Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G022102.291ON72723301e-41
NDAI0G006902.291ON72723125e-39
Cgla_YGOB_Anc_2.2912.291ON72723082e-38
NCAS0G037602.291ON72723065e-38
Suva_14.3222.291ON72723048e-38
Smik_14.3062.291ON72723013e-37
YNL024C-A (KSH1)2.291ON72723013e-37
ZYRO0A01980g2.291ON72722987e-37
Skud_14.3042.291ON72722943e-36
KNAG0H019702.291ON72722935e-36
KAFR0H032802.291ON72722882e-35
Kpol_1003.412.291ON72722873e-35
Kwal_YGOB_Anc_2.2912.291ON72722841e-34
KLLA0E08251g2.291ON72722832e-34
KLTH0G10472g2.291ON72722822e-34
TPHA0C034302.291ON72722813e-34
SAKL0E07568g2.291ON72722795e-34
TBLA0B069702.291ON72712752e-33
ADL210W2.291ON72722735e-33
Ecym_33302.291ON72722571e-30
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G02210
         (72 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G02210 Chr7 (434303..434521) [219 bp, 72 aa] {ON} Anc_2.291...   131   1e-41
NDAI0G00690 Chr7 (151360..151578) [219 bp, 72 aa] {ON} Anc_2.291...   124   5e-39
Cgla_YGOB_Anc_2.291 Chr13 complement(701547..701765) [219 bp, 72...   123   2e-38
NCAS0G03760 Chr7 complement(693645..693863) [219 bp, 72 aa] {ON}...   122   5e-38
Suva_14.322 Chr14 complement(569440..569655) [216 bp, 72 aa] {ON...   121   8e-38
Smik_14.306 Chr14 complement(548999..549214) [216 bp, 72 aa] {ON...   120   3e-37
YNL024C-A Chr14 complement(586602..586820) [219 bp, 72 aa] {ON} ...   120   3e-37
ZYRO0A01980g Chr1 (164037..164255) [219 bp, 72 aa] {ON} highly s...   119   7e-37
Skud_14.304 Chr14 complement(557335..557550) [216 bp, 72 aa] {ON...   117   3e-36
KNAG0H01970 Chr8 complement(347994..348212) [219 bp, 72 aa] {ON}...   117   5e-36
KAFR0H03280 Chr8 complement(626054..626272) [219 bp, 72 aa] {ON}...   115   2e-35
Kpol_1003.41 s1003 (99502..99720) [219 bp, 72 aa] {ON} (99502..9...   115   3e-35
Kwal_YGOB_Anc_2.291 s27 complement(830525..830743) [219 bp, 72 a...   114   1e-34
KLLA0E08251g Chr5 complement(744523..744741) [219 bp, 72 aa] {ON...   113   2e-34
KLTH0G10472g Chr7 (885262..885480) [219 bp, 72 aa] {ON} highly s...   113   2e-34
TPHA0C03430 Chr3 (751723..751941) [219 bp, 72 aa] {ON} Anc_2.291...   112   3e-34
SAKL0E07568g Chr5 complement(613454..613672) [219 bp, 72 aa] {ON...   112   5e-34
TBLA0B06970 Chr2 (1648736..1648954) [219 bp, 72 aa] {ON} Anc_2.2...   110   2e-33
ADL210W Chr4 (334320..334538) [219 bp, 72 aa] {ON} Syntenic homo...   109   5e-33
Ecym_3330 Chr3 (631388..631606) [219 bp, 72 aa] {ON} similar to ...   103   1e-30

>TDEL0G02210 Chr7 (434303..434521) [219 bp, 72 aa] {ON} Anc_2.291
          YNL024C-A
          Length = 72

 Score =  131 bits (330), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 63/72 (87%), Positives = 63/72 (87%)

Query: 1  MSALFNFKSXXXXXXXXXCSCTYVHAQWPSLLDRYKDHGVFGAFWKMARVGERASPYVSV 60
          MSALFNFKS         CSCTYVHAQWPSLLDRYKDHGVFGAFWKMARVGERASPYVSV
Sbjct: 1  MSALFNFKSLLQVILLLLCSCTYVHAQWPSLLDRYKDHGVFGAFWKMARVGERASPYVSV 60

Query: 61 ACILMAINQFNS 72
          ACILMAINQFNS
Sbjct: 61 ACILMAINQFNS 72

>NDAI0G00690 Chr7 (151360..151578) [219 bp, 72 aa] {ON} Anc_2.291
          YNL024C-A
          Length = 72

 Score =  124 bits (312), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 61/72 (84%)

Query: 1  MSALFNFKSXXXXXXXXXCSCTYVHAQWPSLLDRYKDHGVFGAFWKMARVGERASPYVSV 60
          MSALFNF+S         CSCTYVH+QWPS+LDRYKDHG  GAFWKMAR+GERASPYVS+
Sbjct: 1  MSALFNFRSLLQVILLLICSCTYVHSQWPSILDRYKDHGALGAFWKMARIGERASPYVSL 60

Query: 61 ACILMAINQFNS 72
          ACI+MAINQFNS
Sbjct: 61 ACIIMAINQFNS 72

>Cgla_YGOB_Anc_2.291 Chr13 complement(701547..701765) [219 bp, 72
          aa] {ON} ANNOTATED BY YGOB -
          Length = 72

 Score =  123 bits (308), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 59/72 (81%)

Query: 1  MSALFNFKSXXXXXXXXXCSCTYVHAQWPSLLDRYKDHGVFGAFWKMARVGERASPYVSV 60
          MSALFNF S         CSCTY+H QWPSLLDRYK+H + GAFWKMAR+GERASPYVSV
Sbjct: 1  MSALFNFASLLQVILLLICSCTYIHTQWPSLLDRYKNHDILGAFWKMARIGERASPYVSV 60

Query: 61 ACILMAINQFNS 72
          ACILMAINQFNS
Sbjct: 61 ACILMAINQFNS 72

>NCAS0G03760 Chr7 complement(693645..693863) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score =  122 bits (306), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 58/72 (80%)

Query: 1  MSALFNFKSXXXXXXXXXCSCTYVHAQWPSLLDRYKDHGVFGAFWKMARVGERASPYVSV 60
          MSALFNF S         CSCTYVH QWPSLLDRYKDH   GAFWKMAR+GERASPYVS+
Sbjct: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKDHEALGAFWKMARIGERASPYVSL 60

Query: 61 ACILMAINQFNS 72
          ACI+MAINQFNS
Sbjct: 61 ACIIMAINQFNS 72

>Suva_14.322 Chr14 complement(569440..569655) [216 bp, 72 aa] {ON}
          YNL024C-A (REAL)
          Length = 72

 Score =  121 bits (304), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 61/72 (84%)

Query: 1  MSALFNFKSXXXXXXXXXCSCTYVHAQWPSLLDRYKDHGVFGAFWKMARVGERASPYVSV 60
          MSALFNF+S         CSC+YVH QWPSLLDRYK+H VFGAFWKMAR+GERASPYVS+
Sbjct: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVFGAFWKMARIGERASPYVSL 60

Query: 61 ACILMAINQFNS 72
          ACILMAI+QFNS
Sbjct: 61 ACILMAISQFNS 72

>Smik_14.306 Chr14 complement(548999..549214) [216 bp, 72 aa] {ON}
          YNL024C-A (REAL)
          Length = 72

 Score =  120 bits (301), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 60/72 (83%)

Query: 1  MSALFNFKSXXXXXXXXXCSCTYVHAQWPSLLDRYKDHGVFGAFWKMARVGERASPYVSV 60
          MSALFNF+S         CSC+YVH QWPSLLDRYK+H V GAFWKMARVGERASPYVS+
Sbjct: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60

Query: 61 ACILMAINQFNS 72
          ACILMAI+QFNS
Sbjct: 61 ACILMAISQFNS 72

>YNL024C-A Chr14 complement(586602..586820) [219 bp, 72 aa] {ON}
          KSH1Essential protein suggested to function early in
          the secretory pathway; inviability is suppressed by
          overexpression of Golgi protein Tvp23p; ortholog of
          human Kish
          Length = 72

 Score =  120 bits (301), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 60/72 (83%)

Query: 1  MSALFNFKSXXXXXXXXXCSCTYVHAQWPSLLDRYKDHGVFGAFWKMARVGERASPYVSV 60
          MSALFNF+S         CSC+YVH QWPSLLDRYK+H V GAFWKMARVGERASPYVS+
Sbjct: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60

Query: 61 ACILMAINQFNS 72
          ACILMAI+QFNS
Sbjct: 61 ACILMAISQFNS 72

>ZYRO0A01980g Chr1 (164037..164255) [219 bp, 72 aa] {ON} highly
          similar to uniprot|Q8TGJ3 Saccharomyces cerevisiae
          YNL024C-A Identified by gene-trapping microarray-based
          expression analysis and genome-wide homology searching
          Length = 72

 Score =  119 bits (298), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 56/72 (77%), Positives = 59/72 (81%)

Query: 1  MSALFNFKSXXXXXXXXXCSCTYVHAQWPSLLDRYKDHGVFGAFWKMARVGERASPYVSV 60
          MSALFNFKS         CSCTYVHAQWPSLLDRYK HGV  AFWKMARVGERASPYVS+
Sbjct: 1  MSALFNFKSLLQVILLLLCSCTYVHAQWPSLLDRYKGHGVLSAFWKMARVGERASPYVSL 60

Query: 61 ACILMAINQFNS 72
          ACILMA++Q NS
Sbjct: 61 ACILMALSQLNS 72

>Skud_14.304 Chr14 complement(557335..557550) [216 bp, 72 aa] {ON}
          YNL024C-A (REAL)
          Length = 72

 Score =  117 bits (294), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 60/72 (83%)

Query: 1  MSALFNFKSXXXXXXXXXCSCTYVHAQWPSLLDRYKDHGVFGAFWKMARVGERASPYVSV 60
          MSALFNF+S         CSC+YVH QWPSLLDRYK+H V GAFWKMAR+GERASPYVS+
Sbjct: 1  MSALFNFRSLLQVLLLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARIGERASPYVSL 60

Query: 61 ACILMAINQFNS 72
          ACILMAI+QFNS
Sbjct: 61 ACILMAISQFNS 72

>KNAG0H01970 Chr8 complement(347994..348212) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score =  117 bits (293), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 53/72 (73%), Positives = 57/72 (79%)

Query: 1  MSALFNFKSXXXXXXXXXCSCTYVHAQWPSLLDRYKDHGVFGAFWKMARVGERASPYVSV 60
          MSALFNF S         CSCTYVH QWPSLLDRYK+H   GAFWKMAR+GERASPYVS+
Sbjct: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKEHEALGAFWKMARLGERASPYVSL 60

Query: 61 ACILMAINQFNS 72
          ACILMA+NQF S
Sbjct: 61 ACILMALNQFMS 72

>KAFR0H03280 Chr8 complement(626054..626272) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score =  115 bits (288), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 56/72 (77%)

Query: 1  MSALFNFKSXXXXXXXXXCSCTYVHAQWPSLLDRYKDHGVFGAFWKMARVGERASPYVSV 60
          MSALFNF S         CSCTY+H QWPSLL+RYKDH   G FWKMARVGER SPYVS+
Sbjct: 1  MSALFNFSSLLQVLLLLICSCTYIHTQWPSLLERYKDHEALGIFWKMARVGERGSPYVSL 60

Query: 61 ACILMAINQFNS 72
          ACILMA+NQFNS
Sbjct: 61 ACILMAVNQFNS 72

>Kpol_1003.41 s1003 (99502..99720) [219 bp, 72 aa] {ON}
          (99502..99720) [219 nt, 73 aa]
          Length = 72

 Score =  115 bits (287), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 57/72 (79%)

Query: 1  MSALFNFKSXXXXXXXXXCSCTYVHAQWPSLLDRYKDHGVFGAFWKMARVGERASPYVSV 60
          MSALFNF S         CS TY+H+QWPS LDRYKD  V GAFWK+AR+GERASPYVS+
Sbjct: 1  MSALFNFTSLLQVILLLICSSTYIHSQWPSFLDRYKDQSVLGAFWKLARIGERASPYVSL 60

Query: 61 ACILMAINQFNS 72
          ACI+MA+NQFNS
Sbjct: 61 ACIIMAVNQFNS 72

>Kwal_YGOB_Anc_2.291 s27 complement(830525..830743) [219 bp, 72
          aa] {ON} ANNOTATED BY YGOB -
          Length = 72

 Score =  114 bits (284), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 59/72 (81%)

Query: 1  MSALFNFKSXXXXXXXXXCSCTYVHAQWPSLLDRYKDHGVFGAFWKMARVGERASPYVSV 60
          MSALFNF++         CSCTY+H+QWPSLLDRYKDH + GAFWK AR+GERASPYVS+
Sbjct: 1  MSALFNFQALLQVLLLLICSCTYIHSQWPSLLDRYKDHSMLGAFWKCARIGERASPYVSL 60

Query: 61 ACILMAINQFNS 72
          ACI+MA+NQF +
Sbjct: 61 ACIIMAVNQFQT 72

>KLLA0E08251g Chr5 complement(744523..744741) [219 bp, 72 aa] {ON}
          highly similar to uniprot|Q8TGJ3 Saccharomyces
          cerevisiae YNL024C-A Identified by gene-trapping
          microarray-based expression analysis and genome-wide
          homology searching
          Length = 72

 Score =  113 bits (283), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 51/72 (70%), Positives = 57/72 (79%)

Query: 1  MSALFNFKSXXXXXXXXXCSCTYVHAQWPSLLDRYKDHGVFGAFWKMARVGERASPYVSV 60
          MSALFNFKS         CSCTY+HAQ PSLLDRYKD G+ G FWK AR+GERASPYVS+
Sbjct: 1  MSALFNFKSLLQVILLFICSCTYIHAQRPSLLDRYKDSGILGVFWKFARIGERASPYVSL 60

Query: 61 ACILMAINQFNS 72
          ACI MA++QFNS
Sbjct: 61 ACIAMAVSQFNS 72

>KLTH0G10472g Chr7 (885262..885480) [219 bp, 72 aa] {ON} highly
          similar to uniprot|Q8TGJ3 Saccharomyces cerevisiae
          YNL024C-A Identified by gene-trapping microarray-based
          expression analysis and genome-wide homology searching
          Length = 72

 Score =  113 bits (282), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 48/72 (66%), Positives = 59/72 (81%)

Query: 1  MSALFNFKSXXXXXXXXXCSCTYVHAQWPSLLDRYKDHGVFGAFWKMARVGERASPYVSV 60
          MSALFNF++         CSCTY+H+QWPSLLDRYK+H + GAFWK AR+GERASPYVS+
Sbjct: 1  MSALFNFQALLQVLLLLICSCTYIHSQWPSLLDRYKEHSMLGAFWKCARIGERASPYVSI 60

Query: 61 ACILMAINQFNS 72
          ACI+MA+NQF +
Sbjct: 61 ACIIMAVNQFQT 72

>TPHA0C03430 Chr3 (751723..751941) [219 bp, 72 aa] {ON} Anc_2.291
          YNL024C-A
          Length = 72

 Score =  112 bits (281), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 48/72 (66%), Positives = 56/72 (77%)

Query: 1  MSALFNFKSXXXXXXXXXCSCTYVHAQWPSLLDRYKDHGVFGAFWKMARVGERASPYVSV 60
          MSALFNF S         CS TY+H+QWPSL DRYKD GV   FWK++R+GERASPYVS+
Sbjct: 1  MSALFNFSSLLQVILLLICSSTYIHSQWPSLFDRYKDTGVLSTFWKLSRIGERASPYVSI 60

Query: 61 ACILMAINQFNS 72
          ACI+MA+NQFNS
Sbjct: 61 ACIIMAVNQFNS 72

>SAKL0E07568g Chr5 complement(613454..613672) [219 bp, 72 aa] {ON}
          similar to uniprot|Q8TGJ3 Saccharomyces cerevisiae
          YNL024C-A Identified by gene-trapping, microarray-based
          expression analysis, and genome-wide homology searching
          Length = 72

 Score =  112 bits (279), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 56/72 (77%)

Query: 1  MSALFNFKSXXXXXXXXXCSCTYVHAQWPSLLDRYKDHGVFGAFWKMARVGERASPYVSV 60
          MSALFNF+S         CSCTY+H QWPSLLDRYK+HG+   FWK ARVGERASPYVS+
Sbjct: 1  MSALFNFRSLLQVILLLICSCTYIHTQWPSLLDRYKNHGMLNVFWKFARVGERASPYVSL 60

Query: 61 ACILMAINQFNS 72
          ACI MAI+QF S
Sbjct: 61 ACICMAISQFKS 72

>TBLA0B06970 Chr2 (1648736..1648954) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score =  110 bits (275), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 56/71 (78%)

Query: 1  MSALFNFKSXXXXXXXXXCSCTYVHAQWPSLLDRYKDHGVFGAFWKMARVGERASPYVSV 60
          MSALF+F+S         CS TY+H QWPSLLDRYK+H   GAFWKMAR+GERASPYVS+
Sbjct: 1  MSALFSFRSMLQVILLLICSSTYIHCQWPSLLDRYKNHSTLGAFWKMARIGERASPYVSL 60

Query: 61 ACILMAINQFN 71
          ACI MAI+QFN
Sbjct: 61 ACIAMAISQFN 71

>ADL210W Chr4 (334320..334538) [219 bp, 72 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL024CX; YNL024CX
          was overlooked in Saccharomyces cerevisiae
          Length = 72

 Score =  109 bits (273), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 54/72 (75%)

Query: 1  MSALFNFKSXXXXXXXXXCSCTYVHAQWPSLLDRYKDHGVFGAFWKMARVGERASPYVSV 60
          MSALF F +         CS TYVHAQWPSLL+RYK+H V G FWK AR+GERASPYVS+
Sbjct: 1  MSALFKFSALLQVILLLICSSTYVHAQWPSLLERYKEHSVLGIFWKFARIGERASPYVSI 60

Query: 61 ACILMAINQFNS 72
          ACI MAINQ NS
Sbjct: 61 ACIAMAINQINS 72

>Ecym_3330 Chr3 (631388..631606) [219 bp, 72 aa] {ON} similar to
          Ashbya gossypii ADL210W
          Length = 72

 Score =  103 bits (257), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 48/72 (66%), Positives = 52/72 (72%)

Query: 1  MSALFNFKSXXXXXXXXXCSCTYVHAQWPSLLDRYKDHGVFGAFWKMARVGERASPYVSV 60
          MSALF F S         CS TYVH QWPSLL+RYK HGV   FWK AR+GERASPYVS+
Sbjct: 1  MSALFKFSSLLQIILLLICSSTYVHCQWPSLLERYKQHGVLSIFWKFARIGERASPYVSL 60

Query: 61 ACILMAINQFNS 72
          ACI+M  NQFNS
Sbjct: 61 ACIVMVANQFNS 72

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.134    0.453 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 5,924,650
Number of extensions: 153663
Number of successful extensions: 262
Number of sequences better than 10.0: 20
Number of HSP's gapped: 262
Number of HSP's successfully gapped: 20
Length of query: 72
Length of database: 53,481,399
Length adjustment: 45
Effective length of query: 27
Effective length of database: 48,321,429
Effective search space: 1304678583
Effective search space used: 1304678583
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 59 (27.3 bits)