Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G021902.288ON93693647830.0
NCAS0G037802.288ON95790430420.0
NDAI0G006702.288ON96889830250.0
Smik_14.3082.288ON96590829680.0
Suva_14.3242.288ON96890229570.0
Skud_14.3062.288ON97090529510.0
ZYRO0A01936g2.288ON95389129410.0
YNL023C (FAP1)2.288ON96591929370.0
KAFR0H033002.288ON96690729060.0
KNAG0H019902.288ON97391428750.0
TBLA0B059502.288ON99590427720.0
CAGL0M06919g2.288ON95690627260.0
Kpol_1039.452.288ON96890226720.0
KLTH0G10406g2.288ON96390226150.0
TPHA0D015302.288ON96291125970.0
SAKL0E07634g2.288ON97490225780.0
Kwal_27.115182.288ON95389325050.0
KLLA0E08317g2.288ON92189522930.0
Ecym_33272.288ON92689221920.0
ADL213W2.288ON90889821600.0
NCAS0C059204.7ON28756771.2
NDAI0C032705.86ON293110724.8
Skud_13.108.877ON56358734.9
Skud_5.3088.234ON80299718.3
NDAI0B003801.152ON238133708.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G02190
         (936 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.2...  1847   0.0  
NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {O...  1176   0.0  
NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.2...  1169   0.0  
Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {...  1147   0.0  
Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {...  1143   0.0  
Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {...  1141   0.0  
ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} simila...  1137   0.0  
YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON} ...  1135   0.0  
KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {O...  1123   0.0  
KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {O...  1112   0.0  
TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON} Anc_2...  1072   0.0  
CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa] ...  1054   0.0  
Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON} (1358...  1033   0.0  
KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} simila...  1011   0.0  
TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {O...  1004   0.0  
SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {...   997   0.0  
Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {...   969   0.0  
KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {...   887   0.0  
Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar t...   848   0.0  
ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic ho...   836   0.0  
NCAS0C05920 Chr3 (1218910..1219773) [864 bp, 287 aa] {ON} Anc_4....    34   1.2  
NDAI0C03270 Chr3 complement(742293..743174) [882 bp, 293 aa] {ON...    32   4.8  
Skud_13.10 Chr13 complement(11346..13037) [1692 bp, 563 aa] {ON}...    33   4.9  
Skud_5.308 Chr5 (508459..510867) [2409 bp, 802 aa] {ON} YER169W ...    32   8.3  
NDAI0B00380 Chr2 (69299..70015) [717 bp, 238 aa] {ON}                  32   8.9  

>TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.288
           YNL023C
          Length = 936

 Score = 1847 bits (4783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 909/936 (97%), Positives = 909/936 (97%)

Query: 1   MVVEELNQHSLVLXXXXXXXXXXXXXCSVHEVRDEHDMAYYERAVQEIALGDRYVCMICT 60
           MVVEELNQHSLVL             CSVHEVRDEHDMAYYERAVQEIALGDRYVCMICT
Sbjct: 1   MVVEELNQHSLVLEFSEDDSDFSSESCSVHEVRDEHDMAYYERAVQEIALGDRYVCMICT 60

Query: 61  VEMDYTCKMYACEGCYRVFDYECIREWALKSTEKTLDRVWKCPNCYKVNKRVPAKNRPTC 120
           VEMDYTCKMYACEGCYRVFDYECIREWALKSTEKTLDRVWKCPNCYKVNKRVPAKNRPTC
Sbjct: 61  VEMDYTCKMYACEGCYRVFDYECIREWALKSTEKTLDRVWKCPNCYKVNKRVPAKNRPTC 120

Query: 121 WCGKTVNPDPNPLDPNSCGQTCDAPICPHGCSKQCHLGPHPDCVRTITTKCQCGKHTRET 180
           WCGKTVNPDPNPLDPNSCGQTCDAPICPHGCSKQCHLGPHPDCVRTITTKCQCGKHTRET
Sbjct: 121 WCGKTVNPDPNPLDPNSCGQTCDAPICPHGCSKQCHLGPHPDCVRTITTKCQCGKHTRET 180

Query: 181 FCYQTISMKGKSQFQCNEVCGLPLACGIHKCERLCHSGICGPCPAVLNAKSNKLKIRCYC 240
           FCYQTISMKGKSQFQCNEVCGLPLACGIHKCERLCHSGICGPCPAVLNAKSNKLKIRCYC
Sbjct: 181 FCYQTISMKGKSQFQCNEVCGLPLACGIHKCERLCHSGICGPCPAVLNAKSNKLKIRCYC 240

Query: 241 GLEHRDSFKCKDVRVASDLSKDGKGDSWIGAFGCSGIRKIEYACREHSFVEKCQPSPSIS 300
           GLEHRDSFKCKDVRVASDLSKDGKGDSWIGAFGCSGIRKIEYACREHSFVEKCQPSPSIS
Sbjct: 241 GLEHRDSFKCKDVRVASDLSKDGKGDSWIGAFGCSGIRKIEYACREHSFVEKCQPSPSIS 300

Query: 301 GKIACPFSPKLLKTCPCGRTSLKVLAEPRKSCTSPIPNCDSTCGKKLACGRHTCPFTCHD 360
           GKIACPFSPKLLKTCPCGRTSLKVLAEPRKSCTSPIPNCDSTCGKKLACGRHTCPFTCHD
Sbjct: 301 GKIACPFSPKLLKTCPCGRTSLKVLAEPRKSCTSPIPNCDSTCGKKLACGRHTCPFTCHD 360

Query: 361 GPCMDPCIQIETVRCSCHKNLYSVPCQFKEQPRCDTKCESLMSXXXXXXXXXXXXXXPFA 420
           GPCMDPCIQIETVRCSCHKNLYSVPCQFKEQPRCDTKCESLMS              PFA
Sbjct: 361 GPCMDPCIQIETVRCSCHKNLYSVPCQFKEQPRCDTKCESLMSCRRHRCTERCCCGRPFA 420

Query: 421 ERRRKTPLSSRELMDESSVESEHICLKDCNLTLSCGCHKCQRKCHPGKCPPCLESDSNDL 480
           ERRRKTPLSSRELMDESSVESEHICLKDCNLTLSCGCHKCQRKCHPGKCPPCLESDSNDL
Sbjct: 421 ERRRKTPLSSRELMDESSVESEHICLKDCNLTLSCGCHKCQRKCHPGKCPPCLESDSNDL 480

Query: 481 VCPCGKTVVEAPVRCGTRLPPCHYPCIRVIQNAYKCGHKPMPHTCHPLNEPCPSCTAPVF 540
           VCPCGKTVVEAPVRCGTRLPPCHYPCIRVIQNAYKCGHKPMPHTCHPLNEPCPSCTAPVF
Sbjct: 481 VCPCGKTVVEAPVRCGTRLPPCHYPCIRVIQNAYKCGHKPMPHTCHPLNEPCPSCTAPVF 540

Query: 541 KPCKCGKKDKVRTLCFQNDVSCGTTCGKPLDNCPHMCQKSCHIPGECQKKCKQICNRKRI 600
           KPCKCGKKDKVRTLCFQNDVSCGTTCGKPLDNCPHMCQKSCHIPGECQKKCKQICNRKRI
Sbjct: 541 KPCKCGKKDKVRTLCFQNDVSCGTTCGKPLDNCPHMCQKSCHIPGECQKKCKQICNRKRI 600

Query: 601 YCDHKCRLICHGNDKCPDIPCPLSVKIKCECEVKESFITCGANSETPSKATTTILPCDEE 660
           YCDHKCRLICHGNDKCPDIPCPLSVKIKCECEVKESFITCGANSETPSKATTTILPCDEE
Sbjct: 601 YCDHKCRLICHGNDKCPDIPCPLSVKIKCECEVKESFITCGANSETPSKATTTILPCDEE 660

Query: 661 CERHKRHLQLREAFGISNFSDNPSRSKTASLENLAAVANSFEELELPFSEPALGTFAKQE 720
           CERHKRHLQLREAFGISNFSDNPSRSKTASLENLAAVANSFEELELPFSEPALGTFAKQE
Sbjct: 661 CERHKRHLQLREAFGISNFSDNPSRSKTASLENLAAVANSFEELELPFSEPALGTFAKQE 720

Query: 721 AWCTQIENVLNSFMDNEEKTSLHFKPMRPAQRHFIHELAKSYNLYVESQDREPKRSVFVK 780
           AWCTQIENVLNSFMDNEEKTSLHFKPMRPAQRHFIHELAKSYNLYVESQDREPKRSVFVK
Sbjct: 721 AWCTQIENVLNSFMDNEEKTSLHFKPMRPAQRHFIHELAKSYNLYVESQDREPKRSVFVK 780

Query: 781 KQDNGGSCKPVIQLKDSLPIYQFFKENEKEKKAQRFEAQTTTEFVNFIPKEEPQLERAKN 840
           KQDNGGSCKPVIQLKDSLPIYQFFKENEKEKKAQRFEAQTTTEFVNFIPKEEPQLERAKN
Sbjct: 781 KQDNGGSCKPVIQLKDSLPIYQFFKENEKEKKAQRFEAQTTTEFVNFIPKEEPQLERAKN 840

Query: 841 NAFKLKNVSTGTTKEDLERIFADHLKPTLVKNPQFKIQDSTKNGLIYPEDYAEISVNVER 900
           NAFKLKNVSTGTTKEDLERIFADHLKPTLVKNPQFKIQDSTKNGLIYPEDYAEISVNVER
Sbjct: 841 NAFKLKNVSTGTTKEDLERIFADHLKPTLVKNPQFKIQDSTKNGLIYPEDYAEISVNVER 900

Query: 901 DLEALVGHFDYLCKESFIGDGIELCHIDLKVLQESE 936
           DLEALVGHFDYLCKESFIGDGIELCHIDLKVLQESE
Sbjct: 901 DLEALVGHFDYLCKESFIGDGIELCHIDLKVLQESE 936

>NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {ON} 
          Length = 957

 Score = 1176 bits (3042), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 578/904 (63%), Positives = 695/904 (76%), Gaps = 4/904 (0%)

Query: 34  DEHDMAYYERAVQEIALGDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREWALKSTE 93
           D+  M YYERA+QEIA GD YVCMICTVEMDYTC+MYAC+ CYRVFDYECIREWALKSTE
Sbjct: 46  DDDAMHYYERAIQEIAKGDSYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWALKSTE 105

Query: 94  KTLDRVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPICPHGCSK 153
           KT+DR+WKCPNCY VNK+VP KNRPTCWCGK VNP+PNPL+PNSCGQTC+A  C HGCSK
Sbjct: 106 KTVDRIWKCPNCYHVNKKVPPKNRPTCWCGKVVNPEPNPLNPNSCGQTCNAHTCVHGCSK 165

Query: 154 QCHLGPHPDCVRTITTKCQCGKHTRETFCYQTISMKGKSQFQCNEVCGLPLACGIHKCER 213
            CHLGPHP+C R IT KC+CGKHT++  CYQ+  ++GK +FQC+E CGLPLACG+H+C++
Sbjct: 166 ICHLGPHPECTRIITIKCRCGKHTKDISCYQSSLLRGKDKFQCDEPCGLPLACGLHRCQK 225

Query: 214 LCHSGICGPCPAVLNAKSN-KLKIRCYCGLEHRDSFKCKDVRV--ASDLSKDGKGDSWIG 270
            CHSG+CG CP +LN K      IRCYCG + RD+ KC+DV V  ++ LS++ KG+ W+G
Sbjct: 226 KCHSGLCGICPEILNTKEYLDAHIRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGEKWVG 285

Query: 271 AFGCSGIRKIEYACREHSFVEKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKVLAEPRK 330
            F C  IR ++Y C EHSFVE+C   P+I G   CPFSPKLLKTCPCG+T LK L E RK
Sbjct: 286 VFKCDNIRNVDYKCHEHSFVEQCIAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELVESRK 345

Query: 331 SCTSPIPNCDSTCGKKLACGRHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSVPCQFKE 390
            CT PIP CDS CGK L CGRHTCPF CH GPCMDPC+QI+  +CSC++  + VPCQF +
Sbjct: 346 KCTDPIPTCDSRCGKPLKCGRHTCPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQFHQ 405

Query: 391 QPRCDTKCESLMSXXXXXXXXXXXXXXPFAERRRKTPLSSRELMDESSVESEHICLKDCN 450
            P+C TKCESLMS              P AE R+K    S++LMDES VE +HICLK+CN
Sbjct: 406 DPQCTTKCESLMSCRRHRCTERCCAGRPRAEARKKRLFRSQDLMDESLVEPQHICLKECN 465

Query: 451 LTLSCGCHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHYPCIRVI 510
           L LSCG HKCQRKCHPGKCPPCLESDSNDLVCPCG+T++EAPVRCGT+LPPC YPCI+V+
Sbjct: 466 LMLSCGKHKCQRKCHPGKCPPCLESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCIKVV 525

Query: 511 QNAYKCGHKPMPHTCHPLNEPCPSCTAPVFKPCKCGKKDKVRTLCFQNDVSCGTTCGKPL 570
           +  Y CGH PMPHTCHPLNEPCP CTA VFKPCKCGK DKVRTLCFQNDVSCG  CG PL
Sbjct: 526 RGEYPCGHTPMPHTCHPLNEPCPPCTASVFKPCKCGKVDKVRTLCFQNDVSCGKICGLPL 585

Query: 571 DNCPHMCQKSCHIPGECQKKCKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLSVKIKCE 630
           +NC H CQK CH+ GECQK CKQIC +KRI C+H C   CHG   CPDIPC +S+KI CE
Sbjct: 586 ENCNHTCQKRCHLLGECQKTCKQICKKKRINCEHTCLKPCHGKTDCPDIPCSVSIKITCE 645

Query: 631 CEVKESFITCGANSETPSKATTTILPCDEECERHKRHLQLREAFGISNFSDNPSRSKTAS 690
           C  KE+++TCGA S  PS AT T + CDEECE  +RH QL+EAFGI + S+  +  +   
Sbjct: 646 CGRKETYVTCGATSTIPSAATKTHIECDEECELLERHRQLKEAFGIVD-SNRSTSLEVEK 704

Query: 691 LENLAAVANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEKTSLHFKPMRPA 750
           L++LA VA +FEEL+LP++E  L  +AKQE WC QIE +LN  MD++ + SLHFKPMRP 
Sbjct: 705 LKDLAKVATTFEELQLPYNETTLSIYAKQEKWCDQIEEILNKLMDDKARPSLHFKPMRPP 764

Query: 751 QRHFIHELAKSYNLYVESQDREPKRSVFVKKQDNGGSCKPVIQLKDSLPIYQFFKENEKE 810
           QRHFI E AKS+NLY E+QDREPKRSVFVKK+++G S KP+I L D+LP+YQ FKE EKE
Sbjct: 765 QRHFIQEFAKSFNLYAEAQDREPKRSVFVKKEEDGSSSKPIISLHDALPLYQTFKELEKE 824

Query: 811 KKAQRFEAQTTTEFVNFIPKEEPQLERAKNNAFKLKNVSTGTTKEDLERIFADHLKPTLV 870
           +K + FEA+TTT  +N    +E  +  AK + F +K +S GTT EDL+RIF   L  TL+
Sbjct: 825 RKLKEFEARTTTRLINVEAPQEDNVYHAKYSGFLIKKISPGTTVEDLQRIFGQFLTSTLI 884

Query: 871 KNPQFKIQDSTKNGLIYPEDYAEISVNVERDLEALVGHFDYLCKESFIGDGIELCHIDLK 930
            NPQ+ I    K+ LIYPE+Y E+S  VERDLE LVGHFD++ KE+FI DG+ELC +++ 
Sbjct: 885 VNPQYLIIQDGKDALIYPENYQEMSAGVERDLETLVGHFDFISKENFIADGVELCDVEVA 944

Query: 931 VLQE 934
           +L E
Sbjct: 945 MLGE 948

>NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.288
           YNL023C
          Length = 968

 Score = 1169 bits (3025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/898 (61%), Positives = 679/898 (75%), Gaps = 6/898 (0%)

Query: 35  EHDMAYYERAVQEIALGDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREWALKSTEK 94
           + DM YYER +QEIA GD YVCMICTVEMDYTC+MYAC+ CYRVFDY+CIREWA+KSTEK
Sbjct: 55  DEDMKYYERTIQEIAKGDSYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVKSTEK 114

Query: 95  TLDRVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPICPHGCSKQ 154
           T+DR+WKCPNCY VNK+VP KNR TCWCGK VNP+ NPL+PNSCGQTC+A IC HGC+  
Sbjct: 115 TVDRIWKCPNCYHVNKKVPPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHGCTNI 174

Query: 155 CHLGPHPDCVRTITTKCQCGKHTRETFCYQTISMKGKSQFQCNEVCGLPLACGIHKCERL 214
           CHLGPHP+C R ++  C+CGKHT++ FCYQ+ + KG S+FQC + CGLPL+CGIHKC+R 
Sbjct: 175 CHLGPHPECTRMLSITCRCGKHTKDIFCYQSKTFKGNSKFQCKDECGLPLSCGIHKCKRK 234

Query: 215 CHSGICGPCPAVLNA-KSNKLKIRCYCGLEHRDSFKCKDVRV--ASDLSKDGKGDSWIGA 271
           CHSG+CG CP  L   + N   ++CYCG E + S KCKD+++  ++  S D +G+ WIG 
Sbjct: 235 CHSGLCGVCPERLEVNEENAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGNKWIGV 294

Query: 272 FGCSGIRKIEYACREHSFVEKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKVLAEPRKS 331
           F C  IR ++Y C +HSF+E+C   P++S +  CP+SPKLLKTCPCG+T L+ LA+PR  
Sbjct: 295 FACKEIRTVQYDCDKHSFIERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLAKPRTL 354

Query: 332 CTSPIPNCDSTCGKKLACGRHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSVPCQFKEQ 391
           CT PIP C+S C K L CG+H CPF CH G CMDPC+QIET +CSC +  + VPCQF   
Sbjct: 355 CTDPIPTCESHCNKPLKCGKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPCQFTGS 414

Query: 392 PRCDTKCESLMSXXXXXXXXXXXXXXPFAERRRKTPLSSRELMDESSVESEHICLKDCNL 451
           P C+ KCESLMS              P AE+R+KT   S++LMDE+ VE+EHICLK+CNL
Sbjct: 415 PHCNIKCESLMSCRRHRCLERCCSGRPAAEKRKKTLFRSQDLMDETLVEAEHICLKECNL 474

Query: 452 TLSCGCHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHYPCIRVIQ 511
            LSCG H+CQRKCHPGKCPPCLESDSNDLVCPCGKT+VEAPVRCGT+LPPC + CI+V++
Sbjct: 475 LLSCGIHRCQRKCHPGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQCIKVVR 534

Query: 512 NAYKCGHKPMPHTCHPLNEPCPSCTAPVFKPCKCGKKDKVRTLCFQNDVSCGTTCGKPLD 571
           N Y CGH PMPHTCHPL+EPCP CTAPVFKPCKCGK  +VRTLCFQNDVSCG  CG PL 
Sbjct: 535 NEYPCGHTPMPHTCHPLDEPCPPCTAPVFKPCKCGKVKEVRTLCFQNDVSCGKICGLPLK 594

Query: 572 NCPHMCQKSCHIPGECQKKCKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLSVKIKCEC 631
           +CPH C K CHIPG+CQ KCKQIC ++RI CDH C   CHGN +CPD+PC +S K+ CEC
Sbjct: 595 DCPHKCMKRCHIPGDCQTKCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAKVTCEC 654

Query: 632 EVKESFITCGANSETPSKATTTILPCDEECERHKRHLQLREAFGISNFSDNPSRSKTASL 691
             +E+++TCGA S   S  TTTIL CDEECE  +RH QL+EAFGI     + +  +   L
Sbjct: 655 GRRETYVTCGAMSNIASAVTTTILECDEECEMLERHRQLKEAFGIKEIISSSTDLEFERL 714

Query: 692 ENLAAVANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEKTSLHFKPMRPAQ 751
           +++   A +FEEL+LPF+E  L  F++QE WC QIE ++N FMD++ + SLHFKPMRP Q
Sbjct: 715 KDIVPTAIAFEELQLPFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKPMRPPQ 774

Query: 752 RHFIHELAKSYNLYVESQDREPKRSVFVKKQDNGGSCKPVIQLKDSLPIYQFFKENEKEK 811
           RHFIHEL+K+YNLY ESQD EPKRSVF+KK  N  S KP   L   LP+YQ FKE EKE+
Sbjct: 775 RHFIHELSKAYNLYCESQDPEPKRSVFIKK--NTTSSKPSFSLSKVLPLYQTFKELEKER 832

Query: 812 KAQRFEAQTTTEFVNF-IPKEEPQLERAKNNAFKLKNVSTGTTKEDLERIFADHLKPTLV 870
           K Q FEA+T+   VN  +P+       A+ N F +K++S GTT EDLERIF  +LK TL+
Sbjct: 833 KLQEFEARTSKRLVNVEVPEGPTDNYIAEANGFLIKDLSPGTTVEDLERIFGQYLKSTLI 892

Query: 871 KNPQFKIQDSTKNGLIYPEDYAEISVNVERDLEALVGHFDYLCKESFIGDGIELCHID 928
           KNPQ+ +    K+G+IYPEDY  I+ NVERD ++LVGHFD L K++FI +G+ELC ID
Sbjct: 893 KNPQYLVLQDGKSGVIYPEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKID 950

>Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {ON}
           YNL023C (REAL)
          Length = 965

 Score = 1147 bits (2968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/908 (59%), Positives = 676/908 (74%), Gaps = 6/908 (0%)

Query: 28  SVHEVRDEHDMAYYERAVQEIALGDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREW 87
           S +E   + DM YYER++QEI+ GD Y+CMICTVEMDYTC+M+AC+ CYRVFDY CIREW
Sbjct: 40  SSYEEETDDDMQYYERSIQEISKGDSYICMICTVEMDYTCQMFACKRCYRVFDYGCIREW 99

Query: 88  ALKSTEKTLDRVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPIC 147
           A+KSTEKT+DR+WKCPNCY V K+VPA NRPTCWCGK VNPDPNPLDPNSCGQTC APIC
Sbjct: 100 AIKSTEKTVDRIWKCPNCYHVGKKVPANNRPTCWCGKVVNPDPNPLDPNSCGQTCSAPIC 159

Query: 148 PHGCSKQCHLGPHPDCVRTITTKCQCGKHTRETFCYQTISMKGKSQFQCNEVCGLPLACG 207
            HGCSK CHLGPHP+C R +   C CGKH++  FCYQ+ +MK    F+C E CGLPL+C 
Sbjct: 160 IHGCSKTCHLGPHPECTRMVEIMCHCGKHSQSIFCYQSKAMK--KNFKCQEECGLPLSCS 217

Query: 208 IHKCERLCHSGICGPCPAVLNAK-SNKLKIRCYCGLEHRDSFKCKDVRV--ASDLSKDGK 264
           +H C+R CH+G+CGPCP ++ +K S + +I+CYCG   R S KC + R   +   SKDG 
Sbjct: 218 VHNCKRKCHTGLCGPCPELITSKDSTEEQIKCYCGNHSRASIKCSEARFPKSGRSSKDGN 277

Query: 265 GDSWIGAFGCSGIRKIEYACREHSFVEKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKV 324
           G+ WIG F C+ IR ++++CR+HSF+E C   PS++G+  CPF P LLKTCPCGRT+L  
Sbjct: 278 GNEWIGVFACTDIRTVDFSCRKHSFIEPCLSPPSVNGRKVCPFLPSLLKTCPCGRTALDE 337

Query: 325 LAEPRKSCTSPIPNCDSTCGKKLACGRHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSV 384
           L +PRK C  PIP C+S C K L CG+H+CPF CHD  CMDPC+QI++ +C+C ++ +SV
Sbjct: 338 LTKPRKHCDDPIPTCNSRCSKPLKCGKHSCPFICHDLACMDPCLQIDSAKCACEQSTFSV 397

Query: 385 PCQFKEQPRCDTKCESLMSXXXXXXXXXXXXXXPFAERRRKTPLSSRELMDESSVESEHI 444
           PC F+ +PRC+ KCESLMS              P A +RRK    S++L+DES VE++HI
Sbjct: 398 PCGFQGRPRCNIKCESLMSCRRHRCTDRCCSGRPSAVKRRKNFFRSQDLLDESLVEAKHI 457

Query: 445 CLKDCNLTLSCGCHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHY 504
           CLK CNLTLSCG HKCQRKCHPGKCPPCLESDSNDL+CPCGKTVV APVRCGT LP C++
Sbjct: 458 CLKPCNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLICPCGKTVVPAPVRCGTELPVCNH 517

Query: 505 PCIRVIQNAYKCGHKPMPHTCHPLNEPCPSCTAPVFKPCKCGKKDKVRTLCFQNDVSCGT 564
           PCI+V++    CGHKPMPHTCHPL  PCP CT  VFKPCKCGKKDKVRT+CFQ DVSCGT
Sbjct: 518 PCIKVVRGESSCGHKPMPHTCHPLGVPCPPCTETVFKPCKCGKKDKVRTVCFQKDVSCGT 577

Query: 565 TCGKPLDNCPHMCQKSCHIPGECQKKCKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLS 624
            CG  L  C H CQK+CH+PG CQK CKQIC  +R+ C H C   CHG  +CPD+PCP  
Sbjct: 578 KCGLLLHFCRHTCQKTCHLPGNCQKVCKQICGHERLSCRHTCPKPCHGKTECPDLPCPTL 637

Query: 625 VKIKCECEVKESFITCGANSETPSKATTTILPCDEECERHKRHLQLREAFGISNFSDNPS 684
           VKI C+C   E  +TC A S       +++L CDEECE  KR  +LREAFGI   S+N +
Sbjct: 638 VKITCKCGRNEKSVTCSAKSGVVPANESSVLDCDEECEALKRLKELREAFGIKEESNNVT 697

Query: 685 RSKTASLENLAAVANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEKTSLHF 744
            ++  +L+ L +VA +FEEL LPF+E  L  ++KQE WC+QIE +LN  MD++ ++SLHF
Sbjct: 698 SNELDALKKLVSVATTFEELHLPFTETTLSVYSKQERWCSQIEVILNKLMDDKTRSSLHF 757

Query: 745 KPMRPAQRHFIHELAKSYNLYVESQDREPKRSVFVKKQDNGGSCKPVIQLKDSLPIYQFF 804
           KPMRP QRHFI ELAK+Y LY ESQDREP RSVF+KK+DNG S KPV+ L ++LP+Y+ F
Sbjct: 758 KPMRPPQRHFIRELAKAYGLYSESQDREPMRSVFIKKEDNGTSNKPVLSLGEALPLYESF 817

Query: 805 KENEKEKKAQRFEAQTTTEFVNF-IPKEEPQLERAKNNAFKLKNVSTGTTKEDLERIFAD 863
           K+ +KE+K Q F+++TT + +NF +   +P++E AKNN F ++N+ TG T EDL+R F  
Sbjct: 818 KQLQKERKVQEFQSRTTAKLINFEVQDAQPKVEVAKNNGFLVRNLVTGNTVEDLKRFFEP 877

Query: 864 HLKPTLVKNPQFKIQDSTKNGLIYPEDYAEISVNVERDLEALVGHFDYLCKESFIGDGIE 923
           HLK TLV NPQ+ I D  K  L+YPE+Y   SVN ERD+E LVGHFD++ KE+F+ D I 
Sbjct: 878 HLKHTLVVNPQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIL 937

Query: 924 LCHIDLKV 931
           LC  D +V
Sbjct: 938 LCSTDEEV 945

>Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {ON}
           YNL023C (REAL)
          Length = 968

 Score = 1143 bits (2957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/902 (59%), Positives = 670/902 (74%), Gaps = 6/902 (0%)

Query: 31  EVRDEHDMAYYERAVQEIALGDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREWALK 90
           E   + DM YYERA+QEIA GD Y+CMICTVEMDYTC+M+AC+ CYRVFDY CIREWALK
Sbjct: 47  EEESDDDMQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALK 106

Query: 91  STEKTLDRVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPICPHG 150
           STEKT+D++WKCPNCY + K+VP +NRPTCWCGK VNPD NPLDPNSCGQTC+AP C HG
Sbjct: 107 STEKTVDKIWKCPNCYHIGKKVPTRNRPTCWCGKVVNPDHNPLDPNSCGQTCNAPTCVHG 166

Query: 151 CSKQCHLGPHPDCVRTITTKCQCGKHTRETFCYQTISMKGKSQFQCNEVCGLPLACGIHK 210
           CSK CHLGPHP+C RT+  KC+CGKH++  FCYQ+ +MK    F C E CGLPL+CGIHK
Sbjct: 167 CSKICHLGPHPECTRTVEIKCRCGKHSKSIFCYQSKAMK--KHFDCQEECGLPLSCGIHK 224

Query: 211 CERLCHSGICGPCPAVLNAKSNKLK-IRCYCGLEHRDSFKCKDVRV--ASDLSKDGKGDS 267
           C++ CHSG+CGPCP ++ ++   +  I+CYCG+  +DS KC +V    +   SKD  G+ 
Sbjct: 225 CKKKCHSGLCGPCPELIMSEDKAMDWIKCYCGIHSKDSIKCCEVNFPKSGRSSKDESGNE 284

Query: 268 WIGAFGCSGIRKIEYACREHSFVEKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKVLAE 327
           WIG F C  IR ++YAC +HSF+E C   P+++GK  CPF P LLKTCPCGRT+L+ L +
Sbjct: 285 WIGVFACKDIRTVDYACHKHSFIEPCISPPTVNGKKTCPFLPSLLKTCPCGRTALEELTK 344

Query: 328 PRKSCTSPIPNCDSTCGKKLACGRHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSVPCQ 387
           PRK CT PIP C S C K L CG+H+CPF CHDG CMDPC+Q ++V+C+C ++ + VPC 
Sbjct: 345 PRKHCTDPIPTCSSRCSKPLKCGKHSCPFICHDGACMDPCLQTDSVKCACEQSTFLVPCG 404

Query: 388 FKEQPRCDTKCESLMSXXXXXXXXXXXXXXPFAERRRKTPLSSRELMDESSVESEHICLK 447
           F+E+P C+ KCESLMS              P A  R+K    S++LMDES VE++HICLK
Sbjct: 405 FQEKPHCNIKCESLMSCRRHRCIDRCCSGRPSALERKKRIFRSQDLMDESLVEAQHICLK 464

Query: 448 DCNLTLSCGCHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHYPCI 507
            CNLTLSCG HKCQRKCHPGKCPPCLESDSNDLVCPCGKTV+ APVRCGT+LP C+Y CI
Sbjct: 465 PCNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVIPAPVRCGTKLPLCNYACI 524

Query: 508 RVIQNAYKCGHKPMPHTCHPLNEPCPSCTAPVFKPCKCGKKDKVRTLCFQNDVSCGTTCG 567
           +V++   +CGHKPMPHTCHPL+  CP CT  VFKPCKCGKKDKVRT+CFQ DVSCGTTCG
Sbjct: 525 KVVRGESECGHKPMPHTCHPLDLACPPCTETVFKPCKCGKKDKVRTVCFQTDVSCGTTCG 584

Query: 568 KPLDNCPHMCQKSCHIPGECQKKCKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLSVKI 627
           KPL  C H CQK+CH+P  CQK CKQIC +KR  CDH C   CHG  +CPD+PC   VKI
Sbjct: 585 KPLSGCHHTCQKTCHLPENCQKVCKQICRQKRPNCDHACPKPCHGRSECPDLPCASLVKI 644

Query: 628 KCECEVKESFITCGANSETPSKATTTILPCDEECERHKRHLQLREAFGISNFSDNPSRSK 687
            C+C   E  + CGA S   S      L C+EECE  KR  +LREAFGIS  S+  + ++
Sbjct: 645 TCKCGRIEKKVACGAKSNVVSVTEAPQLDCNEECEALKRLKELREAFGISEESNESTNNE 704

Query: 688 TASLENLAAVANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEKTSLHFKPM 747
             +L+ L +VA +FEEL+LPF+E  L  +AKQE WC QIEN++N  M ++ ++SLHFKPM
Sbjct: 705 LDTLKKLVSVATTFEELQLPFTETVLSVYAKQEGWCLQIENIVNKLMSDKTRSSLHFKPM 764

Query: 748 RPAQRHFIHELAKSYNLYVESQDREPKRSVFVKKQDNGGSCKPVIQLKDSLPIYQFFKEN 807
           RP QRHFI ELAK+YNLY ESQDREP RSVF+KK+DN  S +P++ L ++ P+Y+ FKE 
Sbjct: 765 RPPQRHFIRELAKAYNLYSESQDREPMRSVFIKKEDNSKSSRPILSLAEAFPLYESFKEL 824

Query: 808 EKEKKAQRFEAQTTTEFVNF-IPKEEPQLERAKNNAFKLKNVSTGTTKEDLERIFADHLK 866
           +KE+K Q F+A+TT + +NF +   EP++E AKNN F ++ +  G   +DL R F  HLK
Sbjct: 825 QKERKIQEFQARTTAKLINFEVRDAEPKVELAKNNGFLVQKLVNGNDVDDLRRFFEPHLK 884

Query: 867 PTLVKNPQFKIQDSTKNGLIYPEDYAEISVNVERDLEALVGHFDYLCKESFIGDGIELCH 926
            TLV  PQ+ I D  K  L+YPE+Y E+SVN ERD++ LVGHFD++ KE+F+ D I LC 
Sbjct: 885 HTLVVKPQYLIIDDGKTALVYPENYQEVSVNTERDMDILVGHFDFMAKEAFLADSISLCS 944

Query: 927 ID 928
           ID
Sbjct: 945 ID 946

>Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {ON}
           YNL023C (REAL)
          Length = 970

 Score = 1141 bits (2951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/905 (59%), Positives = 678/905 (74%), Gaps = 6/905 (0%)

Query: 31  EVRDEHDMAYYERAVQEIALGDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREWALK 90
           E   + D+ YYERA+QEIA GD Y+CMICTVEMDYTC+M+AC+ CYRVFDY CIREWALK
Sbjct: 48  EEESDDDLQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALK 107

Query: 91  STEKTLDRVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPICPHG 150
           STEKT+D++WKCPNCY V K+VP +NRPTCWCG  VNPDPN LDPNSCGQTC+AP C HG
Sbjct: 108 STEKTVDKIWKCPNCYHVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHG 167

Query: 151 CSKQCHLGPHPDCVRTITTKCQCGKHTRETFCYQTISMKGKSQFQCNEVCGLPLACGIHK 210
           C K CHLGPHP+C R +  KC CG+H++  FCYQ+ +M+ +  F C E CGL L+CG+HK
Sbjct: 168 CFKICHLGPHPECTRMVEIKCHCGRHSKTIFCYQSKAMRRR--FNCQEECGLSLSCGVHK 225

Query: 211 CERLCHSGICGPCPA-VLNAKSNKLKIRCYCGLEHRDSFKCKDVRV--ASDLSKDGKGDS 267
           C++ CHSG+CG CP  ++N  S+K +I+CYCG   ++S KC + R   +   SKD  G+ 
Sbjct: 226 CKKKCHSGLCGSCPEFIINDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNE 285

Query: 268 WIGAFGCSGIRKIEYACREHSFVEKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKVLAE 327
           W G F C+ IR ++YAC +HSF+E C   P+ISG+  CPF P LLKTCPCGRT+L+ L +
Sbjct: 286 WAGVFACADIRTVDYACHKHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTK 345

Query: 328 PRKSCTSPIPNCDSTCGKKLACGRHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSVPCQ 387
           PRK C  PIP C+S C K L CG+H CPFTCHDG CMDPC+QI++  CSC ++ +S+PC 
Sbjct: 346 PRKHCHDPIPTCNSRCSKPLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCG 405

Query: 388 FKEQPRCDTKCESLMSXXXXXXXXXXXXXXPFAERRRKTPLSSRELMDESSVESEHICLK 447
           F+E PRC+ KCESLMS              P A RR+K+   S++L+DES VE++HICLK
Sbjct: 406 FQESPRCNIKCESLMSCRRHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLK 465

Query: 448 DCNLTLSCGCHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHYPCI 507
            CNLTLSCG HKCQRKCHPGKCPPCLESDSNDL+C CGKTVV APVRCGT+LP C++PCI
Sbjct: 466 PCNLTLSCGLHKCQRKCHPGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCI 525

Query: 508 RVIQNAYKCGHKPMPHTCHPLNEPCPSCTAPVFKPCKCGKKDKVRTLCFQNDVSCGTTCG 567
           +V++    CGHKPMPHTCHP N  CP CT  VFKPC+CGKKDKVRT+CFQ DVSCGT+CG
Sbjct: 526 KVVRGESWCGHKPMPHTCHPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCG 585

Query: 568 KPLDNCPHMCQKSCHIPGECQKKCKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLSVKI 627
            PL  C H CQK+CH+ G+CQK CKQIC +KR+ C H C   CHG  +CPD+PC   VKI
Sbjct: 586 IPLSGCYHTCQKTCHLLGKCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKI 645

Query: 628 KCECEVKESFITCGANSETPSKATTTILPCDEECERHKRHLQLREAFGISNFSDNPSRSK 687
            CEC   +  ITC A  +T S  T++IL C+EECE  KR  +LREAFG+S   +N  R++
Sbjct: 646 TCECGRIKKSITCSAKRDTVSVITSSILDCNEECETLKRLKELREAFGVSEGPNNVIRNE 705

Query: 688 TASLENLAAVANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEKTSLHFKPM 747
             +L  L +VA +FEEL+LPF+E  L  ++KQE WC QIE +LN  MD+E ++SLHFKPM
Sbjct: 706 LDALSELVSVAKTFEELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPM 765

Query: 748 RPAQRHFIHELAKSYNLYVESQDREPKRSVFVKKQDNGGSCKPVIQLKDSLPIYQFFKEN 807
           RP QRHFIHE+AK+YNLY ESQDREP RSVF+KK+DN  S KPV+ L ++ P+Y+ FK++
Sbjct: 766 RPPQRHFIHEMAKAYNLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQS 825

Query: 808 EKEKKAQRFEAQTTTEFVNF-IPKEEPQLERAKNNAFKLKNVSTGTTKEDLERIFADHLK 866
           +KE+K Q F+A+TT + +NF +   E ++E AKNN F ++N+ +G T EDL+R F  HLK
Sbjct: 826 QKERKLQEFQARTTAKLINFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLK 885

Query: 867 PTLVKNPQFKIQDSTKNGLIYPEDYAEISVNVERDLEALVGHFDYLCKESFIGDGIELCH 926
            TLV NPQ+ I D +++ LIYPE+Y   SVN ERD+E LVGHFD++ KE+F+ D I LC 
Sbjct: 886 HTLVANPQYLILDDSRSALIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCS 945

Query: 927 IDLKV 931
           +D ++
Sbjct: 946 VDEEI 950

>ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 953

 Score = 1137 bits (2941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/891 (61%), Positives = 664/891 (74%), Gaps = 7/891 (0%)

Query: 38  MAYYERAVQEIALGDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREWALKSTEKTLD 97
           M YYERAV+EIA GD YVCMICTVEMDYTCKM+AC  CYRVFDY+CIREWALKST +T+D
Sbjct: 56  MMYYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMD 115

Query: 98  RVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPICPHGCSKQCHL 157
           + WKCPNC   + +VP K+RPTCWCGK VNPDPNPLDPNSCGQTCDAPIC HGCSK CHL
Sbjct: 116 KTWKCPNCLDESNKVPRKSRPTCWCGKVVNPDPNPLDPNSCGQTCDAPICEHGCSKVCHL 175

Query: 158 GPHPDCVRTITTKCQCGKHTRETFCYQTISMKGKSQFQCNEVCGLPLACGIHKCERLCHS 217
           GPHP+C R I+ KC+CG+HTR+  C +  S + + QF C E CGL L CG+HKC + CHS
Sbjct: 176 GPHPECTRIISIKCKCGRHTRDVRCSEVGSGRNQ-QFTCEESCGLLLPCGVHKCSKKCHS 234

Query: 218 GICGPCPAVLNAKSNK-LKIRCYCGLEHRDSFKCKDVRVASDLSKDGKGDSWIGAFGCSG 276
           G+CG C   L++K +K   I+CYCGL    S +C DVRVA   S D +G+ WIG F C  
Sbjct: 235 GLCGGCNETLHSKPDKGAVIKCYCGLHESPSIRCGDVRVADRDSVDDQGNGWIGVFRCKD 294

Query: 277 IRKIEYACREHSFVEKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKVLAEPRKSCTSPI 336
           +R +EYAC +HSFVE C+P+PS+  +I CPFSP +L++CPCGRT L  L + R  CT  I
Sbjct: 295 VRVVEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTDHI 354

Query: 337 PNCDSTCGKKLACGRHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSVPCQFKEQPRCDT 396
           P C+S CGKKLACG+HTCP+ CH+G CMDPC+Q E   C C    + VPCQF+E PRC+T
Sbjct: 355 PTCESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRCNT 414

Query: 397 KCESLMSXXXXXXXXXXXXXXPFAERRRKTPLSSRELMDESSVESEHICLKDCNLTLSCG 456
           KCESLMS              P AERR+KTP +SREL+DES VE+EH+CLK CNLTL+CG
Sbjct: 415 KCESLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTLTCG 474

Query: 457 CHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHYPCIRVIQNAYKC 516
            HKCQRKCHPG+CPPCLESD NDLVCPCGKTVVEAPVRCGT+LPPC Y CI V+++ Y C
Sbjct: 475 RHKCQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGYPC 534

Query: 517 GHKPMPHTCHPLNEPCPSCTAPVFKPCKCGKKDKVRTLCFQNDVSCGTTCGKPLDNCPHM 576
           GH PMPH CHP  E CP CTA V KPCKCGKK  VRTLCFQ DVSCG  C KPL +C H 
Sbjct: 535 GHTPMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSCRHT 594

Query: 577 CQKSCHIPGECQKKCKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLSVKIKCECEVKES 636
           CQK CH  G CQ KC+QIC +KR+ CDHKC   CHG + CPD PCP SV IKC C  KES
Sbjct: 595 CQKKCH-DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRKES 653

Query: 637 FITCGANSETPSKATTTILPCDEECERHKRHLQLREAFGISNFSDNPSRSKTASLENLAA 696
              CG NS+T S + T  L CDEECER KR  QL++A G+    D+   +  ++    A 
Sbjct: 654 TEPCGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLKENGDSSVENTVSN----AL 709

Query: 697 VANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEKTSLHFKPMRPAQRHFIH 756
           VA++FEEL LPF E  L  +++Q+ +C  IE+VLN+F+D+E+K+SLHFKPM+PAQRHF+H
Sbjct: 710 VASNFEELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHFVH 769

Query: 757 ELAKSYNLYVESQDREPKRSVFVKKQDNGGSCKPVIQLKDSLPIYQFFKENEKEKKAQRF 816
           ELAK+Y LY ESQD EPKRSV+VKK+ NG S KP I L+++LPIYQ FK+ EKE K +R+
Sbjct: 770 ELAKAYKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIRRY 829

Query: 817 EAQTTTEFVNFIPKEEPQLERAKNNAFKLKNVSTGTTKEDLERIFADHLKPTLVKNPQFK 876
           E Q  T  VNF+PK EP +E AK N F ++N++ GT  EDL+RI+ +HLKPTLV+NP +K
Sbjct: 830 EMQNVTNLVNFVPKFEPTVELAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNPVYK 889

Query: 877 IQDSTKNGLIYPEDYAEISVNVERDLEALVGHFDYLCKESFIGDGIELCHI 927
                   LI+PE Y++++VN E D+E LVGHFD++CKE FIGDG+ELC +
Sbjct: 890 ALPDRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQV 940

>YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON}
           FAP1Protein that binds to Fpr1p, conferring rapamycin
           resistance by competing with rapamycin for Fpr1p
           binding; accumulates in the nucleus upon treatment of
           cells with rapamycin; has similarity to D. melanogaster
           shuttle craft and human NFX1
          Length = 965

 Score = 1135 bits (2937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/919 (58%), Positives = 680/919 (73%), Gaps = 14/919 (1%)

Query: 28  SVHEVRDEHDMAYYERAVQEIALGDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREW 87
           S +E   + DM YYERA+QEI+ GD YVCMICTVEMDYTC+M+AC+ CYRVFDY CIREW
Sbjct: 40  SSYEEESDDDMQYYERAIQEISSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYGCIREW 99

Query: 88  ALKSTEKTLDRVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPIC 147
           ALKSTEKT+DR+WKCPNCY V+KRVP KNRPTCWCGK VNPDPNPLDPNSCGQTC+A  C
Sbjct: 100 ALKSTEKTVDRIWKCPNCYYVSKRVPVKNRPTCWCGKVVNPDPNPLDPNSCGQTCNASTC 159

Query: 148 PHGCSKQCHLGPHPDCVRTITTKCQCGKHTRETFCYQTISMKGKSQFQCNEVCGLPLACG 207
            HGCSK CHLGPHP+C R +   C CGKH++  FCYQ+  MK    F C EVCGLPL+C 
Sbjct: 160 MHGCSKICHLGPHPECTRMVEIMCHCGKHSKSIFCYQSKVMK--KNFNCQEVCGLPLSCS 217

Query: 208 IHKCERLCHSGICGPCPAVLNAK-SNKLKIRCYCGLEHRDSFKCKDVRV--ASDLSKDGK 264
           IH C++ CH G+CGPCP ++ +K S K +I+CYCG   R + KC + +   +   SKD  
Sbjct: 218 IHTCKKKCHPGLCGPCPEMIISKDSPKKQIKCYCGNHTRANIKCSETKFPKSGKSSKDEN 277

Query: 265 GDSWIGAFGCSGIRKIEYACREHSFVEKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKV 324
           G+ WIG F C+  R ++Y+CR+HSF+E C   P+I+G+ ACPF P  LKTCPCGRT+L+ 
Sbjct: 278 GNRWIGVFACADNRVVDYSCRKHSFIESCISPPTINGEKACPFLPSSLKTCPCGRTALEE 337

Query: 325 LAEPRKSCTSPIPNCDSTCGKKLACGRHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSV 384
           L +PRK C  PIP CDS CGK L CG+H+CPFTCHD  CM+PC+QI++V+C+C ++ +SV
Sbjct: 338 LTKPRKHCDDPIPTCDSRCGKPLKCGKHSCPFTCHDKACMEPCLQIDSVKCACEQSTFSV 397

Query: 385 PCQFKEQPRCDTKCESLMSXXXXXXXXXXXXXXPFAERRRKTPLSSRELMDESSVESEHI 444
           PC F+ +PRC+ KCESLMS              P A RR+K    +++L+DES VE++HI
Sbjct: 398 PCGFQGRPRCNIKCESLMSCRRHRCTDRCCSGRPSAIRRKKNLFRTQDLLDESLVEAKHI 457

Query: 445 CLKDCNLTLSCGCHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHY 504
           CLK CNLTLSCG HKCQRKCHPGKCPPCLESDSNDLVCPCG TVV APVRCGT+LP C++
Sbjct: 458 CLKPCNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLVCPCGNTVVPAPVRCGTKLPTCNH 517

Query: 505 PCIRVIQNAYKCGHKPMPHTCHPLNEPCPSCTAPVFKPCKCGKKDKVRTLCFQNDVSCGT 564
           PCI+V++    CGHKPMPHTCH L+  CP CT  VFKPCKCGKK KVRT+CFQ DVSCG 
Sbjct: 518 PCIKVVRGESTCGHKPMPHTCHSLDVSCPPCTETVFKPCKCGKKTKVRTVCFQTDVSCGI 577

Query: 565 TCGKPLDNCPHMCQKSCHIPGECQKKCKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLS 624
            CG PL  C H CQK+CH+PG CQK CKQ C +KR+ C+H+C   CHG  +CPD+PC   
Sbjct: 578 KCGIPLSYCYHTCQKTCHLPGNCQKVCKQTCGQKRLNCNHECPKPCHGKTECPDLPCATL 637

Query: 625 VKIKCECEVKESFITCGANSETPSKATTTILPCDEECERHKRHLQLREAFGISNFSDNPS 684
           VKI C+C   +  +TCGA S+  S   +++L C+EECE  KR  +L+EAFGI   ++N +
Sbjct: 638 VKIYCKCGRIKKSVTCGAKSDRVSVTESSVLDCNEECEALKRLKELKEAFGIKEETNNFT 697

Query: 685 RSKTASLENLAAVANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEKTSLHF 744
            ++  +L+ L +VA +FEEL+LPF+E AL  ++KQE WC+QIE +LN  MD++ ++SLHF
Sbjct: 698 SNELDALKKLVSVATTFEELQLPFTEAALSVYSKQERWCSQIEAILNKLMDDKTRSSLHF 757

Query: 745 KPMRPAQRHFIHELAKSYNLYVESQDREPKRSVFVKKQDNGGSCKPVIQLKDSLPIYQFF 804
           KPMRP QRHFI ELAK+Y LY ESQDREP RSVF+KK+DNG S KPV+ L ++ P+Y+ F
Sbjct: 758 KPMRPPQRHFIRELAKAYGLYSESQDREPMRSVFIKKEDNGASNKPVLSLAEAYPLYESF 817

Query: 805 KENEKEKKAQRFEAQTTTEFVNF-IPKEEPQLERAKNNAFKLKNVSTGTTKEDLERIFAD 863
           K+ +KE+KAQ F+A+TT + +NF +   EP++E AK N F ++N+  G T EDL R F  
Sbjct: 818 KQLQKERKAQEFQARTTAKLINFEVQDTEPKVEVAKKNGFLVQNLVAGNTAEDLRRFFEP 877

Query: 864 HLKPTLVKNPQFKIQDSTKNGLIYPEDYAEISVNVERDLEALVGHFDYLCKESFIGDGIE 923
           HLK TLV NPQ+ I D  K  L+YPE+Y   SVN ERD+E LVGHFD++ KE+F+ D I 
Sbjct: 878 HLKHTLVVNPQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIS 937

Query: 924 LC--------HIDLKVLQE 934
           LC         +D  V+QE
Sbjct: 938 LCSTEEELERRLDTPVIQE 956

>KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {ON}
           Anc_2.288 YNL023C
          Length = 966

 Score = 1123 bits (2906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/907 (59%), Positives = 674/907 (74%), Gaps = 8/907 (0%)

Query: 32  VRDEHDMAYYERAVQEIALGDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREWALKS 91
           + D  DM YYERA+QEIA GD Y+CMICTVEMDYTCKMYAC+ C R+FDY+CIREWALKS
Sbjct: 47  LSDNDDMMYYERAIQEIAAGDSYICMICTVEMDYTCKMYACKKCCRIFDYDCIREWALKS 106

Query: 92  TEKTLDRVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPICPHGC 151
           TEKT +R+WKCPNCY VNK+VP KNR TCWCGK VNP+ NPL+PNSCGQTC+AP+C HGC
Sbjct: 107 TEKTKERIWKCPNCYHVNKKVPTKNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGC 166

Query: 152 SKQCHLGPHPDCVRTITTKCQCGKHTRETFCYQTISMKGK-SQFQCNEVCGLPLACGIHK 210
           SK CHLGPHP+C+RTIT KC CGKH R+  C+Q+ S  G+ ++F C E CGLPL+CGIH 
Sbjct: 167 SKICHLGPHPECLRTITMKCDCGKHERQISCFQSKSQSGRRNRFSCEEECGLPLSCGIHT 226

Query: 211 CERLCHSGICGPCPAVLNAKSNK-LKIRCYCGLEHRDSFKCKDVRVASDLSKDGKGDSWI 269
           C++ CHSG+CG CP +L     K   I+CYCGLE + SF CKDV+  + LS+D +G+ W+
Sbjct: 227 CKKKCHSGLCGSCPELLEVNEEKCATIKCYCGLETKKSFPCKDVKAPTTLSRDAEGNKWV 286

Query: 270 GAFGCSGIRKIEYACREHSFVEKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKVLAEPR 329
           G F C+ IR +EY+C++HSFVE C   P++SG   CPFSP LLKTCPCGRT L  L++PR
Sbjct: 287 GVFSCNKIRNVEYSCQKHSFVESCVAPPTVSGTKQCPFSPNLLKTCPCGRTPLNALSKPR 346

Query: 330 KSCTSPIPNCDSTCGKKLACGRHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSVPCQFK 389
             CT P+P C++ C K L CG+H CPFTCH+GPCMDPCIQI+   CSCH++ +  PCQF+
Sbjct: 347 LKCTDPVPTCEACCNKPLKCGKHRCPFTCHNGPCMDPCIQIDKKPCSCHQSFFLTPCQFE 406

Query: 390 EQPRCDTKCESLMSXXXXXXXXXXXXXXPFAERRRKTPLSSRELMDESSVESEHICLKDC 449
            +P C+ KCESLMS              P AE+R+KT   S ++ DE+ VE++H+CLK+C
Sbjct: 407 GEPHCNIKCESLMSCRRHRCTERCCSGRPLAEKRKKTLFRSSDINDETLVEAQHVCLKEC 466

Query: 450 NLTLSCGCHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHYPCIRV 509
           NL LSCG H+CQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGT+L PC +PCI+V
Sbjct: 467 NLMLSCGKHRCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTKLSPCLFPCIKV 526

Query: 510 IQNAYKCGHKPMPHTCHPLNEPCPSCTAPVFKPCKCGKKDKVRTLCFQNDVSCGTTCGKP 569
           I+N   CGH P+PH+CHPL++PCP CTA VFKPCKCGK+DKVRT+CFQ DVSCG  CG P
Sbjct: 527 IRNESVCGHPPVPHSCHPLDQPCPPCTATVFKPCKCGKRDKVRTVCFQKDVSCGKICGLP 586

Query: 570 LDNCPHMCQKSCHIPGECQKKCKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLSVKIKC 629
           L  C H CQK CH  GECQ KCKQ+C +KR+ C H+C   CHG+ +C D PCP+S KI C
Sbjct: 587 LLTCHHKCQKVCHPNGECQVKCKQVCRKKRVNCVHECLKSCHGSTECSDSPCPVSTKISC 646

Query: 630 ECEVKESFITCGANSETPSKATTTILPCDEECERHKRHLQLREAFGISNFSDNPSRSKTA 689
            C  +ES++TC A S   S A  T L C+EECE  KRH +LREAFGI    + P    T 
Sbjct: 647 PCGRRESYVTCNATSTIDSAALITRLDCNEECEVVKRHRELREAFGIVE-KEEPENLGTE 705

Query: 690 SLENLAAVANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEKTSLHFKPMRP 749
            L++ A  A ++++L+LP++EPAL  + KQ  WC QIE +L  FMD+  + SLHFKPMRP
Sbjct: 706 RLQSFAQSATNYDDLQLPYTEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLHFKPMRP 765

Query: 750 AQRHFIHELAKSYNLYVESQDREPKRSVFVKKQDNGGSCKPVIQLKDSLPIYQFFKENEK 809
            QR+FIHE+AK++NLY ESQDREPKRSVF+KK D+G S KP ++L D LP+YQ FK+ EK
Sbjct: 766 PQRYFIHEIAKAFNLYAESQDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQNFKKLEK 825

Query: 810 EKKAQRFEAQTTTEFVNFIPKEEPQLERAK--NNAFKLKNVSTGTTKEDLERIFADHLKP 867
           E+KA++FEA+TT   +N I  ++   ER K  NN   +KN+S G T E L   F    K 
Sbjct: 826 ERKAKQFEARTTARLMN-ITLDDTLEERKKFENNGLIIKNLSNGITLEFLSEFFNKFFKS 884

Query: 868 TLVKNPQFKIQDSTKNGLIYPEDYAEISVNVERDLEALVGHFDYLCKESFIGDGIELCHI 927
           TL+KNPQ+ I ++  NGLIYPE + EI+  V  DL+ LVGHF+ + KE  IGD +E+C+I
Sbjct: 885 TLIKNPQYLIIEN--NGLIYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSVEMCNI 942

Query: 928 DLKVLQE 934
           + ++ +E
Sbjct: 943 ENELPEE 949

>KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {ON}
           Anc_2.288 YNL023C
          Length = 973

 Score = 1112 bits (2875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/914 (57%), Positives = 659/914 (72%), Gaps = 7/914 (0%)

Query: 28  SVHEVRDEHDMAYYERAVQEIALGDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREW 87
           +  +  ++ D+ YYERAV+EIA GD Y CMICTVEMDYTCKM+AC  CYRVFDY+C+REW
Sbjct: 41  ATSDTEEDQDLPYYERAVREIAKGDLYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREW 100

Query: 88  ALKSTEKTLDRVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPIC 147
           A+KST+KT+DR+WKCPNCY VNK+VP KNRPTCWCGK VNP+PNPLDPNSCGQTCDA IC
Sbjct: 101 AIKSTDKTVDRIWKCPNCYLVNKKVPTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKIC 160

Query: 148 PHGCSKQCHLGPHPDCVRTITTKCQCGKHTRETFCYQTISMKGKSQFQCNEVCGLPLACG 207
            HGCSK CHLGPHP+C+RT + KC+CGK T+E  C++T   +G++ FQCNE C   L CG
Sbjct: 161 IHGCSKICHLGPHPECLRTTSVKCRCGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCG 220

Query: 208 IHKCERLCHSGICGPCPAVLNAK-SNKLKIRCYCGLEHRDSFKCKDVRVASDLSKDGKGD 266
           IH+C+++CHSG+CG CP  L  K  + + I CYCG   R+S KCKDV V    SK+  GD
Sbjct: 221 IHRCQKICHSGLCGSCPENLTVKEGDDVSISCYCGQHTRNSIKCKDVNVTGRKSKNANGD 280

Query: 267 SWIGAFGCSGIRKIEYACREHSFVEKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKVLA 326
            WIG + C  IR +EY+CR+HSF E+C   P+++G   CPFSPK LKTC CG+T L+ L 
Sbjct: 281 EWIGVYACKDIRSVEYSCRQHSFFEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALG 340

Query: 327 EPRKSCTSPIPNCDSTCGKKLACGRHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSVPC 386
           + R+ C  PIP+C+S C K L CG+HTCPF CHDGPCMDPCIQI+ V+C+C +N + VPC
Sbjct: 341 KARRRCIDPIPHCESRCDKLLKCGKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPC 400

Query: 387 QFKEQPRCDTKCESLMSXXXXXXXXXXXXXXPFAERRRKTPLSSRELMDESSVESEHICL 446
            F+  P C  KCESL+S              P AE RRK     +++ DE+ +E+EH+CL
Sbjct: 401 GFQGAPHCQLKCESLLSCRRHKCAERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCL 460

Query: 447 KDCNLTLSCGCHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHYPC 506
           K CNLTLSCG H+CQRKCHPGKCPPCLESDSNDLVCPCGKT+V APVRCGT+LP C +PC
Sbjct: 461 KACNLTLSCGQHQCQRKCHPGKCPPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPC 520

Query: 507 IRVIQNAYKCGHKPMPHTCHPLNEPCPSCTAPVFKPCKCGKKDKVRTLCFQNDVSCGTTC 566
           I+V++   +CGHKP+PH CHPL++PCP CTA VFKPCKCGK  +VRT+CFQ DVSCG TC
Sbjct: 521 IKVVEGISECGHKPIPHACHPLDQPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTC 580

Query: 567 GKPLDNCPHMCQKSCHIPGECQKKCKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLSVK 626
           GKPL NC H CQK+CH+PG+CQ  CKQ+CN+  + C HKCR  CHG   CPDI C   VK
Sbjct: 581 GKPLPNCHHFCQKTCHLPGQCQATCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVK 640

Query: 627 IKCECEVKESFITCGANSETPSKATTTILPCDEECERHKRHLQLREAFGISNFSDNPSRS 686
           I+C C  KE  +TCGA S   S   T  L CDEECE + RH QL+EAFGI++   N S  
Sbjct: 641 IRCPCGRKEVEVTCGATSTLSSSLFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAM 700

Query: 687 K---TASLENLAAVANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEKTSLH 743
           K      LE LA+ A +FEEL+ PF+E  + T+ +Q  WC +IE  LN+FMDNE K+SLH
Sbjct: 701 KEKEGTRLEGLASKATTFEELQFPFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLH 760

Query: 744 FKPMRPAQRHFIHELAKSYNLYVESQDREPKRSVFVKKQDNGGSCKPVIQLKDSLPIYQF 803
           FKPM+P QR FI ELAK+YNLY E+QD EPKRSVFVKK D+G S KP+  L +  P+YQ 
Sbjct: 761 FKPMKPPQRLFIRELAKAYNLYSEAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQS 820

Query: 804 FKENEKEKKAQRFEAQTTTEFVNFIPKEEPQL---ERAKNNAFKLKNVSTGTTKEDLERI 860
           FK  EKE+K Q F A+TTT  +N    ++         +NNAF +KN+S GTT +DL+ +
Sbjct: 821 FKLLEKERKMQDFLAKTTTHLINVKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNL 880

Query: 861 FADHLKPTLVKNPQFKIQDSTKNGLIYPEDYAEISVNVERDLEALVGHFDYLCKESFIGD 920
           F  +++ TL++NPQ++      + ++YPEDY  IS N   D+E LVGH +++  ++F+ D
Sbjct: 881 FGKYMEKTLIRNPQYQELPEENSAIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLAD 940

Query: 921 GIELCHIDLKVLQE 934
             ELC    K+ +E
Sbjct: 941 SAELCDASSKLPEE 954

>TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON}
           Anc_2.288 YNL023C
          Length = 995

 Score = 1072 bits (2772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/904 (57%), Positives = 644/904 (71%), Gaps = 5/904 (0%)

Query: 35  EHDMAYYERAVQEIALGDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREWALKSTEK 94
           E D+ YYERAV+EIA GD Y CMICTVEMD+TCKMYAC  CYRVFDY+CIREWALKST+K
Sbjct: 66  EEDLMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDYDCIREWALKSTQK 125

Query: 95  TLDRVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPICPHGCSKQ 154
           T+D+ WKCPNCY  +K+VP K+RPTCWCGK VNPDPNPLDPNSCGQTC+A ICPH C KQ
Sbjct: 126 TVDKTWKCPNCYHSSKKVPLKDRPTCWCGKVVNPDPNPLDPNSCGQTCNANICPHKCLKQ 185

Query: 155 CHLGPHPDCVRTITTKCQCGKHTRETFCYQTISMKGKSQFQCNEVCGLPLACGIHKCERL 214
           CHLG HP+C + +   C+CG+ T++ +C++  S + KS F C++ CGL L CGIHKC R 
Sbjct: 186 CHLGSHPECTQLLKITCRCGRETKDIYCHE--SRRQKSIFHCDQECGLTLPCGIHKCRRK 243

Query: 215 CHSGICGPCPAVLNAKSNKLKIRCYCGLEHRDSFKCKDVRVASD--LSKDGKGDSWIGAF 272
           CHSG+CG CP +L  ++   KI+CYCGL       CKDV   S   +S++ +   W+G F
Sbjct: 244 CHSGLCGSCPELLIDENVSGKIKCYCGLHSLKEMNCKDVAFPSSGKISRNQEDKEWVGIF 303

Query: 273 GCSGIRKIEYACREHSFVEKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKVLAEPRKSC 332
            C  +R + Y C EH FVE C   P++   + CPFSP LLKTCPCG+T+L+ +   R  C
Sbjct: 304 DCKEMRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKTALQDMDCERTKC 363

Query: 333 TSPIPNCDSTCGKKLACGRHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSVPCQFKEQP 392
           T PIP CD+ C K L CG+H CPFTCH G CMDPCIQI+ + C+C +  + VPCQFK +P
Sbjct: 364 TDPIPTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMDCACERRTFLVPCQFKGKP 423

Query: 393 RCDTKCESLMSXXXXXXXXXXXXXXPFAERRRKTPLSSRELMDESSVESEHICLKDCNLT 452
            C  KCESLMS              P+AERR+KT L S +  DE+ VE+EH+CLKDCNL 
Sbjct: 424 VCKFKCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRNDETLVEAEHVCLKDCNLK 483

Query: 453 LSCGCHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHYPCIRVIQN 512
           LSCG H CQRKCHPG CPPCLESDSNDLVCPCGKTV+ APVRCGT LPPC YPCI+VI+ 
Sbjct: 484 LSCGIHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVRCGTTLPPCKYPCIKVIRG 543

Query: 513 AYKCGHKPMPHTCHPLNEPCPSCTAPVFKPCKCGKKDKVRTLCFQNDVSCGTTCGKPLDN 572
              CGHKPMPH+CH L++PCP CTAPVFKPCKCGKKDKVRT+CFQ DVSCG  CG PL +
Sbjct: 544 ESDCGHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTMCFQEDVSCGLPCGLPLKD 603

Query: 573 CPHMCQKSCHIPGECQKKCKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLSVKIKCECE 632
           C H CQK CH+PGECQ  C QICN KR  C H C   CH N  CPDIPC + V + C+C 
Sbjct: 604 CYHKCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNAPCPDIPCTVPVTVVCDCG 663

Query: 633 VKESFITCGANSETPSKATTTILPCDEECERHKRHLQLREAFGISN-FSDNPSRSKTASL 691
            ++    C + S   S   T+ L CDEEC    R ++L+ AFGI N   D+ +      +
Sbjct: 664 RRKLVKPCSSTSTIDSVTITSHLECDEECMLLLRRMELKAAFGIVNGLGDDKTSVAIERI 723

Query: 692 ENLAAVANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEKTSLHFKPMRPAQ 751
           +N  +VA ++EELELPF E  L  +AKQ  WC+QIE +LN FMD + K+SLHFK M+  Q
Sbjct: 724 QNRISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKFMDEKLKSSLHFKHMKAPQ 783

Query: 752 RHFIHELAKSYNLYVESQDREPKRSVFVKKQDNGGSCKPVIQLKDSLPIYQFFKENEKEK 811
           R F+H LA +Y +Y ESQD EP RSVFVKK  NG S KP++ L+++LP+Y+ FKE +KEK
Sbjct: 784 RSFVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILTLEEALPLYESFKEVQKEK 843

Query: 812 KAQRFEAQTTTEFVNFIPKEEPQLERAKNNAFKLKNVSTGTTKEDLERIFADHLKPTLVK 871
           K Q +EA+T    +N   + + Q    K N F +KN+  GTT+EDLERIF + LKPTLVK
Sbjct: 844 KKQEYEARTHKTLINVEAETQTQQSATKYNGFLIKNLVKGTTEEDLERIFGESLKPTLVK 903

Query: 872 NPQFKIQDSTKNGLIYPEDYAEISVNVERDLEALVGHFDYLCKESFIGDGIELCHIDLKV 931
           +PQ+ + D + +G I P DYAEIS+NVERD+E L+G FD LCKE FIGD +ELC+ID  +
Sbjct: 904 DPQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLCKEHFIGDIVELCNIDEAL 963

Query: 932 LQES 935
           LQE+
Sbjct: 964 LQEN 967

>CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa]
           {ON} similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023c FAP1
          Length = 956

 Score = 1054 bits (2726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/906 (57%), Positives = 639/906 (70%), Gaps = 9/906 (0%)

Query: 34  DEHDMAYYERAVQEIALGDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREWALKSTE 93
           DE DMAYYE+AVQEI  GD Y C+ICTVE+DYTCK+YACE CYRV+DYECIREWA KST 
Sbjct: 55  DEKDMAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEKSTS 114

Query: 94  KTLDRVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPICPHGCSK 153
           K  D++W CPNC+   K +P KNRPTCWCG+ VNP+PNPL+PNSCGQTC+A IC HGCS+
Sbjct: 115 KRTDKLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQ 174

Query: 154 QCHLGPHPDCVRTITTKCQCGKHTRETFCYQT-ISMKGKSQFQCNEVCGLPLACGIHKCE 212
            CHLGPH +C R ++ KC CGK T++  C+Q  +  KG   F C  VC   L CGIHKC 
Sbjct: 175 ICHLGPHQECTRMMSIKCSCGKVTKDIVCFQRRLYSKG---FNCETVCDKLLPCGIHKCN 231

Query: 213 RLCHSGICGPCPAVLNAKSNKLKIRCYCGLEHRDSFKCKDVRVASD--LSKDGKGDSWIG 270
           R CH+G+CG CP  + +K+  +KIRCYCG   +D  KCKDVR  ++   SKD KG  WIG
Sbjct: 232 RKCHTGLCGSCPETIISKNTNMKIRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIG 291

Query: 271 AFGCSGIRKIEYACREHSFVEKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKVLAEPRK 330
            F C  IRK+ Y C EHSF EKC+  PSISG++ C FSPK LKTCPCG+  L  L++PR 
Sbjct: 292 VFMCDKIRKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKPRS 351

Query: 331 SCTSPIPNCDSTCGKKLACGRHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSVPCQFKE 390
            CT  IP C   CGK L CG+H CPF CH G CMDPC QIE VRC+C +  +++PC F +
Sbjct: 352 KCTDAIPTCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFND 411

Query: 391 QPRCDTKCESLMSXXXXXXXXXXXXXXPFAERRRKT-PLSSRELMDESSVESEHICLKDC 449
             RC+ KCESLMS              P AERRRKT  ++ R+L DES++E  HICLKDC
Sbjct: 412 HARCNLKCESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLKDC 471

Query: 450 NLTLSCGCHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHYPCIRV 509
           NLTLSCG HKC RKCH GKCPPCLESDSNDLVCPCGKT+VEAPVRCGT+LP C YPCIRV
Sbjct: 472 NLTLSCGIHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRV 531

Query: 510 IQNAYKCGHKPMPHTCHPLNEPCPSCTAPVFKPCKCGKKDKVRTLCFQNDVSCGTTCGKP 569
           ++    CGH PMPH CHP + PCP CTA VFKPCKCGK+ +VRT+CF  DVSCG  CG+ 
Sbjct: 532 VRGETDCGHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKDVSCGKVCGER 591

Query: 570 LDNCPHMCQKSCHIPGECQKKCKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLSVKIKC 629
           L  C H CQK CH PG CQ  CKQ CN  R+YC+H+C   CH  ++CPDIPC   VKI C
Sbjct: 592 LQTCYHKCQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKITC 651

Query: 630 ECEVKESFITCGANSETPSKATTTILPCDEECERHKRHLQLREAFGISNFSDNPSRSKTA 689
            C   E  +TCG  S+      +T + CDEEC   +RH+QL+EAFGI +   N    + A
Sbjct: 652 PCGRIEKEVTCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKEAFGIVDKPQNTHNEEMA 711

Query: 690 SLENLAAVANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEKTSLHFKPMRP 749
            LE + + A++F +L+LPF+EP + T+ + E WCT IEN LN  +D+  +TSLHFKPMRP
Sbjct: 712 RLEQVISTASTFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRP 771

Query: 750 AQRHFIHELAKSYNLYVESQDREPKRSVFVKKQDNGGSCKPVIQLKDSLPIYQFFKENEK 809
            QR+FI ELAK+YNLY ESQD EP RSVFVKK  +G S KP++ + ++ P+YQ +K+ EK
Sbjct: 772 PQRYFIRELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEK 831

Query: 810 EKKAQRFEAQTTTEFVNFIPKEEPQLER-AKNNAFKLKNVSTGTTKEDLERIFADHLKPT 868
           EKK   FE+ TTT  +NF P+  P+LE  A+ N F + NV   T+ +DL+ +FA +LK T
Sbjct: 832 EKKQANFESMTTTRLINFTPEMSPELESAARFNGFLVTNVGEFTSTDDLQNLFAPYLKST 891

Query: 869 LVKNPQFKIQDSTKNGLIYPEDYAEISVNVERDLEALVGHFDYLCKESFIGDGIELCHID 928
           LV  PQF+I    K  +IYP  Y EIS+NVERD+E LV HFD+L KES +  G+ELC+I+
Sbjct: 892 LVVEPQFQILPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGVELCNIE 951

Query: 929 LKVLQE 934
             VL E
Sbjct: 952 -NVLAE 956

>Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON}
           (135833..138739) [2907 nt, 969 aa]
          Length = 968

 Score = 1033 bits (2672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/902 (54%), Positives = 633/902 (70%), Gaps = 11/902 (1%)

Query: 37  DMAYYERAVQEIALGDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREWALKSTEKTL 96
           D+ +YERA+++IA GD Y CMICT+E+D T KMYAC  CYRVFDY+CIREWA+KS++K+L
Sbjct: 65  DLMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQKSL 124

Query: 97  DRVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPICPHGCSKQCH 156
           D+VWKCPNC   + ++P +NRPTCWCGKTVNPDPNP  PNSCGQTC+A  C H CS  CH
Sbjct: 125 DKVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHFCH 184

Query: 157 LGPHPDCVRTITTKCQCGKHTRETFCYQTISMKGKSQ-FQCNEVCGLPLACGIHKCERLC 215
           LGPHP C RT T  C+CGKHT++ FCY     K +++ F C E C + L+CGIHKC R+C
Sbjct: 185 LGPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSRVC 244

Query: 216 HSGICGPCPAVLNAKSNKLKIRCYCGLEHRDSFKCKDVRV--ASDLSKDGKGDSWIGAFG 273
           HSG CGPCP ++  K N     CYCG    D  +C +V++  +   SKD +G++WIG F 
Sbjct: 245 HSGSCGPCPELITKKVN-----CYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGVFK 299

Query: 274 CSGIRKIEYACREHSFVEKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKVLAEPRKSCT 333
           C+ IR +EYAC+ HSF E C   P+ISG   CP+SPKLLKTCPCG+T+L      R+ CT
Sbjct: 300 CNKIRTVEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQKCT 359

Query: 334 SPIPNCDSTCGKKLACGRHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSVPCQFKEQPR 393
            PI  C++ C K L CG+H CPFTCH+GPCMDPC QIE  +CSC+   +SVPCQF E+PR
Sbjct: 360 DPISTCENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHEKPR 419

Query: 394 CDTKCESLMSXXXXXXXXXXXXXXPFAERRRKTPLSSRELMDESSVESEHICLKDCNLTL 453
           C+ KCESLMS              P A++R+K   S  +L+DES VE+EHICLKDCNL L
Sbjct: 420 CNMKCESLMSCRRHRCTRRCCSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCNLKL 479

Query: 454 SCGCHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHYPCIRVIQNA 513
           SCG H C RKCH GKCPPCLESDS+DLVCPCGKTVVEAPVRCGT+LP C +PCI+ I+ +
Sbjct: 480 SCGIHNCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYIEGS 539

Query: 514 YKCGHKPMPHTCHPLNEPCPSCTAPVFKPCKCGKKDKVRTLCFQNDVSCGTTCGKPLDNC 573
           Y CGHKP  H CHP + PCP CT  VFKPCKCGK+ K + LCFQ   SCG  C K LD C
Sbjct: 540 YPCGHKPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKLDGC 599

Query: 574 PHMCQKSCHIPGECQKKCKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLSVKIKCECEV 633
            H CQ  CH+PGECQKKC QICN++R+ C H C   CHG+  CPDIPC +  ++ C C  
Sbjct: 600 HHYCQLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGCGR 659

Query: 634 KESFITCGANSETPSKATTTILPCDEECERHKRHLQLREAFGISNFSDNPSRSKTASLEN 693
           ++  + CGA S T S   T +LPCD+ C +++R  +LR AFG+ + S++P  S+   L+ 
Sbjct: 660 RKELLLCGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDP-ESELERLKK 718

Query: 694 LAAVANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEKTSLHFKPMRPAQRH 753
           +     S+EELELPFSE  L  ++KQ  WC QIE ++N F++++ K SLHFKPM   QR+
Sbjct: 719 IVEKVTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAPQRN 778

Query: 754 FIHELAKSYNLYVESQDREPKRSVFVKKQDNGGSCKPVIQLKDSLPIYQFFKENEKEKKA 813
           FIH L ++Y +Y ESQDREPKRSV++KK  N  +  P I L+++LP+YQ +K+ EKE+K 
Sbjct: 779 FIHALVEAYEMYSESQDREPKRSVYLKK--NKYTRIPNISLEEALPLYQSYKKIEKERKV 836

Query: 814 QRFEAQTTTEFVNFIPKEEPQLERAKNNAFKLKNVSTGTTKEDLERIFADHLKPTLVKNP 873
           Q FE++    ++N+ P E       K N F +K ++ GTT +DL  +F  HLKPTL+K+ 
Sbjct: 837 QSFESKKNVTYLNYQPPERSLTPDVKYNGFLIKGITFGTTTDDLNTLFGVHLKPTLIKDA 896

Query: 874 QFKIQDSTKNGLIYPEDYAEISVNVERDLEALVGHFDYLCKESFIGDGIELCHIDLKVLQ 933
           Q+ I    K+ ++YP+DY  IS NVERD+E+L GHFDY+ KE+ +G+ +E+C+I   +  
Sbjct: 897 QYSILPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNITDILQT 956

Query: 934 ES 935
           ES
Sbjct: 957 ES 958

>KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 963

 Score = 1011 bits (2615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/902 (54%), Positives = 625/902 (69%), Gaps = 13/902 (1%)

Query: 34  DEHDMAYYERAVQEIALGDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREWALKSTE 93
           D +D  YYE+ ++EIA GDRY CMICTVEMD+TC MYAC  CYRVFDYECIREWA+KST+
Sbjct: 57  DTYDQPYYEKTIKEIAKGDRYPCMICTVEMDFTCHMYACPECYRVFDYECIREWAVKSTQ 116

Query: 94  KTLDRVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPICPHGCSK 153
           K++ + WKCPNCY   K VP KNRPTCWCGK ++P+PNPL+PNSCGQTCDAPIC HGCS 
Sbjct: 117 KSVTKTWKCPNCYFEKKDVPLKNRPTCWCGKNIHPEPNPLNPNSCGQTCDAPICVHGCSS 176

Query: 154 QCHLGPHPDCVRTITTKCQCGKHTRETFCYQTISMKGKSQFQCNEVCGLPLACGIHKCER 213
            CHLGPHP C+R + TKC+CGK +++ FC +  + K +  F+C   CGL L CG+HKC+R
Sbjct: 177 TCHLGPHPTCMRMVQTKCRCGKKSKDVFCSE--ARKHQELFRCGNPCGLTLPCGVHKCQR 234

Query: 214 LCHSGICGPCPAVLNAKSNKLKIRCYCGLEHRDSFKCKDVRVASDLSKDGKGDSWIGAFG 273
            CH+G+CG CP  +  +     I CYCGLE   S KC+DV++ S  S+DG G  WIGAF 
Sbjct: 235 ECHNGVCGECPETIAKE-----INCYCGLESLPSIKCQDVKIQSK-SQDGSGKKWIGAFA 288

Query: 274 CSGIRKIEYACREHSFVEKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKVLAEPRKSCT 333
           CS IR +EY+CREHSF E C+  PSI+G+I CP+SPK LKTCPCG T L+ +  PR  CT
Sbjct: 289 CSRIRTVEYSCREHSFAEPCKAPPSIAGRIPCPYSPKALKTCPCGETPLENMETPRTKCT 348

Query: 334 SPIPNCDSTCGKKLACGRHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSVPCQFKEQPR 393
            PIP CD+TCGK L+CGRH CPF CH G CM+ C   + ++CSC+   + VPC+F+  PR
Sbjct: 349 DPIPTCDATCGKLLSCGRHRCPFKCHTGTCMEICTCSDKIKCSCNSRPFIVPCKFQGPPR 408

Query: 394 CDTKCESLMSXXXXXXXXXXXXXXPFAERRRKTPLSSRELMDESSVESEHICLKDCNLTL 453
           C+TKCESLMS                A+ R K    +R+ +DES VE++HICLK CNL L
Sbjct: 409 CNTKCESLMSCRRHRCAERCCDGRSLAQVREKKVFLTRDKLDESLVEAQHICLKKCNLKL 468

Query: 454 SCGCHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHYPCIRVIQNA 513
           SCG H CQRKCHPG CPPCLESDSNDLVCPCGKTV  APVRCGT LPPC  PCI+ +Q  
Sbjct: 469 SCGRHFCQRKCHPGNCPPCLESDSNDLVCPCGKTVAPAPVRCGTVLPPCRNPCIKTLQGP 528

Query: 514 YKCGHKPMPHTCHPLNEPCPSCTAPVFKPCKCGKKDKVRTLCFQNDVSCGTTCGKPLDNC 573
             CGH PMPH CH L+EPCPSCTAPVFK CKCGK  KVRTLCFQN+VSCG  CGK L +C
Sbjct: 529 LDCGHPPMPHACHSLDEPCPSCTAPVFKQCKCGKNKKVRTLCFQNNVSCGRVCGKQLVSC 588

Query: 574 PHMCQKSCHIPGECQKKCKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLSVKIKCECEV 633
            H C K+CH  GECQ  CKQ+C   R  C H CR  CH    CPD+PC ++V++KC C  
Sbjct: 589 HHSCTKTCHREGECQSICKQVCGISRSNCSHICRFKCHTGSPCPDVPCNVTVEVKCGCGH 648

Query: 634 KESFITCGANSETPSKATTTILPCDEECERHKRHLQLREAFGISNFSDNPSRSKTASLEN 693
           + SF TC A+ E    A    L C E+C   +R L+L EAFG++  +  P+      L  
Sbjct: 649 RSSFATCAAH-EGQDPADQRPLECTEDCAAARRRLELMEAFGMNTETVQPTEG-IVDLAA 706

Query: 694 LAAVANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEKTSLHFKPMRPAQRH 753
           LA    +F+EL LPF+E +L  FAKQ  WC+QIE  LN  M +  K SLHFKPM+P QRH
Sbjct: 707 LAEKVTTFQELMLPFTEASLSIFAKQSNWCSQIEEHLNRLMSDISKPSLHFKPMKPPQRH 766

Query: 754 FIHELAKSYNLYVESQDREPKRSVFVKKQDNGGSCKPVIQLKDSLPIYQFFKENEKEKKA 813
           FIHELA++Y LY ESQD+EPKRSV+VKK  +  S KP + LK++LP+YQ FK  +KE+K 
Sbjct: 767 FIHELAQAYKLYCESQDKEPKRSVYVKKTVD--SRKPSLSLKEALPLYQSFKNAQKERKL 824

Query: 814 QRFEAQTTTEFVNFIPKEEPQLERAKNNAFKLKNVSTGTTKEDLERIFADHLKPTLVKNP 873
           +  E  TTT  +N+    E     A+ N   ++ V  GT ++ +E  FAD+LK TL+K+P
Sbjct: 825 KELERSTTTRILNYTSTGESSPPVAQINGLLIQKVFEGTDEKTIEACFADYLKHTLIKDP 884

Query: 874 QFKIQDSTKNGLIYPEDYAEISVNVERDLEALVGHFDYLCKESFIGDGIELCHIDLKVLQ 933
            +   DS  + +++ E+YA  S+NVERD+  +VGH D + K+SF+ +G+ +C ++  + +
Sbjct: 885 NYLKLDS-GDVMVFAENYATASINVERDINRVVGHLDLIAKDSFLAEGVTVCRVEQVMAE 943

Query: 934 ES 935
           E+
Sbjct: 944 ET 945

>TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {ON}
           Anc_2.288 YNL023C
          Length = 962

 Score = 1004 bits (2597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/911 (52%), Positives = 631/911 (69%), Gaps = 12/911 (1%)

Query: 34  DEHD-MAYYERAVQEIALGDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREWALKST 92
           DE D + YYE+ +++I+ GDRY CMICT+EMDYTCKMYAC+ CYRVFDYECI+EWA KS 
Sbjct: 40  DEDDGLVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSA 99

Query: 93  EKTLDRVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPICPHGCS 152
            KT+D+VWKCPNC   +K++P +NRPTCWCGK +NPDPN L PNSCGQTC+   C HGC 
Sbjct: 100 SKTIDKVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCK 159

Query: 153 KQCHLGPHPDCVRTITTKCQCGKHTRETFCYQTISMKGKSQFQCNEVCGLPLACGIHKCE 212
             CHLGPH +C    T KC+CG++ ++ FC+Q       + +QCNEVC LPLACG+HKC+
Sbjct: 160 NFCHLGPHGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKCK 219

Query: 213 RLCHSGICGPCPAVLNAK-------SNKLKIRCYCGLEHRDSFKCKDVRVASDLSKDGKG 265
           R+CHSG+CG CP +L+++       +   K +CYCG   ++   CK + +    SK+ +G
Sbjct: 220 RVCHSGLCGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCKKLAITGTFSKNSEG 279

Query: 266 DSWIGAFGCSGIRKIEYACREHSFVEKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKVL 325
           D WIG F C   R + YAC EHSF+E CQ   SISGK  CP++PKLL +CPCG+TSLK L
Sbjct: 280 DKWIGTFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQL 339

Query: 326 AEPRKSCTSPIPNCDSTCGKKLACGRHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSVP 385
           A+ RK CT PIP C++ CGK L CG+HTCP+ CH+G CMDPCIQ+E   CSC +  + VP
Sbjct: 340 AQKRKKCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVP 399

Query: 386 CQFKEQPRCDTKCESLMSXXXXXXXXXXXXXXPFAERRRKTPLSSRELMDESSVESEHIC 445
           C F++ P+C  KCESLMS              P A++R+K  L+  EL DES VE+ HIC
Sbjct: 400 CNFEQTPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKKMLLTREELNDESLVEAVHIC 459

Query: 446 LKDCNLTLSCGCHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHYP 505
           LK+CNL LSCG H C RKCHPG+CP CL SDSNDLVCPCGKTV+EAPVRCG++LPPC + 
Sbjct: 460 LKECNLKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFE 519

Query: 506 CIRVIQNAYKCGHKPMPHTCHPLNEPCPSCTAPVFKPCKCGKKDKVRTLCFQNDVSCGTT 565
           CI+VI+ +Y CGHKP PH CHP  EPCP CTA V +PCKCGK   V+ +CFQ   SCG  
Sbjct: 520 CIKVIERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGEI 579

Query: 566 CGKPLDNCPHMCQKSCHIPGECQKKCKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLSV 625
           C K L+NC H CQ  CH  G+CQK CKQ+CN+ R  C+H+C+  CHG+  CPD+PC    
Sbjct: 580 CNKELENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVT 639

Query: 626 KIKCECEVKESFITCGANSETPSKATTTILPCDEECERHKRHLQLREAFGISNFSDNPSR 685
           K+ C+C  K+ +  C A  +  S A+  +LPCDE+CE H RHLQLR+AFG  +  D  S 
Sbjct: 640 KVSCKCGRKQEYRKCYATLDN-SSASIELLPCDEDCEAHARHLQLRDAFGYDSSLDT-SN 697

Query: 686 SKTASLENLAAVANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEKTSLHFK 745
                +++L    +++EEL LP+ +  + T++KQ  WC+QIE++L  F+ ++ K +LHFK
Sbjct: 698 KNIQDIQSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFK 757

Query: 746 PMRPAQRHFIHELAKSYNLYVESQDREPKRSVFVKKQDNGGSCKPVIQLKDSLPIYQFFK 805
           PM+PAQRHF+ EL+ S+NLY ESQD EPKRSVFVK++ +     P I L++ LP++  FK
Sbjct: 758 PMKPAQRHFVRELSTSFNLYSESQDPEPKRSVFVKRKVDTRI--PNISLEEVLPLWTGFK 815

Query: 806 ENEKEKKAQRFEAQTTTEFVNFIPKEEPQLERAKNNAFKLKNVSTGTTKEDLERIFADHL 865
           + EKE+K Q FE+ +  +++N+ PKE         N F +K +S G T+EDL  +F   L
Sbjct: 816 KLEKERKIQHFESTSQRKYINYEPKEVIVKSSNDTNGFFIKKISPGITEEDLSEVFGKAL 875

Query: 866 KPTLVKNPQFKIQDSTKNGLIYPEDYAEISVNVERDLEALVGHFDYLCKESFIGDGIELC 925
           K TL+KN  +KI   + + +IYPE Y  I+ +V +DLE LVGHFD++ KE+ I D I LC
Sbjct: 876 KSTLIKNVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIGKEALIFDSIMLC 935

Query: 926 HIDLKVLQESE 936
           +++  + Q S+
Sbjct: 936 NVEGYINQISD 946

>SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 974

 Score =  997 bits (2578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/902 (54%), Positives = 617/902 (68%), Gaps = 17/902 (1%)

Query: 38  MAYYERAVQEIALGDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREWALKSTEKTLD 97
           + YYE+ + EI  GD Y CMICT+EMDYTC MYAC  CYRV+D+ECIREWALKS++K+LD
Sbjct: 48  LPYYEKTIHEIQKGDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLD 107

Query: 98  RVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPICPHGCSKQCHL 157
           + WKCPNCY VN  +P KNR TCWCGK V+P+ NP+DPNSCGQTC+APIC HGCSK CHL
Sbjct: 108 KTWKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHL 167

Query: 158 GPHPDCVRTITTKCQCGKHTRETFCYQTISMKGKSQFQCNEVCGLPLACGIHKCERLCHS 217
           GPHP+C+RT   KC CGKHT++ FCYQ  S + K+ +QC E C L L CG+HKC+R CHS
Sbjct: 168 GPHPECMRTTKVKCLCGKHTKDMFCYQ--SEEEKASYQCGEPCNLLLPCGVHKCQRKCHS 225

Query: 218 GICGPCPAVLNAKSNKLKIRCYCGLEHRDSFKCKDVRVASDLSKDGKGDSWIGAFGCSGI 277
           G CG C   ++ K     I CYCG+E R+   CKDV+  +  SK+  G+ WIG F C+ +
Sbjct: 226 GPCGNCEETISGK-----IMCYCGMETREQIICKDVKSVAK-SKNKSGEIWIGVFSCAHL 279

Query: 278 RKIEYACREHSFVEKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKVLAEPRKSCTSPIP 337
           R +EY+C  HSF E C   P+ SG++ACPFSP+LLKTCPCG T LK+L  PRK CT PIP
Sbjct: 280 RSVEYSCGHHSFQESCTAPPTNSGELACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPIP 339

Query: 338 NCDSTCGKKLACGRHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSVPCQFKEQPRCDTK 397
            C++ C K L CG+H+CPF CHDGPCMDPC+ ++ V CSCH   + VPCQF ++  C+TK
Sbjct: 340 TCENRCNKPLKCGKHSCPFVCHDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNTK 399

Query: 398 CESLMSXXXXXXXXXXXXXXPFAERRRKTPLSSRELMDESSVESEHICLKDCNLTLSCGC 457
           CESLMS                A +R KT   +R+ +DES VE++HICLK CNL LSCG 
Sbjct: 400 CESLMSCRRHRCTERCCSGRSLAIKREKTIFLARDRLDESLVEAQHICLKPCNLKLSCGI 459

Query: 458 HKCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHYPCIRVIQNAYKCG 517
           H C+RKCHPGKC PCLESDSNDL CPCGKTVV APVRCGT+LPPC +PCI+ +Q    CG
Sbjct: 460 HYCRRKCHPGKCSPCLESDSNDLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVCG 519

Query: 518 HKPMPHTCHPLNEPCPSCTAPVFKPCKCGKKDKVRTLCFQNDVSCGTTCGKPLDNCPHMC 577
           H PMPH CH L +PCP CTAP++K CKC K +KVRTLCFQNDVSCG  CG PL NC H C
Sbjct: 520 HPPMPHECHSLEQPCPQCTAPIYKKCKCNKVEKVRTLCFQNDVSCGKICGLPLKNCSHTC 579

Query: 578 QKSCHIPGECQKKCKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLSVKIKCECEVKESF 637
           +++CH PG+CQ  CKQIC   R +C+HKC   CH    CPD  C + VK+ C C  KES 
Sbjct: 580 KRTCHEPGQCQTICKQICGLPRKFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKESI 639

Query: 638 ITCGANSETPSKATTTILPCDEECERHKRHLQLREAFGISNFSDNPSRSKTASLENLAAV 697
           + C A+++ PS      LPCD++CE  KRH  L EAFGI      P       L +L   
Sbjct: 640 LPCDAHADQPSSKLLITLPCDDKCEESKRHRMLMEAFGIKEKLTAP----VEELRDLVES 695

Query: 698 ANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEKTSLHFKPMRPAQRHFIHE 757
           A SF+EL LPF+E  L  ++KQ AWC QIE+ L+  M +  +TSLHFKPM+  QR FIHE
Sbjct: 696 AKSFDELHLPFTESTLSVYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQRRFIHE 755

Query: 758 LAKSYNLYVESQDREPKRSVFVKKQDNGGSCKPVIQLKDSLPIYQFFKENEKEKKAQRFE 817
           LA +Y LY ESQDREPKRSVFVKK +N     P++ L ++LP+Y  FK+ +KE+K +  E
Sbjct: 756 LANAYALYSESQDREPKRSVFVKKVENKSHI-PLLCLGEALPLYHSFKQLQKERKVKELE 814

Query: 818 AQTTTEFVNFIPKEEPQL-ERAKNNAFKLKNVSTGTTKEDLERIFADHLKPTLVKNPQFK 876
             TT    N+   +   +   A+ N F +K V+ G TK++L    A++L+ TL++NP ++
Sbjct: 815 KSTTRRLFNYTVDDANDVPHNAEFNCFLVKGVAPGVTKDELSDCLAEYLQFTLIQNPSYQ 874

Query: 877 IQDSTKNGLIYPEDYAEISVNVERDLEALVGHFDYLCKESFIGDGIELCHID--LKVLQE 934
             ++  + LIYPED+  IS NVE D++ L  +   +CKE  I +G++L  ID  LK    
Sbjct: 875 TLENG-DFLIYPEDHMSISENVENDIKRLAPYISSICKEKQISEGVKLYKIDENLKTFTS 933

Query: 935 SE 936
            E
Sbjct: 934 EE 935

>Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {ON}
           YNL023C (FAP1) - Transcription factor homolog;
           similarity to Drosophila melanogaster shuttle craft
           protein; similarity to human NFX1 protein; similarity to
           human DNA-binding protein tenascin [contig 27] FULL
          Length = 953

 Score =  969 bits (2505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/893 (54%), Positives = 615/893 (68%), Gaps = 14/893 (1%)

Query: 31  EVRDEHDMAYYERAVQEIALGDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREWALK 90
           E+ +  D  YYE+ V+EI  GDRY CMICTVEMD+TC MYAC  CYRVFD+ECIREWALK
Sbjct: 36  EIDELEDQPYYEKTVKEIEKGDRYPCMICTVEMDFTCHMYACPDCYRVFDFECIREWALK 95

Query: 91  STEKTLDRVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPICPHG 150
           ST+K++ + WKCPNCY   K VP KNRPTCWCGK+V P+PNPL+PNSCGQTCDA IC HG
Sbjct: 96  STQKSVSKTWKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEHG 155

Query: 151 CSKQCHLGPHPDCVRTITTKCQCGKHTRETFCYQTISMKGKSQFQCNEVCGLPLACGIHK 210
           CS  CHLGPHP C+R +  KC CGK  +  FC++  + K    F C+  CGL L CGIHK
Sbjct: 156 CSSICHLGPHPTCMRMVQVKCNCGKKNKSVFCHE--AGKFVDSFICDSPCGLTLPCGIHK 213

Query: 211 CERLCHSGICGPCPAVLNAKSNKLKIRCYCGLEHRDSFKCKDVRVASDLSKDGKGDSWIG 270
           C+R CHSGICG CP  +        I CYC LE + S KC +VR+    S+D  G+ W+G
Sbjct: 214 CQRKCHSGICGECPESIYGT-----INCYCKLESKPSLKCTEVRIEGR-SRDSSGNKWVG 267

Query: 271 AFGCSGIRKIEYACREHSFVEKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKVLAEPRK 330
           AF C  IR +E++C++HSF E C+  PSISG++ CPFSP+ LKTCPCGR+ L+ +   R 
Sbjct: 268 AFSCENIRTVEHSCKKHSFAEPCKAPPSISGQVPCPFSPRTLKTCPCGRSPLREMDVSRS 327

Query: 331 SCTSPIPNCDSTCGKKLACGRHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSVPCQFKE 390
            CT PIP CDS CGK L CG+H CPF CH G CM+ C+  + V+CSCH   + VPC+F+E
Sbjct: 328 QCTDPIPTCDSVCGKMLRCGKHKCPFKCHTGSCMEECLCTDKVKCSCHARQFIVPCKFQE 387

Query: 391 QPRCDTKCESLMSXXXXXXXXXXXXXXPFAERRRKTPLSSRELMDESSVESEHICLKDCN 450
           + RC+TKCE+LMS                A+ R K    +R+ +DES VE++HICLK CN
Sbjct: 388 KARCNTKCEALMSCRRHRCIERCCDGRSLAQSREKKVFLTRDKLDESLVEAQHICLKQCN 447

Query: 451 LTLSCGCHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHYPCIRVI 510
           L LSCG H C+RKCHPG C PCLESDSNDLVCPCGKTVV APVRCGT LP C +PCI+ +
Sbjct: 448 LKLSCGKHFCKRKCHPGNCAPCLESDSNDLVCPCGKTVVPAPVRCGTVLPRCLHPCIKTL 507

Query: 511 QNAYKCGHKPMPHTCHPLNEPCPSCTAPVFKPCKCGKKDKVRTLCFQNDVSCGTTCGKPL 570
           Q    CGH PMPH CHPL EPCPSCTAPVFK CKC K DKVRTLCFQNDVSCG  CGK L
Sbjct: 508 QGPAPCGHPPMPHPCHPLEEPCPSCTAPVFKSCKCRKNDKVRTLCFQNDVSCGRVCGKQL 567

Query: 571 DNCPHMCQKSCHIPGECQKKCKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLSVKIKCE 630
             C H+CQK+CH  GECQ  CKQ C + R  C+H+CR +CH    CPD PC   V IKC 
Sbjct: 568 AGCQHICQKACHKEGECQTSCKQPCGKTRENCEHRCRALCHSGTPCPDKPCLNLVDIKCN 627

Query: 631 CEVKESFITCGANSETPSKATTTILPCDEECERHKRHLQLREAFGISNFSDNPSRSKTAS 690
           C  + + +TCGAN E  + A  T L C+ +C+  +RH +L EAFGI N ++  S+S    
Sbjct: 628 CGHRSTTVTCGAN-ENRAPAEETALECNNDCDVARRHHELMEAFGIKNDANQGSKS-LED 685

Query: 691 LENLAAVANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEKTSLHFKPMRPA 750
           LE LA   ++F+EL LPFSE  L  F+KQ  WCTQIE  L   M+++ K SLHFKPMRP 
Sbjct: 686 LEALAEKVSTFQELLLPFSEATLSIFSKQTTWCTQIEECLERLMNDKNKPSLHFKPMRPP 745

Query: 751 QRHFIHELAKSYNLYVESQDREPKRSVFVKKQDNGGSCKPVIQLKDSLPIYQFFKENEKE 810
           QRHFIHEL ++Y+LY ESQD+EPKRSVFVKK     S +P I LK +LP+Y  FK  ++E
Sbjct: 746 QRHFIHELGQAYHLYCESQDQEPKRSVFVKK--TADSQRPSISLKVALPLYYSFKSAQRE 803

Query: 811 KKAQRFEAQTTTEFVNFIPKEEPQL-ERAKNNAFKLKNVSTGTTKEDLERIFADHLKPTL 869
           KK +  E  TTT  +N+   ++ Q    A+ N   ++NV  G  ++ ++  F+++LK TL
Sbjct: 804 KKLKETERHTTTRIINYAVTDQAQTPPAARFNGLLVQNVLNGINEKAIQESFSEYLKHTL 863

Query: 870 VKNPQFKIQDSTKNGLIYPEDYAEISVNVERDLEALVGHFDYLCKESFIGDGI 922
           +K+P + +  ++ + L+Y +DY+  SVNVE D+E +VGH D++ KE  + +G+
Sbjct: 864 LKDPHYLLL-ASGDVLVYCDDYSTASVNVENDIERIVGHLDHIVKEQLLAEGV 915

>KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 921

 Score =  887 bits (2293), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/895 (48%), Positives = 577/895 (64%), Gaps = 16/895 (1%)

Query: 37  DMAYYERAVQEIALGDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREWALKSTEKTL 96
           ++ YYE+ V+EI  GD+YVCMICTVE+D TC+MYAC+ CYRVFDYEC+REWALKST KTL
Sbjct: 31  NIPYYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTL 90

Query: 97  DRVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPICPHGCSKQCH 156
           D+ WKCPNCYK+N ++P + R TCWCGK VNPD N LDPNSCGQTC+A  C HGCSK CH
Sbjct: 91  DKSWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCH 150

Query: 157 LGPHPDCVRTITTKCQCGKHTRETFCYQTISMKGKSQFQCNEVCGLPLACGIHKCERLCH 216
           LGPHP+C+  +  KC+CGKH ++  C ++  +   + + C +VCGL L CG H C++ CH
Sbjct: 151 LGPHPECLIPVQIKCKCGKHCKQIPCSRSKVLG--NSYNCGDVCGLLLPCGKHTCQKTCH 208

Query: 217 SGICGPCPAVLNAKSNKLKIRCYCGLEHRDSFKCKDVRVASDLSKDGKGDSWIGAFGCSG 276
           +G CGPC +++     K ++ CYCG + +   +C D+RV  D SKD  G  WIG + C  
Sbjct: 209 TGFCGPCESII-----KTELPCYCGSDVKSGIQCSDLRVL-DYSKDVSGKKWIGVYSCGE 262

Query: 277 IRKIEYACREHSFVEKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKVLAEPRKSCTSPI 336
           +R + Y+C  H++VE+C     I     CPFSPK LKTCPCG+T LK L +PR+ CT  I
Sbjct: 263 VRTLHYSCDHHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDTI 322

Query: 337 PNCDSTCGKKLACGRHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSVPCQFKEQPRCDT 396
           P C + CGK+L+CG+HTCPF+CH G CMDPC+ I    C+CH   +  PCQ  + PRC+ 
Sbjct: 323 PTCSNVCGKQLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCNI 382

Query: 397 KCESLMSXXXXXXXXXXXXXXPFAERRRKTPLSSRELMDESSVESEHICLKDCNLTLSCG 456
           KCES MS              P A++R KT    R+L +E+ VE EH+CLK CNL LSCG
Sbjct: 383 KCESNMSCRRHKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKLSCG 442

Query: 457 CHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHYPCIRVIQNAYKC 516
            H C  KCHPGKCPPCLESD NDLVCPCGKTVV APVRCGT+LPPC  PCI++ +    C
Sbjct: 443 IHDCTWKCHPGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAPC 502

Query: 517 GHKPMPHTCHPLNEPCPSCTAPVFKPCKCGKKDKVRTLCFQND--VSCGTTCGKPLDNCP 574
           GH+  PH CHP    CP CTA V K C+C KK  +RTLC   D  V+CGT CG PL  C 
Sbjct: 503 GHRVGPHKCHPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLATCH 562

Query: 575 HMCQKSCHIPGECQKKCKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLSVKIKCECEVK 634
           H CQK CH+ GEC+ KC + C  KR  C H C+  CHGN  CP+  C   V I C+C  +
Sbjct: 563 HKCQKKCHVEGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNRR 622

Query: 635 ESFITCGANSETPSKATTTILPCDEECERHKRHLQLREAFGISNFSDNPSRSKTASLENL 694
              + CGA  +T S++ T  LPCDEEC + +RH++L EAFG+   ++ P  +K   LE++
Sbjct: 623 TKQVECGATHDTQSRSETEKLPCDEECAKLQRHMELMEAFGM---NEKPKNTK-EQLESI 678

Query: 695 AAVANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEKTSLHFKPMRPAQRHF 754
             VA  F++L +P+SE  L  + KQ  WC QI  V + F+++ +K SLH KPMR  QR F
Sbjct: 679 VLVAKKFDDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQF 738

Query: 755 IHELAKSYNLYVESQDREPKRSVFVKKQDNGGSCKPVIQLKDSLPIYQFFKENEKEKKAQ 814
           I ELA +Y LY ESQDREP RSV++KK  +    KP + LKD+  +YQ FK  EKE+  +
Sbjct: 739 IKELASAYALYSESQDREPNRSVYLKKIQSQSK-KPELTLKDASELYQLFKTLEKERMQE 797

Query: 815 RFEAQTTTEFVNFIPKEEPQLERAKN-NAFKLKNVSTGTTKEDLERIFADHLKPTLVKNP 873
            +  + T   +N    E P     +  NA  +  V   +  +++E +  D LK TLVK P
Sbjct: 798 HYSTKVTKTLINIPASETPLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVKTP 857

Query: 874 QFKIQDSTKNGLIYPEDYAEISVNVERDLEALVGHFDYLCKESFIGDGIELCHID 928
           Q++      + LI+PE+Y+ I+ N   D+E ++       ++  +  G+E+C +D
Sbjct: 858 QYRFLKDLNSVLIFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVD 912

>Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii ADL213W
          Length = 926

 Score =  848 bits (2192), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/892 (47%), Positives = 565/892 (63%), Gaps = 20/892 (2%)

Query: 34  DEHDMAYYERAVQEIALGDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREWALKSTE 93
           D+  + YYE+A+++I  G  Y C+ICTVE+D TC+MYAC  CYRV+DYECI EWA KS++
Sbjct: 24  DDDGLPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAKKSSK 83

Query: 94  KTLDRVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPICPHGCSK 153
           ++ D  WKCPNCY    +V  K R TCWCGK +NP+ N   PNSCGQTC A IC HGC+ 
Sbjct: 84  RSADSTWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKHGCAS 143

Query: 154 QCHLGPHPDCVRTITTKCQCGKHTRETFCYQTISMKGKSQFQCNEVCGLPLACGIHKCER 213
            CHLGPHP C+  +  KC+CGK T +  CYQT ++K K    C   CGLPL CG+H C++
Sbjct: 144 TCHLGPHPKCMVPVGLKCKCGKITEQISCYQTKAVKPK--LSCKLPCGLPLPCGVHTCQK 201

Query: 214 LCHSGICGPCPAVLNAKSNKLKIRCYCGLEHRDSFKCKDVRVASDLSKDGKGDSWIGAFG 273
           +CHSG CG C  V++ K      +CYCG  H DS  CKDV V + +S+ GK   WIG F 
Sbjct: 202 ICHSGPCGRCNTVMSGK-----FKCYCGSNHLDSIICKDVAV-TKMSRSGKHKKWIGVFS 255

Query: 274 CSGIRKIEYACREHSFVEKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKVLAEPRKSCT 333
           C  IR++ Y C+EHSF E C+PSPS   +I CP+SP + KTC CG T+L  + + R+ CT
Sbjct: 256 CKNIREVRYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQQKREKCT 315

Query: 334 SPIPNCDSTCGKKLACGRHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSVPCQFKEQPR 393
            PIP CD  CGK L+CG+HTCP TCH G CMDPC+QIE  +CSC +  +  PCQF  +P 
Sbjct: 316 DPIPTCDQRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPCQFDGKPS 375

Query: 394 CDTKCESLMSXXXXXXXXXXXXXXPFAERRRKTPLSSRELMDESSVESEHICLKDCNLTL 453
           C+ KCE+LMS              P A  R  T     +  DES +E+EHIC K+CN  L
Sbjct: 376 CNIKCENLMSCRRHRCIKRCCSGKPLALARSSTITPWLDKNDESLIEAEHICFKNCNRKL 435

Query: 454 SCGCHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHYPCIRVIQNA 513
           SCG H C  KCHPGKCPPCLESDSNDLVCPCGK+V+ APVRCGT  P C+YPCI  ++ +
Sbjct: 436 SCGLHHCTNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPCINTLRGS 495

Query: 514 YKCGHKPMPHTCHPLNEPCPSCTAPVFKPCKCGKKDKVRTLCFQNDVSCGTTCGKPLDNC 573
             CGH+   H CHP  E CP CTA V+KPCKCGK    RT+CFQND+SCG  C   L NC
Sbjct: 496 MPCGHRAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDISCGRKCAAKLTNC 555

Query: 574 PHMCQKSCHIPGECQKKCKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLSVKIKCECEV 633
            H+CQK CH PGEC   C ++C  KR  C+H C   CHG++ CPD+PC   V + C C  
Sbjct: 556 HHLCQKQCHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVVVSCGCGR 615

Query: 634 KESFITCGANSETPSKATTTILPCDEECERHKRHLQLREAFGISNFSDNPSRSKTASLEN 693
           +   + CGA  +  S   T  L CD++C + ++H  L +    S+ S N +   ++S+ N
Sbjct: 616 RSLKVPCGAYKDKESATATQSLLCDDDCAKVQKHQMLLQTLR-SSESTNKAEHGSSSVIN 674

Query: 694 LAAVANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEKTSLHFKPMRPAQRH 753
                 S+E+L LP+SE  +  F+KQ  WC  I++ L   ++++ + SLHFKPM+  QR 
Sbjct: 675 ---KPTSYEDLGLPYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKAPQRQ 731

Query: 754 FIHELAKSYNLYVESQDREPKRSVFVKKQDNGGSCKPVIQLKDSLPIYQFFKENEKEKKA 813
           F+HEL+K++ LY ESQDREPKRSVFVK         P I L ++L +YQ  K  +KE++ 
Sbjct: 732 FVHELSKAFGLYSESQDREPKRSVFVKILKTSKI--PAIGLSEALLLYQRMKTFQKERRD 789

Query: 814 QRFEAQTTTEFVNFIPKEEPQLER---AKNNAFKLKNVSTGTTKEDLERIFADHLKPTLV 870
              +  TT   ++ IP ++    +   A  NA  +  V    T E+++  F + LK TL+
Sbjct: 790 LELQHNTTKILIS-IPIDDGSDSKTLEASCNAILITGVPRTVTVENIKACFDECLKQTLL 848

Query: 871 KNPQFKIQDSTKNGLIYPEDYAEISVNVERDLEALVGHFDYLCKESFIGDGI 922
           K+PQF++ +S  N  IYP ++ EIS NVE D++ LV +F ++C+   IG  +
Sbjct: 849 KDPQFRLINS--NAYIYPSNFLEISANVETDIQRLVPYFSHVCERKQIGYNV 898

>ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL023C (FAP1)
          Length = 908

 Score =  836 bits (2160), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/898 (48%), Positives = 556/898 (61%), Gaps = 31/898 (3%)

Query: 38  MAYYERAVQEIALGDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREWALKSTEKTLD 97
           + YYE+ V E+  G+ Y C+ICTVEMD +C MYAC  CYRV+DYECIR WALK+T  T+D
Sbjct: 16  IPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALKATSTTVD 75

Query: 98  RVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPICPHGCSKQCHL 157
           R WKCPNCY VN++VP KNR TCWCGK VN DPN ++PNSCGQTC APIC HGCSK CHL
Sbjct: 76  RTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHGCSKLCHL 135

Query: 158 GPHPDCVRTITTKCQCGKHTRETFCYQTISMKGKSQFQCNEVCGLPLACGIHKCERLCHS 217
           GPH +C+  I  KC+CGK T E  CY+  +   K  F C++ CGLP+ CGIHKCER+CH+
Sbjct: 136 GPHEECMVRIDFKCRCGKLTEEIPCYE--AKAAKRNFSCDQPCGLPMPCGIHKCERVCHN 193

Query: 218 GICGPCPAVLNAKSNKLKIRCYCGLEHRDSFKCKDVRVASDLSKDGKGDSWIGAFGCSGI 277
           G CGPC   +        I+CYCGL  R+   C +V V +  SK  K  SWIGAF C  +
Sbjct: 194 GPCGPCKEEIAG-----DIKCYCGLTTRNKMVCSEVSVVAR-SKVSKYKSWIGAFACDRM 247

Query: 278 RKIEYACREHSFVEKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKVLAEPRKSCTSPIP 337
           R++ Y+C +HSF EKC   PS+  +  CP+SP+   TCPCG+T L  L   R +CT  I 
Sbjct: 248 REVPYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRTACTDHIS 307

Query: 338 NCDSTCGKKLACGRHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSVPCQFKEQPRCDTK 397
           +C   CGK+L+CG HTCP TCHDG CMDPC+ I   +C+C +  + VPCQF   P C  K
Sbjct: 308 SCGKVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPHSPSCTAK 367

Query: 398 CESLMSXXXXXXXXXXXXXXPF-----AERRRKTPLSSRELMDESSVESEHICLKDCNLT 452
           CESLMS              P      + RRR++P       DES VE++H+CLKDCN  
Sbjct: 368 CESLMSCRRHRCAERCCSGRPHSVKRNSRRRRESP------DDESEVEAQHVCLKDCNRV 421

Query: 453 LSCGCHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHYPCIRVIQN 512
           L CG H C  KCH GKCPPCLESDSNDL+CPCGKT+V APVRCGT+LP C +PC   + +
Sbjct: 422 LLCGIHMCNYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLLD 481

Query: 513 AYKCGHKPMPHTCHPLNEPCPSCTAPVFKPCKCGKKDKVRTLCFQNDVSCGTTCGKPLDN 572
            + CGH P  H CHPL+EPCP CT  V K C+CG K+++RT C+ +DVSC   C KPL  
Sbjct: 482 TWPCGHSPPSHNCHPLDEPCPPCTITVKKTCRCG-KNEIRTFCYNDDVSCSRPCKKPLSY 540

Query: 573 CPHMCQKSCHIPGECQKKCKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLSVKIKCECE 632
           C H CQ  CH  G+CQ+ CKQ C   R  C+H C+  CHG+  CP+ PC     I C C 
Sbjct: 541 CNHFCQVPCHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCG 600

Query: 633 VKESFITCGANS-ETPSKATTTILPCDEECERHKRHLQLREAFGISNFSDNPSRSKTASL 691
            K S   C   + +      +  L CDE+C + +RH QL  AFG+       S    A L
Sbjct: 601 HKSSTKICSEYAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGV--VEKATSEEDEALL 658

Query: 692 ENLAAVANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEKTSLHFKPMRPAQ 751
             LA  + SF++L LPF+E  L  F KQ  WCTQIE  L   MD+    +LHFKPMR AQ
Sbjct: 659 --LAQRSQSFDDLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQ 716

Query: 752 RHFIHELAKSYNLYVESQDREPKRSVFVKKQDNGGSCKPVIQLKDSLPIYQFFKENEKEK 811
           R F+HEL+ S+ LY ESQD EPKRSV+VKK   G S  P I L  + P+Y  FK+ E+E 
Sbjct: 717 RRFVHELSSSFGLYSESQDPEPKRSVYVKK--TGISRVPAIGLSKAAPLYTSFKKLEREF 774

Query: 812 KAQRFEAQTTTEFVNFIPKEEPQLER-AKNNAFKLKNVSTGTTKEDLERIFADHLKPTLV 870
           KA   E+  T + V+    + P+ +  A  NA  L  +++  ++  L   FAD+   TL+
Sbjct: 775 KANS-ESAVTKKLVSVHIDDSPESQHDAAINAILLSGLTSFASESALRDCFADYFSQTLL 833

Query: 871 KNPQFKIQDSTKNGLIYPEDYAEISVNVERDLEALVGHFDYLCKESFIGDGIELCHID 928
             PQ+ ++ +   G I+P DY  +S N E+DL  L G+F  L +E  +   I  C +D
Sbjct: 834 NCPQYVVRGT--EGYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLD 889

>NCAS0C05920 Chr3 (1218910..1219773) [864 bp, 287 aa] {ON} Anc_4.7
           YHL034C
          Length = 287

 Score = 34.3 bits (77), Expect = 1.2,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 834 QLERAKNNAFKLKNVSTGTTKEDLERIFADHLKPTLVKNPQFKIQDSTKNGLIYPE 889
           Q+ER+K+  + + N+    TKE+L  +F    KP LV  P+ +++D T   +++ E
Sbjct: 166 QMERSKDTLY-VNNLPYSATKEELAELFGT--KPELVVLPKRRMRDETTKKVVFSE 218

>NDAI0C03270 Chr3 complement(742293..743174) [882 bp, 293 aa] {ON}
           Anc_5.86 YGR239C
          Length = 293

 Score = 32.3 bits (72), Expect = 4.8,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 54/110 (49%), Gaps = 15/110 (13%)

Query: 801 YQFFKENEKEKKAQRFEAQTTTEFVN---FIPKEEPQLERAKNNAFKLKNVSTGTTK-ED 856
           Y+ + ENE E            EF+N    I +EE Q E + N  F  KN+ST   + ++
Sbjct: 175 YRSYNENENE----------APEFLNEQFNIIEEEEQKEDSMNTGFPNKNISTEQEEFKN 224

Query: 857 LERIFADHLKPTLVKNPQFKIQDSTKNGLIYPEDYAEISVNV-ERDLEAL 905
           + +   D ++    KN   KI+ S    +I   +  ++++NV ER+L +L
Sbjct: 225 IAKDIYDFVENKENKNVSDKIRGSKFMSMISLVNDGDVTINVQERELFSL 274

>Skud_13.10 Chr13 complement(11346..13037) [1692 bp, 563 aa] {ON}
           YML130C (REAL)
          Length = 563

 Score = 32.7 bits (73), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 36/58 (62%), Gaps = 5/58 (8%)

Query: 681 DNPSRSKTASLENLAAVANSFEELELP----FSEPALGTFAK-QEAWCTQIENVLNSF 733
           +N + +K    EN ++ A++F++L++P     S+PA G   K ++ W T+I NVL +F
Sbjct: 455 ENINNTKQEKEENDSSQAHAFDDLKVPQPKSVSKPAAGVENKWKKGWNTEINNVLEAF 512

>Skud_5.308 Chr5 (508459..510867) [2409 bp, 802 aa] {ON} YER169W
           (REAL)
          Length = 802

 Score = 32.0 bits (71), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 46/99 (46%), Gaps = 14/99 (14%)

Query: 780 KKQDNGGSCKPVIQLKDSLPIYQFFKENEKEKKAQRFEAQTTTEFV-------NFIPKEE 832
           KK D+  S + + ++K   PI Q    N+     Q  E + T   +       +++P E+
Sbjct: 54  KKLDSPHSAETLQKIKIKSPIQQHISGNKGLFMVQNVEKKKTYNIIQWKDLSKDYVPPED 113

Query: 833 PQLERA-------KNNAFKLKNVSTGTTKEDLERIFADH 864
           P++ R+       K++  KLKN  +    +D E+  A++
Sbjct: 114 PKVRRSSRKGSVSKSSKLKLKNFESSFNIDDFEQFRAEY 152

>NDAI0B00380 Chr2 (69299..70015) [717 bp, 238 aa] {ON}
          Length = 238

 Score = 31.6 bits (70), Expect = 8.9,   Method: Composition-based stats.
 Identities = 39/133 (29%), Positives = 56/133 (42%), Gaps = 20/133 (15%)

Query: 641 GANSETPSKATTTILPCDEECE-------RHKRHLQLREAFGISNFSDNPSRSKTASLEN 693
           G+ ++T  +  + ILP +EE E       R+  H  +     I N S       T S E+
Sbjct: 24  GSGTDTIIREESFILPLEEEQEFIINNPSRNTSHFLI-----IDNNSPKIDTLSTDSEES 78

Query: 694 LAAV--ANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEKTSLHFKPMRPAQ 751
           +  +  A + EE  +  S  A     K       IENVL    +NEEKTSL   P+    
Sbjct: 79  ITGIISARTSEEFSI-LSSSAQSPELKYNKELDTIENVLK---ENEEKTSLEAVPLH--G 132

Query: 752 RHFIHELAKSYNL 764
            HF+     + NL
Sbjct: 133 YHFLDTEENNKNL 145

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.454 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 100,104,867
Number of extensions: 4461180
Number of successful extensions: 11142
Number of sequences better than 10.0: 63
Number of HSP's gapped: 10475
Number of HSP's successfully gapped: 68
Length of query: 936
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 817
Effective length of database: 39,836,145
Effective search space: 32546130465
Effective search space used: 32546130465
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)