Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G022002.290ON26126112950.0
ZYRO0A01958g2.290ON2632638661e-117
NCAS0B062402.290ON2602618381e-113
Kpol_1003.402.290ON2612618301e-112
KLTH0G10450g2.290ON2612628281e-111
YIL093C (RSM25)2.290ON2642427841e-105
Smik_9.862.290ON2642427821e-104
SAKL0E07590g2.290ON2602377751e-103
NDAI0B035402.290ON2612577751e-103
KAFR0J013502.290ON2642527721e-103
Suva_9.1062.290ON2642427691e-102
Kwal_27.115092.290ON2612627671e-102
Skud_9.802.290ON2642427631e-101
Ecym_33292.290ON2582627491e-99
KLLA0E08273g2.290ON2612637352e-97
TPHA0C034202.290ON2682497241e-95
CAGL0D04158g2.290ON2722547197e-95
TBLA0B059602.290ON2662597179e-95
KNAG0A054102.290ON2662407082e-93
ADL211C2.290ON2251795498e-70
AGR303W5.645ON94535676.0
Ecym_54865.645ON100233659.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G02200
         (261 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G02200 Chr7 complement(433032..433817) [786 bp, 261 aa] {ON...   503   0.0  
ZYRO0A01958g Chr1 complement(162742..163533) [792 bp, 263 aa] {O...   338   e-117
NCAS0B06240 Chr2 (1178232..1179014) [783 bp, 260 aa] {ON} Anc_2....   327   e-113
Kpol_1003.40 s1003 complement(97903..98688) [786 bp, 261 aa] {ON...   324   e-112
KLTH0G10450g Chr7 complement(884037..884822) [786 bp, 261 aa] {O...   323   e-111
YIL093C Chr9 complement(187990..188784) [795 bp, 264 aa] {ON}  R...   306   e-105
Smik_9.86 Chr9 complement(167101..167895) [795 bp, 264 aa] {ON} ...   305   e-104
SAKL0E07590g Chr5 (613875..614657) [783 bp, 260 aa] {ON} similar...   303   e-103
NDAI0B03540 Chr2 (890148..890933) [786 bp, 261 aa] {ON} Anc_2.29...   303   e-103
KAFR0J01350 Chr10 (247931..248725) [795 bp, 264 aa] {ON} Anc_2.2...   301   e-103
Suva_9.106 Chr9 complement(182086..182880) [795 bp, 264 aa] {ON}...   300   e-102
Kwal_27.11509 s27 (831150..831935) [786 bp, 261 aa] {ON} YIL093C...   300   e-102
Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON} ...   298   e-101
Ecym_3329 Chr3 complement(630346..631122) [777 bp, 258 aa] {ON} ...   293   1e-99
KLLA0E08273g Chr5 (745145..745930) [786 bp, 261 aa] {ON} similar...   287   2e-97
TPHA0C03420 Chr3 complement(750353..751159) [807 bp, 268 aa] {ON...   283   1e-95
CAGL0D04158g Chr4 complement(410309..411127) [819 bp, 272 aa] {O...   281   7e-95
TBLA0B05960 Chr2 complement(1408779..1409579) [801 bp, 266 aa] {...   280   9e-95
KNAG0A05410 Chr1 (798238..799038) [801 bp, 266 aa] {ON} Anc_2.29...   277   2e-93
ADL211C Chr4 complement(333418..334095) [678 bp, 225 aa] {ON} Sy...   216   8e-70
AGR303W Chr7 (1299365..1302202) [2838 bp, 945 aa] {ON} Syntenic ...    30   6.0  
Ecym_5486 Chr5 (992547..995555) [3009 bp, 1002 aa] {ON} similar ...    30   9.8  

>TDEL0G02200 Chr7 complement(433032..433817) [786 bp, 261 aa] {ON}
           Anc_2.290 YIL093C
          Length = 261

 Score =  503 bits (1295), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/261 (94%), Positives = 247/261 (94%)

Query: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60
           MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL
Sbjct: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60

Query: 61  KDHADEPNAKGFFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPKVL 120
           KDHADEPNAKGFFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPKVL
Sbjct: 61  KDHADEPNAKGFFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPKVL 120

Query: 121 VENDAEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLRMXX 180
           VENDAEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLRM  
Sbjct: 121 VENDAEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLRMQQ 180

Query: 181 XXXXXXXXXXXXMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPSEAWA 240
                       MFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPSEAWA
Sbjct: 181 EVEQQVAQEESEMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPSEAWA 240

Query: 241 AGEEQPDKKDLEDQDIEEIVL 261
           AGEEQPDKKDLEDQDIEEIVL
Sbjct: 241 AGEEQPDKKDLEDQDIEEIVL 261

>ZYRO0A01958g Chr1 complement(162742..163533) [792 bp, 263 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093C RSM25 Mitochondrial ribosomal protein of the
           small subunit
          Length = 263

 Score =  338 bits (866), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 161/263 (61%), Positives = 202/263 (76%), Gaps = 2/263 (0%)

Query: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60
           MK+QTNAVNVLERTSAYLRSGLLR TPAWY VVAS+PP TKFTRE R INPS  KK    
Sbjct: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60

Query: 61  KDHADEPNAKGFFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPKVL 120
           K+  +  N KGF+KTR S+ D+K  +++LY+APKL+F+EDQLREVFY+QHPWE SRPK+L
Sbjct: 61  KEFDEGINRKGFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPKML 120

Query: 121 VENDAEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLRMXX 180
           VEN+  E FDWS++ QL KPLDGESV+QRT++LL+ +    + +AYD+ RFEFYRLRM  
Sbjct: 121 VENEINENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLRMQE 180

Query: 181 XXXXXXXXXXXXMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPSEAWA 240
                       MFGS++  SAID+GV+QEQ+ ID+WKQKAIEET+LLAARRA+P+E+W 
Sbjct: 181 EIEQQVAQEEAEMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPAESWG 240

Query: 241 A--GEEQPDKKDLEDQDIEEIVL 261
               E +P+K D + Q+ EE+ L
Sbjct: 241 QEKQEGEPNKSDEDGQETEELHL 263

>NCAS0B06240 Chr2 (1178232..1179014) [783 bp, 260 aa] {ON} Anc_2.290
           YIL093C
          Length = 260

 Score =  327 bits (838), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 154/261 (59%), Positives = 203/261 (77%), Gaps = 1/261 (0%)

Query: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60
           M++QTNA+N++ERTSAYL+SGLL+NTPAWY+VVA IPP  KFTREPRLINPS  + LA L
Sbjct: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL 60

Query: 61  KDHADEPNAKGFFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPKVL 120
           +D+ +  N KGF+KTR + LD+K+N+ KLY+ PKL++VEDQLR +F+ QHPWELSRPK+L
Sbjct: 61  RDNREAVNKKGFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRPKIL 120

Query: 121 VENDAEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLRMXX 180
           VEN  EE FDWSHIQQL KPLDGESV+QRT++LLK ++   +T AY+QARFEFYR R+  
Sbjct: 121 VENSLEERFDWSHIQQLGKPLDGESVVQRTMYLLKTDKMDMIT-AYNQARFEFYRFRIQQ 179

Query: 181 XXXXXXXXXXXXMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPSEAWA 240
                       MFGS++  S IDFG+++EQK I  WK+KA +ET+L+AARRANPS++W 
Sbjct: 180 EVEEQVAQEEAEMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANPSDSWI 239

Query: 241 AGEEQPDKKDLEDQDIEEIVL 261
           + E    +++L++Q  E + L
Sbjct: 240 SAEAGATEENLDEQGSELLEL 260

>Kpol_1003.40 s1003 complement(97903..98688) [786 bp, 261 aa] {ON}
           complement(97903..98688) [786 nt, 262 aa]
          Length = 261

 Score =  324 bits (830), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 152/261 (58%), Positives = 192/261 (73%)

Query: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60
           MKIQ NAVNVLERTSAYLR+GLL   PAWY+VVAS+PP  KF R P+L NPSN +    L
Sbjct: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60

Query: 61  KDHADEPNAKGFFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPKVL 120
                     G FKTR +  D+   + +LY A KL ++EDQLRE+FYKQHPWELSRPK+L
Sbjct: 61  HSLDSSAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPKIL 120

Query: 121 VENDAEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLRMXX 180
           +EN+ +E++DWSH+QQ+ KPLDGESV+QRTL+L+KN E  SL  AYD AR+EFYRLRM  
Sbjct: 121 IENNGDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLRMQQ 180

Query: 181 XXXXXXXXXXXXMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPSEAWA 240
                       MFGS++GPSAI++G+Q+EQK ID WK+KAI +T+++AARR NPSE+WA
Sbjct: 181 HIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARRINPSESWA 240

Query: 241 AGEEQPDKKDLEDQDIEEIVL 261
             E+ P K D  ++D+EEI L
Sbjct: 241 TDEKDPKKNDDIEEDVEEIKL 261

>KLTH0G10450g Chr7 complement(884037..884822) [786 bp, 261 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093C RSM25 Mitochondrial ribosomal protein of the
           small subunit
          Length = 261

 Score =  323 bits (828), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 150/262 (57%), Positives = 202/262 (77%), Gaps = 2/262 (0%)

Query: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60
           MK+Q NAVNVLERTS+YL++GLL+ TPAWYDVVA +PP  +F REPRL+NPS  K+ A L
Sbjct: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60

Query: 61  KDHADEPNAKG-FFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPKV 119
            + A++ + +   +KTRAS  +++++ +KL+ APKLK+ ED+LREVFY+QHPWELSRPK+
Sbjct: 61  SEFAEQYSVENRSYKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPKM 120

Query: 120 LVENDAEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLRMX 179
           LVEN    ++DWS IQQL KPLDGESV+QRTL+LL+    + L  AYDQARFEFYRLR+ 
Sbjct: 121 LVENSGTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLRIQ 180

Query: 180 XXXXXXXXXXXXXMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPSEAW 239
                        MFGS++GPSAIDFG+++EQK ID+WKQKAI++T++++AR  NPSE+W
Sbjct: 181 EEVQNQVAQEEAEMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPSESW 240

Query: 240 AAGEEQPDKKDLEDQDIEEIVL 261
           +A E QP + D + +D +E+ L
Sbjct: 241 SAQESQP-QSDAKAEDTKELQL 261

>YIL093C Chr9 complement(187990..188784) [795 bp, 264 aa] {ON}
           RSM25Mitochondrial ribosomal protein of the small
           subunit
          Length = 264

 Score =  306 bits (784), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 140/242 (57%), Positives = 186/242 (76%), Gaps = 3/242 (1%)

Query: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60
           MKIQTNAVNVL+RTSAYL+SGLL+ TPAWY+VVASIPP TKFTREPR  NPSN   +  L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFKNPSNGHIIGKL 60

Query: 61  KDHADEPNA--KGFFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPK 118
            D  ++P+A  KG +KTR ++ DK++   +LYR PKL +VED+LR +FYKQHPWELSRPK
Sbjct: 61  VDVTEQPHANNKGLYKTRPNSSDKRVGVKRLYRPPKLTYVEDRLRSLFYKQHPWELSRPK 120

Query: 119 VLVEND-AEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLR 177
           +LVEN+  +E +DWSH+ Q+ +PLDGESVIQRT++L+K  +   + EAYD AR+EFY LR
Sbjct: 121 ILVENEIGDENYDWSHMLQIGRPLDGESVIQRTMYLIKTKQYGDMVEAYDHARYEFYALR 180

Query: 178 MXXXXXXXXXXXXXXMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPSE 237
           M              MFGS++G SAI+ G+Q+EQ+ +D+W++K +EET+L+AAR +NP+ 
Sbjct: 181 MQEETEQQVALEEAEMFGSLFGVSAIEHGIQKEQEVLDVWEKKVVEETELMAARTSNPAG 240

Query: 238 AW 239
           +W
Sbjct: 241 SW 242

>Smik_9.86 Chr9 complement(167101..167895) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  305 bits (782), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 144/242 (59%), Positives = 184/242 (76%), Gaps = 3/242 (1%)

Query: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60
           MKIQTNAVNVL+RTSAYL+SGLL++TPAWY+VVASIPP TKFTREP   NPSN   +  L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKDTPAWYNVVASIPPSTKFTREPHFENPSNGHTIGRL 60

Query: 61  KD--HADEPNAKGFFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPK 118
            D       N+ G +KTR +T DK+I   KLY+ PKL +VED+LR +FYKQHPWELSRPK
Sbjct: 61  VDVIENQHTNSNGLYKTRPNTNDKRIGVKKLYKPPKLTYVEDRLRTLFYKQHPWELSRPK 120

Query: 119 VLVEND-AEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLR 177
           +LVEN+  +E++DWSH+ QL KPLDGESVIQRT++LLK  + ++  EAYD AR+EFY LR
Sbjct: 121 ILVENEIGDEDYDWSHMLQLGKPLDGESVIQRTMYLLKTKQYENTVEAYDHARYEFYALR 180

Query: 178 MXXXXXXXXXXXXXXMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPSE 237
           M              MFGSI+G SAI+ G+Q+EQ+ ++IW++K IEET+L+AAR +NP+ 
Sbjct: 181 MQEETQQQVALEEAEMFGSIFGKSAIEHGIQKEQEVLNIWEKKVIEETELMAARSSNPAG 240

Query: 238 AW 239
           +W
Sbjct: 241 SW 242

>SAKL0E07590g Chr5 (613875..614657) [783 bp, 260 aa] {ON} similar to
           uniprot|P40496 Saccharomyces cerevisiae YIL093C RSM25
           Mitochondrial ribosomal protein of the small subunit
          Length = 260

 Score =  303 bits (775), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 138/237 (58%), Positives = 182/237 (76%), Gaps = 1/237 (0%)

Query: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60
           MK+QTNAVN+LERTSAYLR+GLL   PAWY+VVAS+PP   F REP++ NPSN K +A L
Sbjct: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60

Query: 61  KDHADEPNAK-GFFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPKV 119
            ++++    K G +KTR S  D+K++  KLY+APKL + ED+LRE+FY+QHPWELSRPKV
Sbjct: 61  SEYSETVGIKNGTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPKV 120

Query: 120 LVENDAEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLRMX 179
           L+EN  EE +DWS IQQL KPLDGESV+QRTL+LLK  +  +L  AYDQARFEFYR+R+ 
Sbjct: 121 LIENTGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVRVQ 180

Query: 180 XXXXXXXXXXXXXMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPS 236
                        MFGS++G S+I++G+++EQK I+ WK+KAI++T+L+AAR + PS
Sbjct: 181 QEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSSGPS 237

>NDAI0B03540 Chr2 (890148..890933) [786 bp, 261 aa] {ON} Anc_2.290
           YIL093C
          Length = 261

 Score =  303 bits (775), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 143/257 (55%), Positives = 190/257 (73%)

Query: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60
           MKIQTNAVN++ERTSAYL SGLL+NTPAWYDVVASIPP  KFTREP++ NP+  +     
Sbjct: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRNKTFF 60

Query: 61  KDHADEPNAKGFFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPKVL 120
           KD     N KG +KTR + +D+K +   LY+ PKL ++ED+LR +F++QHPWELSRPK+L
Sbjct: 61  KDDRIRVNNKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRPKIL 120

Query: 121 VENDAEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLRMXX 180
           +EN  EE FDWSHIQQ EK LDGESV+QRTL+LLKN  G ++ +AY++ARFEFYRLR+  
Sbjct: 121 IENSLEENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLRIQQ 180

Query: 181 XXXXXXXXXXXXMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPSEAWA 240
                       MFGSI+  ++ + G+++EQK I+ WK+KAI+ET L+  R +NPS++WA
Sbjct: 181 DISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNPSDSWA 240

Query: 241 AGEEQPDKKDLEDQDIE 257
           A EEQ  ++D  + + E
Sbjct: 241 APEEQDLEEDFTEGEPE 257

>KAFR0J01350 Chr10 (247931..248725) [795 bp, 264 aa] {ON} Anc_2.290
           YIL093C
          Length = 264

 Score =  301 bits (772), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 138/252 (54%), Positives = 191/252 (75%), Gaps = 3/252 (1%)

Query: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60
           MKIQTNA N+LERTSAYL++GLLRN PA+YDV+A +PP TKFTREP+L+NPS  +     
Sbjct: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60

Query: 61  KDHADEPNAKGFFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPKVL 120
           ++  D+ N +G +KTR +  D+  + ++LY+A +LK++ED LR++FY QHPWELSRPK++
Sbjct: 61  RELTDKVNWRGLYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPKIV 120

Query: 121 VENDAE-EEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLRMX 179
           +EN+ +    DWS+IQQL KP+DGESV+QRTLFL+KN +  +L + YDQARFEFY++RM 
Sbjct: 121 IENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVRMQ 180

Query: 180 XXXXXXXXXXXXXMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPSEAW 239
                        MFGSI+GP+A+++G+Q+EQ  I  WKQ+AI ET+LL A+RANPS++W
Sbjct: 181 RDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANPSDSW 240

Query: 240 AAGEEQPDKKDL 251
           A  +E+   KDL
Sbjct: 241 A--QEESSDKDL 250

>Suva_9.106 Chr9 complement(182086..182880) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  300 bits (769), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 142/242 (58%), Positives = 184/242 (76%), Gaps = 3/242 (1%)

Query: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60
           MKIQTNAVNVL+RTSAYL+SGLL++TPAWY+VVASIPP TKFTREPR  NPSN + +  L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKDTPAWYNVVASIPPSTKFTREPRFKNPSNGRIIGKL 60

Query: 61  KDHAD--EPNAKGFFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPK 118
            D  +  + NA G +KTR +  D+++   KLY+ PKL +VED+LR +FYKQHPWELSRPK
Sbjct: 61  VDVTERQQANANGLYKTRPNPNDRRVGVKKLYKPPKLTYVEDRLRVLFYKQHPWELSRPK 120

Query: 119 VLVEND-AEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLR 177
           +LVEN+  +E +DWSH+ QL K LDGESVIQRT+ LLK  + K + EAYD AR+EFY LR
Sbjct: 121 ILVENEVGDENYDWSHMLQLGKVLDGESVIQRTMHLLKTQQYKDMVEAYDHARYEFYALR 180

Query: 178 MXXXXXXXXXXXXXXMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPSE 237
           M              MFGSI+G S+I+ G+Q+EQ+ +D+W++K IEET+L+AAR +NP+ 
Sbjct: 181 MEEETQQQVALEEAEMFGSIFGVSSIEHGIQKEQEVLDVWEKKVIEETELMAARSSNPAG 240

Query: 238 AW 239
           +W
Sbjct: 241 SW 242

>Kwal_27.11509 s27 (831150..831935) [786 bp, 261 aa] {ON} YIL093C
           (RSM25) - mitochondrial ribosome small subunit component
           [contig 27] FULL
          Length = 261

 Score =  300 bits (767), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 149/262 (56%), Positives = 199/262 (75%), Gaps = 2/262 (0%)

Query: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60
           MK+Q NAVNVLERTS+YLR+G+L+ TPAWY+VVA IPP  +F REPRL+NPS   ++A L
Sbjct: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60

Query: 61  KDHADEPNAKG-FFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPKV 119
            +  +  N +   +KTRAS  DK+++  KLY+APKLK+ ED+LRE+F++QHPWELSRPK+
Sbjct: 61  SEFRESYNFENRSYKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPKM 120

Query: 120 LVENDAEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLRMX 179
           LVEN   +++DWS +QQL KPLDGESV+QRTL+LLK+ + + L  AYDQARFEFYRLR+ 
Sbjct: 121 LVENSGIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLRIQ 180

Query: 180 XXXXXXXXXXXXXMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPSEAW 239
                        M GS++GPSAIDFG+++EQK ID+WKQKAI++++LL+AR  NPSE+W
Sbjct: 181 EEVQNQVAQEEAEMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSARNTNPSESW 240

Query: 240 AAGEEQPDKKDLEDQDIEEIVL 261
           ++     D  D + Q+ EEI L
Sbjct: 241 SSSPSSQD-NDSKVQETEEIKL 261

>Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  298 bits (763), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 140/242 (57%), Positives = 181/242 (74%), Gaps = 3/242 (1%)

Query: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60
           MKIQTNAVNVL+RTSAYL+SGLL+ TPAWY+VVASIPP TKFTREPR  NPSN   +  L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60

Query: 61  KD--HADEPNAKGFFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPK 118
            D       N  G +KTR +T DK+++  KLY+ PKL +VED+LR +FYKQHPWELSRPK
Sbjct: 61  DDVTQRQHANKNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRPK 120

Query: 119 VLVEND-AEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLR 177
           +LVEN+  +E++DW  + QL KPLDGESV+QRT+ LLK  + + + EAYD AR+EFY LR
Sbjct: 121 ILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYALR 180

Query: 178 MXXXXXXXXXXXXXXMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPSE 237
           M              MFGSI+G SAI+ G+Q+EQ+ +D+W++K IEET+L+AA+ +NP+ 
Sbjct: 181 MQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNPAG 240

Query: 238 AW 239
           +W
Sbjct: 241 SW 242

>Ecym_3329 Chr3 complement(630346..631122) [777 bp, 258 aa] {ON}
           similar to Ashbya gossypii ADL211C
          Length = 258

 Score =  293 bits (749), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 137/262 (52%), Positives = 190/262 (72%), Gaps = 5/262 (1%)

Query: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60
           MKIQTNA N+LERTS++LR GLL  TP WYDV+   PP TKF R+P+L+NPS     A L
Sbjct: 1   MKIQTNATNILERTSSFLRVGLLARTPVWYDVIVKSPPSTKFARQPKLVNPSTGAYTAKL 60

Query: 61  KDHADEPNAK-GFFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPKV 119
           ++ +D  N+  G +KTRA+  +K+++ + +YRAPKL + ED+LR +FYKQHPWELSRPK+
Sbjct: 61  REFSDNRNSSSGTYKTRANKHEKRVSTSAVYRAPKLYYFEDKLRSLFYKQHPWELSRPKI 120

Query: 120 LVENDAEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLRMX 179
           LVEN  +E+ DWS IQQL KPLDGESV+QRTL+LL + E  +L +AYDQARFEFYRLRM 
Sbjct: 121 LVENQGDEKHDWSRIQQLGKPLDGESVVQRTLYLLGSGEHTNLIDAYDQARFEFYRLRMQ 180

Query: 180 XXXXXXXXXXXXXMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPSEAW 239
                        M GS++GPSA++FG+++EQ+ ID WK+KA+++ +L++A+R++ S  W
Sbjct: 181 QELEEQVAQEEAGMLGSVFGPSAVEFGLRKEQEVIDDWKKKALKQVELMSAKRSDQSANW 240

Query: 240 AAGEEQPDKKDLEDQDIEEIVL 261
              E+  +    +  +IEE+ L
Sbjct: 241 GTREDNAN----DAVEIEELEL 258

>KLLA0E08273g Chr5 (745145..745930) [786 bp, 261 aa] {ON} similar to
           uniprot|P40496 Saccharomyces cerevisiae YIL093C RSM25
           Mitochondrial ribosomal protein of the small subunit
          Length = 261

 Score =  287 bits (735), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 143/263 (54%), Positives = 200/263 (76%), Gaps = 4/263 (1%)

Query: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60
           MK+Q  AVNVLERTSAYL+SG+L+ TPAWY+V+A +PP  KF R P+L +P N K    L
Sbjct: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60

Query: 61  KDHAD-EPNAKGFFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPKV 119
            D+++ + N+ G +KTR ++L+KK   +KLY++PKL ++ED+LR++F++QHPWELSRPK+
Sbjct: 61  PDYSNWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPKI 120

Query: 120 LVENDAE-EEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLRM 178
           LVEN  E +E+DWSHIQQL KPLDGESV+QRTLFLLK+ E K L +AYDQARFEFYRLR+
Sbjct: 121 LVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLRI 180

Query: 179 XXXXXXXXXXXXXXMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPSEA 238
                         MFGS++  ++I++G+ +EQK ID WK+KA+++ +L+AAR ++PS +
Sbjct: 181 QQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELMAARASSPSAS 240

Query: 239 WAAGEEQPDKKDLEDQDIEEIVL 261
           W   E + ++K + DQD+EEI L
Sbjct: 241 W-TNETEEEQKPI-DQDVEEIQL 261

>TPHA0C03420 Chr3 complement(750353..751159) [807 bp, 268 aa] {ON}
           Anc_2.290 YIL093C
          Length = 268

 Score =  283 bits (724), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 174/249 (69%), Gaps = 4/249 (1%)

Query: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60
           MKIQ NAVNVLERTS+YLRSGLL   PAWY+VVA IPP  KF R P+  NPSN KKL  L
Sbjct: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60

Query: 61  K----DHADEPNAKGFFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSR 116
           +        + N    FK+R + LDKK ++  +Y+  KL ++EDQLREVFY QHPWELSR
Sbjct: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120

Query: 117 PKVLVENDAEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRL 176
           PK++VEN+ +E +DWSHIQQL K LDGE+V+QR ++L+K        +   +AR+EFYR+
Sbjct: 121 PKIVVENNGDETYDWSHIQQLGKALDGENVVQRAMYLMKKKLIMIFQKHTIKARYEFYRV 180

Query: 177 RMXXXXXXXXXXXXXXMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPS 236
           RM              MFGS++GPS I+FG+ QEQK ID+WK+KAI ET+L+ A+R NPS
Sbjct: 181 RMQSEIEEQVAQEEAEMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKRTNPS 240

Query: 237 EAWAAGEEQ 245
           E WA  +E+
Sbjct: 241 ETWAQEKEE 249

>CAGL0D04158g Chr4 complement(410309..411127) [819 bp, 272 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093c RSM25
          Length = 272

 Score =  281 bits (719), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 134/254 (52%), Positives = 184/254 (72%), Gaps = 1/254 (0%)

Query: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60
           MKIQTNAVNVLERTSAYLR+G+++ TPAWY+VVASIPP TKFTREP  INPS  KK++ L
Sbjct: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60

Query: 61  KD-HADEPNAKGFFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPKV 119
           KD   +  N  G +KTR + L++K+ N ++Y+ PKL ++ED++R +FYKQHPWEL+RPK+
Sbjct: 61  KDPDLESVNRNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPKI 120

Query: 120 LVENDAEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLRMX 179
           + EN+     DW ++ QL +PLDGE+V+QRTL+LLK  E  ++T+AYDQAR EFYRLRM 
Sbjct: 121 VSENEINTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLRMQ 180

Query: 180 XXXXXXXXXXXXXMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPSEAW 239
                        MFGS++GPS I+ GV +EQ+ I+ WK+ A  +++LL+A++ N S+A 
Sbjct: 181 QELEEQVAAEEAEMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAKKENASKAA 240

Query: 240 AAGEEQPDKKDLED 253
                   +K +ED
Sbjct: 241 GDASAVSSEKQVED 254

>TBLA0B05960 Chr2 complement(1408779..1409579) [801 bp, 266 aa] {ON}
           Anc_2.290 YIL093C
          Length = 266

 Score =  280 bits (717), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 132/259 (50%), Positives = 181/259 (69%), Gaps = 1/259 (0%)

Query: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60
           MKIQ NAVNVLERTSAYL++G+++  P WYDVVA+ PP  KFTREP+ INPS  K+    
Sbjct: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60

Query: 61  KDHADEPN-AKGFFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPKV 119
           K   D  N   G +KTRA+++DKK   + LY+ PKL ++ED+LR++FY+QHPWEL+RPK+
Sbjct: 61  KPLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRPKI 120

Query: 120 LVENDAEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLRMX 179
           ++EN  E  +DWS + QL KPLDGESV+QRTLFLLK  E + L +AY+QARFEFYRLRM 
Sbjct: 121 VMENHGEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRLRMA 180

Query: 180 XXXXXXXXXXXXXMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPSEAW 239
                        MFG+++G + I+FG+++EQ+ ID WK +AI+ET++  A+R+  S +W
Sbjct: 181 EEIQEQVAQEESEMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRSKESVSW 240

Query: 240 AAGEEQPDKKDLEDQDIEE 258
                +  + +    DI E
Sbjct: 241 KTDSLEGKEDEFNTGDILE 259

>KNAG0A05410 Chr1 (798238..799038) [801 bp, 266 aa] {ON} Anc_2.290
           YIL093C
          Length = 266

 Score =  277 bits (708), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 131/240 (54%), Positives = 173/240 (72%), Gaps = 1/240 (0%)

Query: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60
           MKIQTNAVN+LERTSA+L SG+++  PAWY+VVA+ PPK KF R+P  +NPS  K   +L
Sbjct: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60

Query: 61  KDHADEP-NAKGFFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPKV 119
           K   D   NA   +KTR S  DK++++  LYR PKL ++EDQLR++FY QHPWE SRP +
Sbjct: 61  KSFLDSKRNAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRPMI 120

Query: 120 LVENDAEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLRMX 179
           L+EN+   +FDWS IQQL K LDGESV+QR LFLL+     SL+ AYD+ARFEFYR+RM 
Sbjct: 121 LIENNVTPKFDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIRMQ 180

Query: 180 XXXXXXXXXXXXXMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPSEAW 239
                        M+GS+Y  SAI+FG+++E K I+ WK++ I+ET+ + ARRA+PSE+W
Sbjct: 181 QELEEQISQEEAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLARRASPSESW 240

>ADL211C Chr4 complement(333418..334095) [678 bp, 225 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL093C
           (RSM25)
          Length = 225

 Score =  216 bits (549), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 135/179 (75%), Gaps = 3/179 (1%)

Query: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60
           MKIQTNAVNVL+RTS YL++GLL+ TPAWY+VVA IPP TKF REP+L +P + K    L
Sbjct: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60

Query: 61  KDHADEPNAKG-FFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPKV 119
               D  N     +KTRA + D++   A +++  KL+F+ED+LR +F++QHPWELSRPKV
Sbjct: 61  DIMTDRLNRNTETYKTRAGSSDRQ--TAAVHKPSKLRFIEDKLRSLFFQQHPWELSRPKV 118

Query: 120 LVENDAEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLRM 178
           LVEN   E++DWS + QL KPLDGESV+QRTL+LLK+   + +  AYDQARFEFYRLRM
Sbjct: 119 LVENMGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLRM 177

>AGR303W Chr7 (1299365..1302202) [2838 bp, 945 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR048C (RAT1)
          Length = 945

 Score = 30.4 bits (67), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 20/35 (57%)

Query: 118 KVLVENDAEEEFDWSHIQQLEKPLDGESVIQRTLF 152
           + L+E DAE+ F W H+  L + L  E ++ R  F
Sbjct: 278 QALIEQDAEKPFLWLHVSVLREYLSAELLVPRLAF 312

>Ecym_5486 Chr5 (992547..995555) [3009 bp, 1002 aa] {ON} similar to
           Ashbya gossypii AGR303W
          Length = 1002

 Score = 29.6 bits (65), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 120 LVENDAEEEFDWSHIQQLEKPLDGESVIQRTLF 152
           L+E DAE+ F W H+  L + L  E  +QR  F
Sbjct: 280 LIEQDAEKPFLWLHVSVLREYLAAELHVQRLSF 312

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 27,775,216
Number of extensions: 1172339
Number of successful extensions: 3624
Number of sequences better than 10.0: 37
Number of HSP's gapped: 3704
Number of HSP's successfully gapped: 37
Length of query: 261
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 154
Effective length of database: 41,212,137
Effective search space: 6346669098
Effective search space used: 6346669098
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)