFGRVRLWYINEQAKLFRQTMIFTKYVSPTANALINNKCQNMTGRWKNHH 509
           N IPQ+QHD DF R+++WYIN+QAKLFRQT+IFTK+ SP AN+LIN KC+N  GRWKNH 
Sbjct: 487 NKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLINGKCRNYAGRWKNHR 546

Query: 510 FIEPNQSSIGKLGLKVRQIFQRIDLGAASILEESDFRFKFFTSVIIPSIIKSTGYEDGIL 569
            I P  SS+G+LG++ R IFQR DL   S+ EE D RFK F SVI+P+I+KSTGYEDGIL
Sbjct: 547 VIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIVPNIVKSTGYEDGIL 606

Query: 570 VYIPDYADFIRVRNYMKEKTTIIFGDINEYSNQKQLNSNRALFQQGRAKVLLYTERLHHF 629
           +YIPDY DF+RVRNY++EKTTI+FGDINEYS Q+QL SNRA+FQQGR KVLLYTERLHHF
Sbjct: 607 LYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQGRVKVLLYTERLHHF 666

Query: 630 RRYEIKGVKSVVFYQPPTNPEFYSEVVRFIAKSAALGTTDLNISTVRTIYSKLDGISLER 689
           RRYEIKGVK+V+FY+PPTNPEF+ EV R++ KSA LG  DLNIS VR ++SKLDG+SLER
Sbjct: 667 RRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVVRCLFSKLDGLSLER 726

Query: 690 IVGTKRAAILTHGQNEVYEFK 710
           IVGT+RAA+LTHG NE YEFK
Sbjct: 727 IVGTERAAVLTHGPNETYEFK 747

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 8/85 (9%)

Query: 18  KRGRKELRSIRR---PQRNKAHEEPEHLNESSEGEVKNHHNGMQHXXXXXXXXXXXXXKR 74
           K GRK+LR+IR+   P+R  A E     N  SE E ++     +                
Sbjct: 21  KSGRKQLRTIRKASGPRRGLAEESANEENNGSETEAEDKLAAPELNEPAQDQRAGG---- 76

Query: 75  RKVYGALLTILNSEHPKPKPKQEVT 99
            + Y ALLT+L +EH  P  ++  T
Sbjct: 77  -EAYAALLTLLKAEHGGPARRKTKT 100

>KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 704

 Score =  821 bits (2121), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/708 (58%), Positives = 505/708 (71%), Gaps = 27/708 (3%)

Query: 18  KRGRKELRSIRRPQRNKAHEEPE----HLNESSEGEVKNHHNGMQHXXXXXXXXXXXXXK 73
           K GRK+LR I R  + +   + E     L   +E +  N    +                
Sbjct: 9   KSGRKQLREITRAGQKRVRYDDEATVADLTPDNESDSDNAEPSV------AAEREDVEQH 62

Query: 74  RRKVYGALLTILNSEHPK---------PKPKQEVTVQSRKXXXXXXXXXXXXXXXXXXXX 124
           R + Y ALLT+L SEHP+          K  Q     S +                    
Sbjct: 63  RGQAYNALLTLLKSEHPERKHKSNKKIKKDSQRAEEDSPENDGINSEDEQQNIENALDDV 122

Query: 125 NLARVDENPXXXXXXXXXXXXXXXXXXTFDSHFNQVPENVVDKLDAAFKERQLKYKSAKV 184
           +   VDE                     F+SHF++  E+ +   D  FK++ +KYKS+K 
Sbjct: 123 SGGVVDEE--DMEDSLSDVDESEDESDPFESHFSKYSESRLYAFDKGFKDKTVKYKSSKT 180

Query: 185 PIGENESMVYSKPLLLEDQSKKLEIPSRHESLKSYVFKQRLKIQNDLEHENL--TSTQRT 242
            + E ES++YSKP L  D  + L +  + ++L SY  KQ+LK+ ND ++  L  T  Q+ 
Sbjct: 181 DVSEEESLIYSKPCL--DDEEVLPVKGK-QTLSSYFIKQKLKLANDFQNNGLPLTEIQKE 237

Query: 243 LVDPMLQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYKTRDKILKNNQRISDNPDADYL 302
           LVDPM QY D+LYEY+ Y  DED+YRDLY+LH LNHVYKTRD+ILKNNQ++ +N D + L
Sbjct: 238 LVDPMFQYKDMLYEYDDY-ADEDQYRDLYSLHALNHVYKTRDRILKNNQKLQENNDEELL 296

Query: 303 DQGFTRPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKGKFRDQFFEESLXXXXXXXXFQ 362
           DQGFTRPKVLIVVPTRD A++++ KI++KSG+DQ DKK KF DQFFE+SL        FQ
Sbjct: 297 DQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTSKPKSFQ 356

Query: 363 HVFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSS 422
           H+F+GNTNDFFVLG+KFTRK++K+YSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSS
Sbjct: 357 HIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSS 416

Query: 423 IEISIFDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDFGRVRLWYINEQAKLFRQTMIF 482
           IE+ I DQLHSIEYQN  HV TIF H+N IP++Q + DF R+R+WYINEQAK FRQT++F
Sbjct: 417 IEVMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFFRQTIVF 476

Query: 483 TKYVSPTANALINNKCQNMTGRWKNHHFIEPNQSSIGKLGLKVRQIFQRIDLGAASILEE 542
           TKY+SP AN+++N KC+N+ GRWKNH  I+P QSSIG+LGLKVRQIFQR DL   + L+E
Sbjct: 477 TKYISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAGGTALDE 536

Query: 543 SDFRFKFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRVRNYMKEKTTIIFGDINEYSNQ 602
            D+RFKFFTSVI+PSI+KSTGYEDGIL+YIPDY DFIRVRNY+KEKTTIIFG+INEYSNQ
Sbjct: 537 PDYRFKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEINEYSNQ 596

Query: 603 KQLNSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVFYQPPTNPEFYSEVVRFIAKS 662
           KQL SNRA FQ G+ KVLLYTERLHHFRRYEIK VKSV+FY+PP NPEFYSEVVR I K+
Sbjct: 597 KQLTSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVVRNIGKN 656

Query: 663 AALGTTDLNISTVRTIYSKLDGISLERIVGTKRAAILTHGQNEVYEFK 710
             LG  D+NISTVR IYSK+DG+SLER+VG+KRAA+L HGQNEVYEFK
Sbjct: 657 VFLGNCDINISTVRCIYSKMDGLSLERVVGSKRAAVLAHGQNEVYEFK 704

>Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091C -
           Protein required for cell viability [contig 27] FULL
          Length = 727

 Score =  817 bits (2111), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/560 (67%), Positives = 460/560 (82%), Gaps = 3/560 (0%)

Query: 153 FDSHFNQVPENVVDKLDAAFKERQLKYKSAKVPIGENESMVYSKPLLLEDQSKKLEIPSR 212
            ++HFN VPE   D LD AFK +Q++Y+S+K+ I +NE  +YS+P L  +    +++P  
Sbjct: 169 LEAHFNSVPEKDTDALDQAFKTKQVRYRSSKIKISKNEEFIYSRPDLNLESRTPIQVPQG 228

Query: 213 HESLKSYVFKQRLKIQNDL--EHENLTSTQRTLVDPMLQYNDLLYEYNSYEKDEDEYRDL 270
            +SL  Y  KQRLKIQNDL     NLT  Q+ +VDP+ QY DLLYEY +Y++ E EYRDL
Sbjct: 229 TQSLSPYFIKQRLKIQNDLLDSKNNLTPLQKKIVDPIFQYQDLLYEYENYDQ-ETEYRDL 287

Query: 271 YALHVLNHVYKTRDKILKNNQRISDNPDADYLDQGFTRPKVLIVVPTRDTAYQVLEKIID 330
           YALH L+H+YKTRD+ILKNNQR+ DNPD + LDQGFTRPKVLIVVPTRD AY VL KII+
Sbjct: 288 YALHALDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVLSKIIE 347

Query: 331 KSGIDQIDKKGKFRDQFFEESLXXXXXXXXFQHVFKGNTNDFFVLGVKFTRKAIKLYSNF 390
           KSG+DQ+DKK KFRDQF+++SL        FQ VFKGNTNDFFVLG KFTRK IKLYSNF
Sbjct: 348 KSGLDQVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIKLYSNF 407

Query: 391 YQSDIIICSPLGIQLILENTDKKKRQDDFLSSIEISIFDQLHSIEYQNVSHVMTIFDHLN 450
           YQSDII+CSPLGIQLILENTDKKKRQDDFLSSIE+ + DQLHSIE+QNV H+ +IF+H+N
Sbjct: 408 YQSDIIVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSIFEHIN 467

Query: 451 LIPQEQHDTDFGRVRLWYINEQAKLFRQTMIFTKYVSPTANALINNKCQNMTGRWKNHHF 510
            IPQ+QHD DF R+++WYIN+QAKLFRQT+IFT++ +P AN+LIN KC+N  GRWKNH  
Sbjct: 468 KIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWKNHTI 527

Query: 511 IEPNQSSIGKLGLKVRQIFQRIDLGAASILEESDFRFKFFTSVIIPSIIKSTGYEDGILV 570
           +   +SS+ +LG++ R +FQR D+   +  +E DFRFK F SVI+P+I++STGYEDGIL+
Sbjct: 528 VGAEKSSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYEDGILL 587

Query: 571 YIPDYADFIRVRNYMKEKTTIIFGDINEYSNQKQLNSNRALFQQGRAKVLLYTERLHHFR 630
           YIPDY DFIRVRNY++EKTTI+FGDI+EYS Q+QL +NRALFQQGR KVLLYTERLHHFR
Sbjct: 588 YIPDYTDFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTERLHHFR 647

Query: 631 RYEIKGVKSVVFYQPPTNPEFYSEVVRFIAKSAALGTTDLNISTVRTIYSKLDGISLERI 690
           RYEIKGVK+V+FY+PPTNPEF+ E VR++AKSA LG  DLNIS VR +YSKLDG++LERI
Sbjct: 648 RYEIKGVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGLALERI 707

Query: 691 VGTKRAAILTHGQNEVYEFK 710
           VGT+RAAILTHG NE YEFK
Sbjct: 708 VGTERAAILTHGPNETYEFK 727

>Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}
           similar to Ashbya gossypii ADL209C
          Length = 708

 Score =  788 bits (2036), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/710 (55%), Positives = 510/710 (71%), Gaps = 22/710 (3%)

Query: 18  KRGRKELRSIRRPQRNKAHEEPEHLNESSEGEVKNHHNGMQHXXXXXXXXXXXX-----X 72
           KRGRK+LR I R  RN++ ++       S  E + +++G ++                  
Sbjct: 4   KRGRKQLRKITRIGRNRSEDKAN----GSALEKRGNNDGDEYAEIAMGEHEKAADDDQEE 59

Query: 73  KRRKVYGALLTILNSEHPKPKPKQEVTVQSRKXXXXXXXXXXXXXXXXXXXXNLARVDEN 132
           +   VYGALL+ILNS HP+ + K+    ++                        A +D++
Sbjct: 60  RTAHVYGALLSILNSAHPEIRRKRVKVEKTTDAVVEERKNGSRNYETDEVATISASLDDS 119

Query: 133 PXXXXXXXXXXXXXXXXXXT------FDSHFNQVPENVVDKLDAAFKERQLKYKSAKVP- 185
                              +      F+ HFNQ+ E   +KLDAAFKE+ ++Y+S K+P 
Sbjct: 120 VDKDEEVEEDDGVYSDGEDSEDERDPFEYHFNQISEMDTNKLDAAFKEKTVQYESTKLPY 179

Query: 186 IGENESMVYSKPLL--LEDQSKKLEIPSRHESLKSYVFKQRLKIQNDL---EHENLTSTQ 240
           + +NE  ++SKP++  L+      + P    ++ SY  K++LK+ N L   + + LT   
Sbjct: 180 MHDNEGFIFSKPVIEGLKGSDAVNDTPVCKGNIHSYFMKKKLKVHNGLLDDKKKPLTPLS 239

Query: 241 RTLVDPMLQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYKTRDKILKNNQRISDNPDAD 300
           +TLVDP+ QY DLL+EY  + + E EYRDLY LH+LNH+YKTRD+ILKNN ++ +N D +
Sbjct: 240 KTLVDPIFQYRDLLFEYEDFSQ-ETEYRDLYTLHILNHIYKTRDRILKNNHKLQENDDQE 298

Query: 301 YLDQGFTRPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKGKFRDQFFEESLXXXXXXXX 360
            LDQGFTRPKVL+V PTR+TAY ++EKIIDKSG+DQ+DKK KF+DQF+E+SL        
Sbjct: 299 LLDQGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYEDSLPPTSKPKS 358

Query: 361 FQHVFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFL 420
           FQHVFKGNTNDFFVLG+KFTRK +KLYSNFYQSD+I+CSPLGIQLILENTDKKKRQDDFL
Sbjct: 359 FQHVFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENTDKKKRQDDFL 418

Query: 421 SSIEISIFDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDFGRVRLWYINEQAKLFRQTM 480
           SSIE+ + DQLHS+E+QN +HV++IF H+N IPQ+QHD+DF R+R+WYIN+QA+LFRQT+
Sbjct: 419 SSIEMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQARLFRQTL 478

Query: 481 IFTKYVSPTANALINNKCQNMTGRWKNHHFIEPNQSSIGKLGLKVRQIFQRIDLGAASIL 540
           IFTKYVSP AN+LIN KC N +GR+KN  +I P +S+I +LGLKVRQ+F R DL   S +
Sbjct: 479 IFTKYVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFHRFDLFTGSSV 538

Query: 541 EESDFRFKFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRVRNYMKEKTTIIFGDINEYS 600
           +E D+RFKFFTSV +P I KSTGYEDGIL+YIPDY DF+RVRNY K++T I+FG+I EYS
Sbjct: 539 DEPDYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTRILFGEITEYS 598

Query: 601 NQKQLNSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVFYQPPTNPEFYSEVVRFIA 660
           +Q+Q+ SNRALFQQG+ KVLLYTERLHHFRRY+IKGVKSV+FY+PP+NPEFY E++R I 
Sbjct: 599 DQRQVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPEFYQELIRCIG 658

Query: 661 KSAALGTTDLNISTVRTIYSKLDGISLERIVGTKRAAILTHGQNEVYEFK 710
           K+A LG  DLNISTVR  Y KLD +SLERIVG+KRAA+LT  QNE+YEFK
Sbjct: 659 KNAFLGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK 708

>ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL091C
          Length = 704

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/705 (55%), Positives = 500/705 (70%), Gaps = 25/705 (3%)

Query: 18  KRGRKELRSIRR------PQRNKAHEEPEH-LNESSEGEVKNHHNGMQHXXXXXXXXXXX 70
           KRGRK+LR+I R       Q ++A    EH + E+  GE  ++     H           
Sbjct: 13  KRGRKQLRNITRIGRAIHVQEDEAKSREEHTVEEAQAGEQTSNRKRGNHPAEDDGGA--- 69

Query: 71  XXKRRKVYGALLTILNSEHPKPKPKQEVTVQSRKXXXXXXXXXXXXXXXXXXXXNLARVD 130
             +  + YGALLT+L++EH K + K+      +                      L    
Sbjct: 70  --RESQSYGALLTLLSAEHGKQRKKR----LRKAEAEAAEAAEAGEDPEEAITAALENSA 123

Query: 131 ENPXXXXXXXXXXXXXXXXXXTFDSHFNQVPENVVDKLDAAFKERQLKYKSAKVPIGENE 190
           ++                    FD HFN+V    V +LDAAFK  + +Y+  K   GE E
Sbjct: 124 QDAEDAEDAFDDSGESDEEQDHFDVHFNRVSAADVAQLDAAFKNGRAQYRVQKEARGEEE 183

Query: 191 SMVYSKPLLL-EDQSKKLEIPSRHESLKSYVFKQRLKIQNDLEHEN----LTSTQRTLVD 245
            ++YSKP+   E     + +P+R  SL+ Y  KQRL++ N L  ++    LT  Q+ L+D
Sbjct: 184 -ILYSKPVASSEGTEGPVRVPAR--SLRGYAIKQRLRMHNGLTADDPEKPLTPQQKVLLD 240

Query: 246 PMLQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYKTRDKILKNNQRISDNPDADYLDQG 305
           PM QY D+LYEY  Y++ E EYR+LY LH+LNHVYKTRD+ILKNNQ++ DNPD + LDQG
Sbjct: 241 PMFQYQDILYEYEGYDR-EREYRELYTLHILNHVYKTRDRILKNNQKLQDNPDQELLDQG 299

Query: 306 FTRPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKGKFRDQFFEESLXXXXXXXXFQHVF 365
           FTRPK L+VVPTR TAY V++ ++ +SGI+Q+DKK KF+DQF++ SL        FQHVF
Sbjct: 300 FTRPKALVVVPTRATAYDVVDLLLQQSGIEQVDKKSKFKDQFYDPSLPPASKPKSFQHVF 359

Query: 366 KGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIEI 425
           KGNTNDFFVLG+KFTRKAI+LYSNFYQSD+I+CSPLG+QLI+ENTDKKKRQDDFLSSIE+
Sbjct: 360 KGNTNDFFVLGMKFTRKAIRLYSNFYQSDVIVCSPLGLQLIIENTDKKKRQDDFLSSIEV 419

Query: 426 SIFDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDFGRVRLWYINEQAKLFRQTMIFTKY 485
            + DQLHSIE+QN++HV  IF H+N IPQ+Q D DF R+R+WYI +QAKLFRQTM+FT+Y
Sbjct: 420 MVLDQLHSIEFQNIAHVSNIFAHINKIPQQQRDADFSRIRMWYIEDQAKLFRQTMVFTRY 479

Query: 486 VSPTANALINNKCQNMTGRWKNHHFIEPNQSSIGKLGLKVRQIFQRIDLGAASILEESDF 545
           +SP ANAL+N KC N  GR K+H  +   +S IG+LGLK+RQIFQR ++   S ++E DF
Sbjct: 480 ISPFANALLNRKCANWAGRVKSHRVVSAEKSVIGQLGLKLRQIFQRFEVLGGSTVDEPDF 539

Query: 546 RFKFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRVRNYMKEKTTIIFGDINEYSNQKQL 605
           RFKFFTSV++P I K+TGY+ GIL+YIP+Y DFIRVRNY+K+KT I+FGDINEYS+Q+QL
Sbjct: 540 RFKFFTSVVVPGIEKTTGYDSGILLYIPEYTDFIRVRNYLKDKTRILFGDINEYSDQRQL 599

Query: 606 NSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVFYQPPTNPEFYSEVVRFIAKSAAL 665
            SNRALFQ GR KVLLYTERLHHFRR+E+KGVKSV+ Y+PP+NPEFY E++R+I KSA L
Sbjct: 600 TSNRALFQLGRIKVLLYTERLHHFRRFELKGVKSVILYKPPSNPEFYQELLRYIGKSAFL 659

Query: 666 GTTDLNISTVRTIYSKLDGISLERIVGTKRAAILTHGQNEVYEFK 710
           G  DLNI+TVR +YSK+D ++LERIVGTKRAA+LTHGQNEVYEFK
Sbjct: 660 GVADLNIATVRCLYSKMDSLALERIVGTKRAAVLTHGQNEVYEFK 704

>TBLA0C05580 Chr3 (1351338..1352610,1353450..1353799) [1623 bp, 540
           aa] {ON} Anc_2.164 YNL112W
          Length = 540

 Score = 35.4 bits (80), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 46/203 (22%), Positives = 84/203 (41%), Gaps = 29/203 (14%)

Query: 469 INEQAKLFRQTMIFTKYVSPTANALINNKCQNMTGRWKNHHFIEPNQSSIGKLGLKVRQI 528
           I +Q +  RQT++++        A    + QN+   + N    +P Q  IG L L     
Sbjct: 284 IVDQIRPDRQTLMWS--------ATWPKEVQNLARDYLN----DPIQVQIGSLELAASHT 331

Query: 529 FQRIDLGAASILEESDFRFKFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRVRNYMKE- 587
             ++ +   +  E+ D   K          + S   E  ILV+         +  Y++E 
Sbjct: 332 ITQL-VEVITDFEKRDRMVKHLE-------VASQDKESKILVFASTKRTCDEITKYLRED 383

Query: 588 --KTTIIFGDINEYSNQKQLNSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVFYQP 645
                 I GD     +Q++ +   A F++GR+ +++ T+     R  ++KG+  V+ Y  
Sbjct: 384 GWPALAIHGD----KDQRERDWVLAEFREGRSPIMVATDVAA--RGIDVKGINYVINYDM 437

Query: 646 PTNPEFYSEVVRFIAKSAALGTT 668
           P N E Y   +    ++ A GT 
Sbjct: 438 PGNIEDYVHRIGRTGRAGATGTA 460

>TDEL0F01190 Chr6 (211677..212937,213454..213842) [1650 bp, 549 aa]
           {ON} Anc_2.164 YNL112W
          Length = 549

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 48/113 (42%), Gaps = 9/113 (7%)

Query: 559 IKSTGYEDGILVYIPDYADFIRVRNYMKE---KTTIIFGDINEYSNQKQLNSNRALFQQG 615
           I S   E  ILV+         +  Y+++       I GD ++      LN     F+ G
Sbjct: 350 IASQDKESKILVFASTKRTCDEITKYLRDDGWPALAIHGDKDQRERDWVLNE----FRTG 405

Query: 616 RAKVLLYTERLHHFRRYEIKGVKSVVFYQPPTNPEFYSEVVRFIAKSAALGTT 668
           R+ +++ T+     R  ++KG+  V+ Y  P N E Y   +    ++ A GT 
Sbjct: 406 RSPIMVATDVAA--RGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTA 456

>YGL015C Chr7 complement(465043..465435) [393 bp, 130 aa] {ON}
           Putative protein of unknown function; null mutants
           accumulate cargo in the Golgi
          Length = 130

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 3/59 (5%)

Query: 577 DFIRVRNYMKEKTTIIFGDINEYSNQKQLNSNRALFQQGRAKVLLYTERLHHFRRYEIK 635
           D IR  NY   +T+   G IN       L S+   F Q      +  ER+HHFR+++ K
Sbjct: 3   DTIRPLNYADIETS---GPINLLETTNNLKSSLKKFSQKAKGSHISRERIHHFRKWKNK 58

>Kpol_1005.11 s1005 complement(18157..19677) [1521 bp, 506 aa] {ON}
           complement(18157..19677) [1521 nt, 507 aa]
          Length = 506

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 52/111 (46%), Gaps = 12/111 (10%)

Query: 568 ILVYIPDYADFIRV---RNYMKEKTTIIFGDINEYSNQKQLNSNRALFQQGRAKVLLYTE 624
           I+V+    A+  R+    N ++   T + GD+N    Q Q   +  LF+ GR  +L+ T+
Sbjct: 329 IIVFTRTKANAERITTLANLLEFSATALHGDLN----QNQRTGSLDLFKAGRRSILVATD 384

Query: 625 RLHHFRRYEIKGVKSVVFYQPPTNPEFYSEVVRFIAKSAALGTTDLNISTV 675
                R  +I  V  V+ Y  P + + Y   +  + ++A  G +  +IS V
Sbjct: 385 --VAARGLDIPSVDIVINYDIPVDSKSY---IHRVGRTARAGRSGKSISLV 430

>KNAG0B04660 Chr2 complement(900857..902341) [1485 bp, 494 aa] {ON}
           Anc_5.337 YHR065C
          Length = 494

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 44/93 (47%), Gaps = 9/93 (9%)

Query: 583 NYMKEKTTIIFGDINEYSNQKQLNSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVF 642
           N ++   T + GD+N+      L+    LF+ GR  +L+ T+     R  +I  V  V+ 
Sbjct: 335 NLLQFSATALHGDLNQNQRTGALD----LFKAGRRSILVATD--VAARGLDIPSVDVVIN 388

Query: 643 YQPPTNPEFYSEVVRFIAKSAALGTTDLNISTV 675
           Y  P + + Y   +  + ++A  G +  +IS V
Sbjct: 389 YDIPVDSKSY---IHRVGRTARAGRSGKSISLV 418

>Kwal_33.14325 s33 (619599..621101) [1503 bp, 500 aa] {ON} YHR065C
           (RRP3) - RRP3 is a DEAD box gene homologous to eIF-4a
           which encodes an RNA-dependent ATPase possessing
           helicase activity which is not specific for RNA [contig
           104] FULL
          Length = 500

 Score = 31.6 bits (70), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 9/93 (9%)

Query: 583 NYMKEKTTIIFGDINEYSNQKQLNSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVF 642
           N ++  +T + GD+N    Q Q      LF+ GR  +L+ T+     R  +I  V  V+ 
Sbjct: 340 NLLEFSSTALHGDLN----QNQRTGALDLFKAGRRSILVATD--VAARGLDIPSVDIVIN 393

Query: 643 YQPPTNPEFYSEVVRFIAKSAALGTTDLNISTV 675
           Y  P + + Y   +  + ++A  G +  +IS V
Sbjct: 394 YDIPVDSKSY---IHRVGRTARAGRSGKSISLV 423

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 73,825,023
Number of extensions: 3324687
Number of successful extensions: 11338
Number of sequences better than 10.0: 70
Number of HSP's gapped: 11764
Number of HSP's successfully gapped: 91
Length of query: 710
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 593
Effective length of database: 40,065,477
Effective search space: 23758827861
Effective search space used: 23758827861
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)