Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G021802.287ON36936919520.0
NCAS0B062502.287ON37337317210.0
NDAI0B035502.287ON37237216990.0
Smik_9.852.287ON37137116850.0
ZYRO0A01914g2.287ON36836916830.0
Suva_9.1052.287ON37137116750.0
YIL094C (LYS12)2.287ON37137116730.0
Skud_9.792.287ON37137116570.0
KNAG0A054202.287ON37237116550.0
CAGL0G02585g2.287ON37237216360.0
KLTH0G10384g2.287ON36736916280.0
KLLA0E08339g2.287ON36936916270.0
SAKL0E07656g2.287ON36836916120.0
Kwal_27.115282.287ON36736915930.0
TBLA0B059402.287ON36936915650.0
Kpol_1003.392.287ON37037015600.0
KAFR0J013602.287ON37337215570.0
TPHA0C034102.287ON37137115180.0
Ecym_33262.287ON36636914660.0
ADL214C2.287ON36736913530.0
ADL223W2.278ON3623814821e-56
TDEL0C038402.278ON3613854733e-55
Kwal_23.50122.278ON3613834691e-54
NCAS0H022505.473ON4223904686e-54
TPHA0D015602.278ON3603854638e-54
KLLA0F04103g2.278ON3613834585e-53
Ecym_33162.278ON3623804561e-52
SAKL0E07876g2.278ON3613524491e-51
NDAI0C014105.473ON3693904482e-51
Ecym_23135.473ON3703524463e-51
Suva_8.1885.473ON3693914455e-51
Smik_14.2902.278ON3603514439e-51
KLTH0G10186g2.278ON3603844411e-50
YNL037C (IDH1)2.278ON3603814411e-50
KNAG0B040705.473ON3733524412e-50
KLLA0E03125g5.473ON3683524412e-50
Skud_14.2932.278ON3613794402e-50
NCAS0B062902.278ON3593534393e-50
Skud_15.3005.473ON3693904377e-50
Smik_15.3165.473ON3693914379e-50
TBLA0B069102.278ON3653514351e-49
Kpol_1039.352.278ON3593774332e-49
NDAI0B035902.278ON3593544332e-49
TBLA0B022405.473ON3733944325e-49
KNAG0A052802.278ON3613834281e-48
Kwal_55.212735.473ON3683914272e-48
KLTH0F15048g5.473ON3683544272e-48
CAGL0I07227g5.473ON3683884263e-48
TDEL0A033705.473ON3713984273e-48
AFR137C5.473ON3673734263e-48
YOR136W (IDH2)5.473ON3693914263e-48
KAFR0B063705.473ON3783714264e-48
ZYRO0D02838g2.278ON3613514202e-47
SAKL0G03520g5.473ON3693904184e-47
ZYRO0D11220g5.473ON3683894175e-47
Kpol_440.125.473ON3683524169e-47
Kpol_543.85.473ON3683714141e-46
CAGL0G02673g2.278ON3583774123e-46
TPHA0J027705.473ON3763764108e-46
TPHA0E014805.473ON3773864063e-45
KAFR0J014102.278ON3503784034e-45
Ecym_12961.402ON3633673828e-42
KLTH0H12188g1.402ON3643713688e-40
TBLA0C015001.402ON3653683662e-39
NDAI0G042301.402ON3633643582e-38
Smik_3.661.402ON3643723503e-37
TDEL0B060001.402ON3623603503e-37
Suva_14.3022.278ON3003223454e-37
KLLA0D04906g1.402ON3623603485e-37
AAL012C1.402ON3723683486e-37
YCL018W (LEU2)1.402ON3643723451e-36
Skud_3.431.402ON3643723452e-36
KNAG0I012801.402ON4473793482e-36
Kwal_0.2251.402ON3643733433e-36
KAFR0I022001.402ON3653663363e-35
ZYRO0E04796g1.402ON3623643355e-35
CAGL0H03795g1.402ON3653613321e-34
Kpol_1048.631.402ON3643663312e-34
SAKL0D08690g1.402ON3643713275e-34
Suva_3.31.402ON3643603223e-33
NCAS0C048701.402ON3653653144e-32
TPHA0B037301.402ON3653702751e-26
Kwal_23.42104.254ON4222041426e-09
KAFR0H031601.396ON4211261372e-08
Kpol_1055.784.254ON4271151363e-08
CAGL0D00770g4.254ON4231331363e-08
TPHA0B022104.254ON4331821354e-08
YDL066W (IDP1)4.254ON4282071345e-08
SAKL0H02860g4.254ON4212981336e-08
CAGL0H03663g1.396ON4181261329e-08
NDAI0D043604.254ON4241151311e-07
Ecym_13061.396ON4151261302e-07
Skud_4.1894.254ON4291151292e-07
AAL022W1.396ON4151261282e-07
NCAS0A087201.396ON4131261283e-07
KLTH0H12012g1.396ON4131951273e-07
KLLA0B03355g4.254ON4292041274e-07
KNAG0I013201.396ON4121061264e-07
KAFR0I021301.396ON4081061264e-07
Kpol_1048.701.396ON4191061265e-07
TBLA0C012901.396ON4181261256e-07
Smik_4.1694.254ON4282071256e-07
TDEL0E011604.254ON4231151256e-07
KNAG0H016701.396ON4241261256e-07
ZYRO0E05016g1.396ON4111271257e-07
Kwal_0.1911.396ON4111941257e-07
SAKL0D08426g1.396ON4111261257e-07
Suva_4.1844.254ON4291061248e-07
NCAS0G036201.396ON4181281248e-07
NDAI0G008501.396ON4191061249e-07
KAFR0G032604.254ON4211111231e-06
TBLA0A080104.254ON4281141231e-06
TDEL0B061001.396ON4141271221e-06
Smik_12.2351.396ON4122181212e-06
AER061C4.254ON4251371212e-06
NCAS0A025104.254ON4261441212e-06
YNL009W (IDP3)1.396ON4201261202e-06
Skud_14.3181.396ON4201261203e-06
KLTH0D14476g4.254ON4201151193e-06
CAGL0B04917g1.396ON4111301194e-06
KNAG0D044104.254ON4281281184e-06
Skud_12.2391.396ON4121261185e-06
YLR174W (IDP2)1.396ON4122181185e-06
KLLA0F12342g1.396ON4151981177e-06
Suva_10.2711.396ON4121261168e-06
ZYRO0B12496g4.254ON4221151151e-05
Suva_14.3391.396ON4171261151e-05
TPHA0B036601.396ON4221261151e-05
Smik_14.3191.396ON4181261142e-05
Ecym_32654.254ON4241071087e-05
NDAI0G051601.396ON4201261033e-04
Suva_14.303singletonON5350897e-04
SAKL0E09218g2.222ON40826731.3
Ecym_50207.21ON790142722.0
KAFR0A053703.455ON120183722.3
KLTH0D02486g7.86ON122397722.5
ZYRO0A00990g2.222ON44630694.9
KNAG0A037508.531ON83085695.2
KNAG0F002201.32ON36858685.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G02180
         (369 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {O...   756   0.0  
NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON} Anc_2...   667   0.0  
NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.2...   659   0.0  
Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}...   653   0.0  
ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {...   652   0.0  
Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON...   649   0.0  
YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}  ...   649   0.0  
Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}...   642   0.0  
KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON}              642   0.0  
CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly...   634   0.0  
KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {...   631   0.0  
KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly...   631   0.0  
SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly...   625   0.0  
Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094...   618   0.0  
TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa] ...   607   0.0  
Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {O...   605   0.0  
KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2....   604   0.0  
TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {O...   589   0.0  
Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}...   569   0.0  
ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON} S...   525   0.0  
ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic ho...   190   1e-56
TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {O...   186   3e-55
Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C...   185   1e-54
NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473    184   6e-54
TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {O...   182   8e-54
KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON} unipro...   181   5e-53
Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar t...   180   1e-52
SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {...   177   1e-51
NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {O...   177   2e-51
Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}...   176   3e-51
Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W ...   176   5e-51
Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037...   175   9e-51
KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly...   174   1e-50
YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON} ...   174   1e-50
KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {O...   174   2e-50
KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly...   174   2e-50
Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037...   174   2e-50
NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa] ...   173   3e-50
Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136...   172   7e-50
Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136...   172   9e-50
TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON}            172   1e-49
Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa] ...   171   2e-49
NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {O...   171   2e-49
TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {O...   171   5e-49
KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON}              169   1e-48
Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {...   169   2e-48
KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]...   169   2e-48
CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {...   168   3e-48
TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.4...   169   3e-48
AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON} S...   168   3e-48
YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subun...   168   3e-48
KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa] ...   168   4e-48
ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} simila...   166   2e-47
SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly...   165   4e-47
ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly...   165   5e-47
Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON} (32084..3...   164   9e-47
Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON} (21411..22...   164   1e-46
CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {...   163   3e-46
TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2....   162   8e-46
TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {O...   160   3e-45
KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {...   159   4e-45
Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar t...   151   8e-42
KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} high...   146   8e-40
TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {O...   145   2e-39
NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa] ...   142   2e-38
Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)   139   3e-37
TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON} Anc_1...   139   3e-37
Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C...   137   4e-37
KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly...   138   5e-37
AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON} S...   138   6e-37
YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}  LEU2Beta-iso...   137   1e-36
Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)   137   2e-36
KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {O...   138   2e-36
Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W (L...   136   3e-36
KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.4...   134   3e-35
ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON} unipro...   133   5e-35
CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}             132   1e-34
Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON} (1820...   132   2e-34
SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {...   130   5e-34
Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)      128   3e-33
NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {O...   125   4e-32
TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {O...   110   1e-26
Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W...    59   6e-09
KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {O...    57   2e-08
Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON} (2078...    57   3e-08
CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly s...    57   3e-08
TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.2...    57   4e-08
YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}  IDP1Mitoch...    56   5e-08
SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly...    56   6e-08
CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly...    55   9e-08
NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON} Anc_4...    55   1e-07
Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}...    55   2e-07
Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W ...    54   2e-07
AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic ho...    54   2e-07
NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa] ...    54   3e-07
KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} high...    54   3e-07
KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly...    54   4e-07
KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {O...    53   4e-07
KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.3...    53   4e-07
Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa] ...    53   5e-07
TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {O...    53   6e-07
Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W ...    53   6e-07
TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.2...    53   6e-07
KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.3...    53   6e-07
ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {...    53   7e-07
Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP...    53   7e-07
SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly...    53   7e-07
Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W ...    52   8e-07
NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {O...    52   8e-07
NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396     52   9e-07
KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {O...    52   1e-06
TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON} Anc_4...    52   1e-06
TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa] ...    52   1e-06
Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174...    51   2e-06
AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON} S...    51   2e-06
NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {O...    51   2e-06
YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}  IDP3Perox...    51   2e-06
Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009...    51   3e-06
KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]...    50   3e-06
CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {...    50   4e-06
KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {O...    50   4e-06
Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174...    50   5e-06
YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}  IDP2Cytos...    50   5e-06
KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} high...    50   7e-06
Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174...    49   8e-06
ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]...    49   1e-05
Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009...    49   1e-05
TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.3...    49   1e-05
Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174...    49   2e-05
Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar t...    46   7e-05
NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa] ...    44   3e-04
Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C ...    39   7e-04
SAKL0E09218g Chr5 (765587..766813) [1227 bp, 408 aa] {ON} some s...    33   1.3  
Ecym_5020 Chr5 complement(43098..45470) [2373 bp, 790 aa] {ON} s...    32   2.0  
KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON} Anc_...    32   2.3  
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    32   2.5  
ZYRO0A00990g Chr1 complement(70521..71861) [1341 bp, 446 aa] {ON...    31   4.9  
KNAG0A03750 Chr1 (487451..489943) [2493 bp, 830 aa] {ON} Anc_8.5...    31   5.2  
KNAG0F00220 Chr6 complement(21846..22952) [1107 bp, 368 aa] {ON}...    31   5.3  

>TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {ON}
           Anc_2.287 YIL094C
          Length = 369

 Score =  756 bits (1952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/369 (100%), Positives = 369/369 (100%)

Query: 1   MLRSAIGRLATRRAYASAPKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDL 60
           MLRSAIGRLATRRAYASAPKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDL
Sbjct: 1   MLRSAIGRLATRRAYASAPKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDL 60

Query: 61  QAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYAN 120
           QAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYAN
Sbjct: 61  QAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYAN 120

Query: 121 VRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIA 180
           VRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIA
Sbjct: 121 VRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIA 180

Query: 181 TIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIV 240
           TIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIV
Sbjct: 181 TIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIV 240

Query: 241 DSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSA 300
           DSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSA
Sbjct: 241 DSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSA 300

Query: 301 PDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQ 360
           PDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQ
Sbjct: 301 PDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQ 360

Query: 361 VVEDILSKL 369
           VVEDILSKL
Sbjct: 361 VVEDILSKL 369

>NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON}
           Anc_2.287
          Length = 373

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/373 (86%), Positives = 348/373 (93%), Gaps = 4/373 (1%)

Query: 1   MLRSAIGRLATR--RAYASAP--KSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFD 56
           MLR+A  R AT   R YA+    K++ IGLIPGDGIGKEVIPAGKQVLENL+ KHGL FD
Sbjct: 1   MLRTAASRFATSTCRTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFD 60

Query: 57  FIDLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELG 116
           FIDLQAG+ TF +TGKALP++TVQVLK+QCQGALFGAVQSPTTKVEGYSSPIVALRKE+G
Sbjct: 61  FIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 120

Query: 117 LYANVRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVAT 176
           L+ANVRPVKSV GTKDRPVDMVIVRENTEDLYIK+EKTY+DKATGTRVAEATKRISE+AT
Sbjct: 121 LFANVRPVKSVSGTKDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIAT 180

Query: 177 RRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYN 236
           RRIATIALDIALQRLK NG ATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYG + YN
Sbjct: 181 RRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYN 240

Query: 237 EQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 296
           EQIVDSMVYRMFREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC
Sbjct: 241 EQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 300

Query: 297 HGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNS 356
           HGSAPDIAGKGI+NPIATIRST LMLEFLGHN  AQDI+RAV+AN+RE+K+KTPDLGGNS
Sbjct: 301 HGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNS 360

Query: 357 TTQQVVEDILSKL 369
           TTQQV ED+L++L
Sbjct: 361 TTQQVTEDVLARL 373

>NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.287
           YIL094C
          Length = 372

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/372 (85%), Positives = 347/372 (93%), Gaps = 3/372 (0%)

Query: 1   MLRSAIGRLATRRAYASAP--KSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFI 58
           MLR+   RLAT R YA+    K++ IGLIPGDGIGKEVIPAGKQVL+NL+ KHGLNFDFI
Sbjct: 1   MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI 60

Query: 59  DLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLY 118
           DLQAG+ TF +TGKALP++T+QVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKE+GLY
Sbjct: 61  DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY 120

Query: 119 ANVRPVKSVEGTKDRPVDMVIVRENTEDLY-IKLEKTYVDKATGTRVAEATKRISEVATR 177
           ANVRPVKSVEGT D+PVDMVIVRENT     IKLE+TY+D+ATGTRVAEATKRISE+ATR
Sbjct: 121 ANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATR 180

Query: 178 RIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNE 237
           RIATIALDIALQRLKTNG ATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQ+ YNE
Sbjct: 181 RIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNE 240

Query: 238 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 297
           QIVDSMVYRMFREP+CFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH
Sbjct: 241 QIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300

Query: 298 GSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNST 357
           GSAPDIAGKGISNPIATIRST LMLEFLGHN+ AQDI+RAV+ANL+E+KVKTPDLGG ST
Sbjct: 301 GSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKST 360

Query: 358 TQQVVEDILSKL 369
           TQ+V ED+L++L
Sbjct: 361 TQEVTEDVLARL 372

>Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/371 (84%), Positives = 347/371 (93%), Gaps = 2/371 (0%)

Query: 1   MLRSAIGRLATRRAYAS--APKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFI 58
           MLRS   RL+T R  A+  A KS+ IGLIPGDGIGKEVIPAGKQVLENL+ KHGL+F+FI
Sbjct: 1   MLRSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 59  DLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLY 118
           DL AG+ TFQETGKALP++TV+VLK QCQGALFGAVQSPTTKVEGYSSPIVALR+E+GL+
Sbjct: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 119 ANVRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRR 178
           ANVRPVKSVEG KD+P+DMVIVRENTEDLYIK+EKTY+DKATGTRVA+ATKRISE+ATRR
Sbjct: 121 ANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180

Query: 179 IATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQ 238
           IATIA+DIAL+RL+T G ATLTVTHKSNVLSQSDGLFREICK+VYESNKDKYGQ+ YNEQ
Sbjct: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240

Query: 239 IVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 298
           IVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300

Query: 299 SAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTT 358
           SAPDIAGKGI+NPIATIRST LMLEFLGHN  AQDIY+AVDANLRE  +KTPDLGG ++T
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAST 360

Query: 359 QQVVEDILSKL 369
           QQVVED+LS+L
Sbjct: 361 QQVVEDVLSRL 371

>ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/369 (86%), Positives = 338/369 (91%), Gaps = 1/369 (0%)

Query: 1   MLRSAIGRLATRRAYASAPKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDL 60
           M RS++ ++A RRAY SAPKSM IGLIPGDGIGKEVIPAGKQVLE L  KHGL FDFIDL
Sbjct: 1   MFRSSVAKVAARRAY-SAPKSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDL 59

Query: 61  QAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYAN 120
           +AGW  FQ+ GKALP+ TV+VLK QCQGALFGAVQSPTTKV GYSSPIVALRKELGLYAN
Sbjct: 60  KAGWEAFQQQGKALPDDTVKVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYAN 119

Query: 121 VRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIA 180
           VRPVKSVE   DR VDM+IVRENTEDLYIK EKTYVD+ATGTRVAEA KRISEVATR+IA
Sbjct: 120 VRPVKSVEKGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIA 179

Query: 181 TIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIV 240
           TIALDI+LQRLK+ GHATLTVTHKSNVLSQSDGLFREICKDVYE NKDKYG+V YNEQIV
Sbjct: 180 TIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIV 239

Query: 241 DSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSA 300
           DSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSA
Sbjct: 240 DSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSA 299

Query: 301 PDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQ 360
           PDIAGKGISNPIATIRST LMLEFLGH +PAQDIY+AVDANL +  V TPDLGG +TTQQ
Sbjct: 300 PDIAGKGISNPIATIRSTALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQ 359

Query: 361 VVEDILSKL 369
           VV+DILSK+
Sbjct: 360 VVDDILSKI 368

>Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/371 (83%), Positives = 344/371 (92%), Gaps = 2/371 (0%)

Query: 1   MLRSAIGRLATRRAYAS--APKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFI 58
           M RS   R++  R  AS  A KS+ IGLIPGDGIGKEVIPAGKQ+LENL+ KHGL+F+FI
Sbjct: 1   MFRSVATRISACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFI 60

Query: 59  DLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLY 118
           DL AG+ TFQETGKALP++T++VLK+QCQGALFGAVQSPTTKVEGYSSPIVALR+E+GLY
Sbjct: 61  DLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLY 120

Query: 119 ANVRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRR 178
           ANVRPVKSVEGTKD+P+DMVIVRENTEDLYIK+EKTY+DKATGTRVA+A KRISEVATRR
Sbjct: 121 ANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRR 180

Query: 179 IATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQ 238
           IA IALDIALQRL+T G ATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQ+ YNEQ
Sbjct: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQ 240

Query: 239 IVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 298
           IVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP+IVIGEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCHG 300

Query: 299 SAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTT 358
           SAPDIAGKGI+NPIATIRST LMLEFLGHN  AQDIY+AVDANLRE  + TPDLGG ++T
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAST 360

Query: 359 QQVVEDILSKL 369
           QQVV+D+LS+L
Sbjct: 361 QQVVDDVLSRL 371

>YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}
           LYS12Homo-isocitrate dehydrogenase, an NAD-linked
           mitochondrial enzyme required for the fourth step in the
           biosynthesis of lysine, in which homo-isocitrate is
           oxidatively decarboxylated to alpha-ketoadipate
          Length = 371

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/371 (83%), Positives = 345/371 (92%), Gaps = 2/371 (0%)

Query: 1   MLRSAIGRLATRRAYAS--APKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFI 58
           M RS   RL+  R  AS  A KS+ IGLIPGDGIGKEVIPAGKQVLENL+ KHGL+F+FI
Sbjct: 1   MFRSVATRLSACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 59  DLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLY 118
           DL AG+ TFQETGKALP++TV+VLK QCQGALFGAVQSPTTKVEGYSSPIVALR+E+GL+
Sbjct: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 119 ANVRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRR 178
           ANVRPVKSVEG K +P+DMVIVRENTEDLYIK+EKTY+DKATGTRVA+ATKRISE+ATRR
Sbjct: 121 ANVRPVKSVEGEKGKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180

Query: 179 IATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQ 238
           IATIALDIAL+RL+T G ATLTVTHKSNVLSQSDGLFREICK+VYESNKDKYGQ+ YNEQ
Sbjct: 181 IATIALDIALKRLQTRGQATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240

Query: 239 IVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 298
           IVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300

Query: 299 SAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTT 358
           SAPDIAGKGI+NPIATIRST LMLEFLGHN+ AQDIY+AVDANLRE  +KTPDLGG ++T
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIYKAVDANLREGSIKTPDLGGKAST 360

Query: 359 QQVVEDILSKL 369
           QQVV+D+LS+L
Sbjct: 361 QQVVDDVLSRL 371

>Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  642 bits (1657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/371 (82%), Positives = 344/371 (92%), Gaps = 2/371 (0%)

Query: 1   MLRSAIGRLATRRAYAS--APKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFI 58
           M RS   R++  R  A+  A KS+ IGLIPGDGIGKEVIPAGKQVLENL+ KHGL+F+FI
Sbjct: 1   MFRSVATRVSACRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 59  DLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLY 118
           DL AG+ TFQETGKALP++TV VLK QCQGALFGAVQSPTTKVEGYSSPIVALR+E+GL+
Sbjct: 61  DLYAGFQTFQETGKALPDETVNVLKKQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 119 ANVRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRR 178
           ANVRPVKSVEG++++P+DMVIVRENTEDLYIK+EKTY+DKATGTRVA+ATKRISE+ATRR
Sbjct: 121 ANVRPVKSVEGSRNKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180

Query: 179 IATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQ 238
           IATIALDIAL+RL+T G ATLTVTHKSNVLSQ+DGLFREICK+VYESNKDKYGQ+ YNEQ
Sbjct: 181 IATIALDIALKRLQTRGEATLTVTHKSNVLSQTDGLFREICKEVYESNKDKYGQIKYNEQ 240

Query: 239 IVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 298
           IVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300

Query: 299 SAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTT 358
           SAPDIAGKGI+NPIATIRST LMLEFLGHN  AQDIY+AVDANLRE  + TPDLGG ++T
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNGAAQDIYKAVDANLREGAITTPDLGGKAST 360

Query: 359 QQVVEDILSKL 369
           QQVV+D+LS+L
Sbjct: 361 QQVVDDVLSRL 371

>KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/371 (82%), Positives = 345/371 (92%), Gaps = 2/371 (0%)

Query: 1   MLRSAIGRLATRRAYAS--APKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFI 58
           MLRSA  +LA  R  A+  A KS+ IGLIPGDGIGKEVIPAGKQVL++L+ KHGLNFDFI
Sbjct: 2   MLRSAANKLAGCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLQSLNPKHGLNFDFI 61

Query: 59  DLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLY 118
           DLQAG+ TFQ+TGKALP++TVQ+LK +CQGALFGAVQSPTTKVEGYSSPIVALRK +GLY
Sbjct: 62  DLQAGFQTFQDTGKALPDETVQILKEKCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLY 121

Query: 119 ANVRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRR 178
           AN+RPVKSVEG+ +RPVDM+IVRENTEDLYIK+EKTY+DKATGTRVAEATKRISE+AT+R
Sbjct: 122 ANIRPVKSVEGSNERPVDMIIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATQR 181

Query: 179 IATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQ 238
           IATIALDIALQRL+ NG ATLTVTHKSNVLSQSDGLFRE+C+++YE+NKDKY  + YNEQ
Sbjct: 182 IATIALDIALQRLQNNGKATLTVTHKSNVLSQSDGLFREVCREMYEANKDKYAGITYNEQ 241

Query: 239 IVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 298
           IVDSMVYRMFREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG
Sbjct: 242 IVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 301

Query: 299 SAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTT 358
           SAPDIAGKGI+NPIATIRST LMLEFLGHN+ AQDI++AVDANLR+  VKT DLGGN+TT
Sbjct: 302 SAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIHKAVDANLRDGLVKTADLGGNATT 361

Query: 359 QQVVEDILSKL 369
           Q VV+DIL++L
Sbjct: 362 QNVVDDILARL 372

>CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094c LYS12 homo-isocitrate dehydrogenase
          Length = 372

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/372 (82%), Positives = 338/372 (90%), Gaps = 3/372 (0%)

Query: 1   MLRSAIGRLATRRAYAS---APKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDF 57
           MLR +  RL   R ++S   A K++ IGLIPGDGIGKEVIPAGKQ+LE +  K  L+F F
Sbjct: 1   MLRGSATRLTAMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKF 60

Query: 58  IDLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGL 117
           IDL AGW TFQ TGKALP++TV+VL+  CQGALFGAVQSPTTKVEGYSSPIVALRK +GL
Sbjct: 61  IDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGL 120

Query: 118 YANVRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATR 177
           +ANVRPVK+VEGT DRPVDMVIVRENTEDLYIK+EKTY D ATGTRVAEATKRISEVATR
Sbjct: 121 FANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATR 180

Query: 178 RIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNE 237
           RIATIALDIALQRL++ GHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYG++ YNE
Sbjct: 181 RIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNE 240

Query: 238 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 297
           QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH
Sbjct: 241 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300

Query: 298 GSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNST 357
           GSAPDIAG+GI+NPIATIRST LMLEFLG+ + AQ IY+AVD+N+RE+++KTPDLGG ST
Sbjct: 301 GSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKST 360

Query: 358 TQQVVEDILSKL 369
           TQQVV+DILSK+
Sbjct: 361 TQQVVDDILSKI 372

>KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 367

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/369 (81%), Positives = 337/369 (91%), Gaps = 2/369 (0%)

Query: 1   MLRSAIGRLATRRAYASAPKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDL 60
           MLR++  +LA RR+YASA KS+ IGLIPGDGIGKEVIPAG+QVLENLS KHGL FDFIDL
Sbjct: 1   MLRASFTQLA-RRSYASASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDL 59

Query: 61  QAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYAN 120
           QAGW TFQETGKALP++T+ +L+NQCQGALFGAVQSPT KVEGYSSPIVALRK+LGLYAN
Sbjct: 60  QAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYAN 119

Query: 121 VRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIA 180
           VRPVKSV   ++RPVDM+IVRENTEDLYIK EKTY+D+ TGTRVAEA KRISE AT+ IA
Sbjct: 120 VRPVKSVL-PQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIA 178

Query: 181 TIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIV 240
            IAL+IALQR K NG ATLTVTHKSNVLSQSDGLFRE+C+ VYESNKDK+G + YNEQIV
Sbjct: 179 NIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIV 238

Query: 241 DSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSA 300
           DSMVYRMFREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPCHGSA
Sbjct: 239 DSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSA 298

Query: 301 PDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQ 360
           PDIAGKGISNP+ATIRST LMLEF+GH + AQDI++AVDANLR++ +KTPDLGG STTQQ
Sbjct: 299 PDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTTQQ 358

Query: 361 VVEDILSKL 369
           VVED+LS++
Sbjct: 359 VVEDVLSRM 367

>KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 369

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/369 (81%), Positives = 342/369 (92%), Gaps = 1/369 (0%)

Query: 1   MLRSAIGRLATRRAYASAPKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDL 60
           M+R+   +L +RRAYAS  K++ IGLIPGDGIGKEVIPAGK++LE+L+ K+GL+F FIDL
Sbjct: 1   MMRTRFIQL-SRRAYASNAKNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDL 59

Query: 61  QAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYAN 120
           QAGW TFQ TGKALP++T+ +LKNQC+GALFGAVQSPTTKVEGYSSPIVALRK LGL+AN
Sbjct: 60  QAGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFAN 119

Query: 121 VRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIA 180
           VRPVKSV+GTKDR VD+VIVRENTEDLYIKLEK+Y+D+ATGTRVA+ATKRI+E+AT+ IA
Sbjct: 120 VRPVKSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIA 179

Query: 181 TIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIV 240
           TIAL IA QRL+ NGHATLTVTHKSNVLSQSDGLFRE+C++ YE+NKDKYG V YNEQIV
Sbjct: 180 TIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIV 239

Query: 241 DSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSA 300
           DSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP IVIGEPCHGSA
Sbjct: 240 DSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCHGSA 299

Query: 301 PDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQ 360
           PDIAGKGISNPIATIRST LMLEFLG+ +PA+DI++AVDAN+RE K  TPDLGGNSTTQQ
Sbjct: 300 PDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQ 359

Query: 361 VVEDILSKL 369
           V+ED+LSKL
Sbjct: 360 VLEDVLSKL 368

>SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  625 bits (1612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/369 (79%), Positives = 335/369 (90%), Gaps = 1/369 (0%)

Query: 1   MLRSAIGRLATRRAYASAPKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDL 60
           MLRS + + A RR+YASA K + IGLIPGDGIGKEVIPAGK VLENLS KH L F+FIDL
Sbjct: 1   MLRSTVSQFA-RRSYASAAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDL 59

Query: 61  QAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYAN 120
           QAGW TF +TGKALP++T+++LK+ CQGALFGAVQSPT KVEGYSSPIVALRK+LGLYAN
Sbjct: 60  QAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYAN 119

Query: 121 VRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIA 180
           VRPVKSV+GT DRPVDM+IVRENTEDLYIK EKTY+D+ TGTRVAEA KRISE AT  IA
Sbjct: 120 VRPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIA 179

Query: 181 TIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIV 240
            IAL+I+LQRLK NG ATLTVTHKSNVLSQSDGLFRE+CK+VYESNK++YG + YNEQIV
Sbjct: 180 KIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIV 239

Query: 241 DSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSA 300
           DSMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG + ++GEPCHGSA
Sbjct: 240 DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCHGSA 299

Query: 301 PDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQ 360
           PDIAGKGISNPIATIRST LMLEF+G+ + AQDI++AVD N+RE+++KTPDLGG STTQQ
Sbjct: 300 PDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQ 359

Query: 361 VVEDILSKL 369
           VV+DILSK+
Sbjct: 360 VVDDILSKM 368

>Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094C
           (LYS12) - Homo-isocitrate dehydrogenase [contig 27] FULL
          Length = 367

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/369 (79%), Positives = 336/369 (91%), Gaps = 2/369 (0%)

Query: 1   MLRSAIGRLATRRAYASAPKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDL 60
           MLR++  +LA RR+Y SA KS+ IGLIPGDGIG+EVIPAGK VLENLS KHGL F+FIDL
Sbjct: 1   MLRTSFNQLA-RRSYTSATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDL 59

Query: 61  QAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYAN 120
           +AGW TF +TGKALP++T+ +LKN+CQGALFGAVQSPT KVEGYSSPIVALRK+LGLYAN
Sbjct: 60  EAGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYAN 119

Query: 121 VRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIA 180
           VRPVKSV  ++++P+DMVIVRENTEDLYIK EKTY+D+ TGTRVAEA KRISEVATR IA
Sbjct: 120 VRPVKSVL-SQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIA 178

Query: 181 TIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIV 240
            IAL+IALQR K NG ATLTVTHKSNVLSQSDGLFREIC+ VYESN+DK+G + YNEQIV
Sbjct: 179 NIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIV 238

Query: 241 DSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSA 300
           DSMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPCHGSA
Sbjct: 239 DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSA 298

Query: 301 PDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQ 360
           PDIAGKGISNP+ATIRST LMLEF+GH + AQDI++AVDANLR++ VKTPDLGG STTQQ
Sbjct: 299 PDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQ 358

Query: 361 VVEDILSKL 369
           VV+D+LS++
Sbjct: 359 VVDDVLSRM 367

>TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa]
           {ON} Anc_2.287 YIL094C
          Length = 369

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/369 (78%), Positives = 330/369 (89%)

Query: 1   MLRSAIGRLATRRAYASAPKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDL 60
           MLR+++ + +     AS+ K++ IGLIPGDGIGKEVIPAGKQVL+NL+ KHGL F+FIDL
Sbjct: 1   MLRTSVRQFSVSARNASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDL 60

Query: 61  QAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYAN 120
           QAG+ TF +TG ALP  TV +LKN+CQGALFGAVQSPTTKVEGYSSPIV LRKELGL+AN
Sbjct: 61  QAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFAN 120

Query: 121 VRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIA 180
           VRPVK+VEGT  +P+D+VIVRENTEDLYIK+EKTY D   G+R+AEATKRI+E AT+RIA
Sbjct: 121 VRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIA 180

Query: 181 TIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIV 240
             ALDIALQRLKT G ATLTVTHKSNVLSQSDGLFRE+CK+VYESNK  Y  VAYNEQIV
Sbjct: 181 KTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIV 240

Query: 241 DSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSA 300
           DSMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLG+VPSANVGP IVIGEPCHGSA
Sbjct: 241 DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCHGSA 300

Query: 301 PDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQ 360
           PDIAGKGI+NPIATIRST  MLE+LG++ PAQDIY+AVDAN+R++K+KT DLGG+STTQQ
Sbjct: 301 PDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQ 360

Query: 361 VVEDILSKL 369
           V++DIL KL
Sbjct: 361 VIDDILGKL 369

>Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {ON}
           complement(96083..97195) [1113 nt, 371 aa]
          Length = 370

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/370 (77%), Positives = 328/370 (88%), Gaps = 1/370 (0%)

Query: 1   MLRSAIGRLATRRAYASAPKS-MVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFID 59
           MLR+ + R   RR   +  +S + IGLIPGDGIGKEVIPAGK+VLE +  K+ ++F FID
Sbjct: 1   MLRNGVYRACARRTVVNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFID 60

Query: 60  LQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYA 119
           L AGW TF +TGKALP++TV +LK QCQGALFGAVQSPTTKVEGYSSPIVALRK+LGLYA
Sbjct: 61  LHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYA 120

Query: 120 NVRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRI 179
           N+RPVKSV GT DRPVDMVIVRENTEDLYIK E+TY+D+ATGT+VAEATKRISEVATR+I
Sbjct: 121 NIRPVKSVSGTNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKI 180

Query: 180 ATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQI 239
           A IALDIALQRLK  G ATLTVTHKSNVLSQSDGLFRE+C+DVYE NKD YG V+YNEQI
Sbjct: 181 AKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQI 240

Query: 240 VDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGS 299
           VDSMVYR+FREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP+I+IGEPCHGS
Sbjct: 241 VDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCHGS 300

Query: 300 APDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQ 359
           APDI+G+GISNP+ATIRS  LML+FLG+N+ A+DI  AVD N+R  K+KTPDLGG+S+T 
Sbjct: 301 APDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTT 360

Query: 360 QVVEDILSKL 369
           +V +DILSKL
Sbjct: 361 EVTDDILSKL 370

>KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2.287
           YIL094C
          Length = 373

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/372 (78%), Positives = 334/372 (89%), Gaps = 4/372 (1%)

Query: 1   MLRSAIGRLATRRAYASA--PKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFI 58
           MLRS + + AT R  ++    KS+ IGLIPGDGIGKEVIPAGKQVL+NLS +HGLNF+FI
Sbjct: 1   MLRSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFI 60

Query: 59  DLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLY 118
           DL+AG+ TF +TGKALP++TV+VLK QCQG LFGAVQSPTT+V+ YSSPIVALRKEL LY
Sbjct: 61  DLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLY 120

Query: 119 ANVRPVKSVEGTKD-RPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATR 177
           AN+RPVKSV G    +PVDMVIVRENTEDLYIK+EK+Y D+  G RVAEATKRI+EVATR
Sbjct: 121 ANIRPVKSVAGAHSGKPVDMVIVRENTEDLYIKIEKSYKDQ-NGMRVAEATKRITEVATR 179

Query: 178 RIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNE 237
           +IA IALD+ALQRLKTNG ATLTVTHKSNVLSQSDGLFREICKDVY++NKDKY  + YNE
Sbjct: 180 KIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNE 239

Query: 238 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 297
           QI+DSMVYRMFREPE FDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP+IV+GEPCH
Sbjct: 240 QIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPCH 299

Query: 298 GSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNST 357
           GSAPDIAGKGI+NPIATIRST LMLEFLGH + AQDI++AV++N+RE+K+KTPDLGGNS+
Sbjct: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSS 359

Query: 358 TQQVVEDILSKL 369
           TQ VV+D+L KL
Sbjct: 360 TQNVVDDVLEKL 371

>TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {ON}
           Anc_2.287 YIL094C
          Length = 371

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/371 (76%), Positives = 322/371 (86%), Gaps = 2/371 (0%)

Query: 1   MLRSAIGRLATRRAYASAPK--SMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFI 58
           MLR ++     +R   +  K  ++ IGLIPGDGIGKEVIP+G+QVLE +  KHGL F+FI
Sbjct: 1   MLRRSVYNRQFQRTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFI 60

Query: 59  DLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLY 118
           DLQAGW TF +TGKALP +TV+ L+  C GALFGAVQSPTTKVEGYSSPIVALRKELGLY
Sbjct: 61  DLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY 120

Query: 119 ANVRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRR 178
           AN+RPVKSV+   ++ VDMVIVRENTEDLYIKLEKTY+D+ TGTRVA+ATKRISEVATRR
Sbjct: 121 ANIRPVKSVDTPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRR 180

Query: 179 IATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQ 238
           IA IALDIALQRLK NG+  LTVTHKSNVLSQSDGLFRE+CK+V+ESNK  Y  + YNEQ
Sbjct: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQ 240

Query: 239 IVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 298
           I+DSMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP IVIGEPCHG
Sbjct: 241 IIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCHG 300

Query: 299 SAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTT 358
           SAPDIAGKGISNPIATIRST LMLEFLGH++ AQDI  AVD+NLREDK+KTPDLGG ++T
Sbjct: 301 SAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNST 360

Query: 359 QQVVEDILSKL 369
             VV D++ +L
Sbjct: 361 SDVVNDVIRRL 371

>Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii ADL214C
          Length = 366

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/369 (75%), Positives = 316/369 (85%), Gaps = 3/369 (0%)

Query: 1   MLRSAIGRLATRRAYASAPKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDL 60
           MLR   G+L+TR    S  KS  IGLIPGDGIGKEVIP G++VLE +  K+G++F +IDL
Sbjct: 1   MLRVGRGQLSTRTYVTS--KSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDL 58

Query: 61  QAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYAN 120
           QAGW TF +TGKALP+ TV+ L+N CQGALFGAVQSPTTKV+GYSSPIVALRK LGLYAN
Sbjct: 59  QAGWQTFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYAN 118

Query: 121 VRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIA 180
           +RPVKSV+GT DRPVD+VI RENTEDLYIK E+TY+DK TG RVAEA KRISE ATR IA
Sbjct: 119 IRPVKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIA 178

Query: 181 TIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIV 240
            IAL+IALQRLK  GHATLTVTHKSNVLSQSDGLFREICK VY+SNK K+  V YNEQIV
Sbjct: 179 NIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNK-KFANVQYNEQIV 237

Query: 241 DSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSA 300
           DSMVYR+F+EP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPS NVGP IVIGEPCHGSA
Sbjct: 238 DSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHGSA 297

Query: 301 PDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQ 360
           PDI G+GI+NPIATIRS  L+LEFLG  + A+ I + VD N+RE+K+KTPDLGGNST +Q
Sbjct: 298 PDIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQ 357

Query: 361 VVEDILSKL 369
           V  DILS++
Sbjct: 358 VANDILSRI 366

>ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL094C
           (LYS12)
          Length = 367

 Score =  525 bits (1353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/369 (68%), Positives = 306/369 (82%), Gaps = 2/369 (0%)

Query: 1   MLRSAIGRLATRRAYASAPKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDL 60
           M RS+   L  +  YA++ K++ IGLIPGDGIGKEVIPAG++VLE +  KH + F +  L
Sbjct: 1   MHRSSATSLIHKATYATS-KTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHL 59

Query: 61  QAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYAN 120
            AGW TF ETG ALP  TV+ L+ +CQGALFGAVQSPTTKVEGYSSPIVALR++LGLYAN
Sbjct: 60  DAGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYAN 119

Query: 121 VRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIA 180
           +RPVKSV GT  +PVD+VIVRENTEDLY++ E+TYVD ATG RVAEA KRISE AT RIA
Sbjct: 120 IRPVKSVSGT-GQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIA 178

Query: 181 TIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIV 240
            I+L +ALQR +  G   LTVTHKSNVLSQ+DGLF+E+C++VYE+NK  YG + YNEQIV
Sbjct: 179 EISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIV 238

Query: 241 DSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSA 300
           DSMVYR+F+EP CFDVVVAPNLYGD+LSDGAAALVGSLG+VPS NVG  I+IGEPCHGSA
Sbjct: 239 DSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCHGSA 298

Query: 301 PDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQ 360
           PDIAG+GI+NPIATIRS  LML+FLG  + A DI +AV  NL++ +V +PDLGG +TTQ+
Sbjct: 299 PDIAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQE 358

Query: 361 VVEDILSKL 369
           V++DIL+++
Sbjct: 359 VLDDILARI 367

>ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL037C (IDH1)
          Length = 362

 Score =  190 bits (482), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 137/381 (35%), Positives = 202/381 (53%), Gaps = 34/381 (8%)

Query: 1   MLRSAIGRLATRRAYASAPKSMV---------IGLIPGDGIGKEVIPAGKQVLENLSGKH 51
           M R+ +  + T+R YA+  + ++         + LIPGDGIGKEV  +  Q+ E  +   
Sbjct: 1   MFRNTLSHI-TKRGYAAGREQLLPKKYGGRYTVTLIPGDGIGKEVTDSVVQIFE--AENV 57

Query: 52  GLNFDFIDLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVAL 111
            ++++ ++L A     +E  + + ++ V+ LK    G L G   +P  +  G+ S  VA 
Sbjct: 58  PVDWESVELSA----LEENHEGV-QKAVESLKRNKVG-LKGIWHTPADQT-GHGSLNVAF 110

Query: 112 RKELGLYANVRPVKSVEG--TKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATK 169
           RK+L ++ANV   KS  G  TK + VD+VI+RENTE  Y  LE   V       V E+ K
Sbjct: 111 RKQLDIFANVALFKSFPGVKTKLQDVDLVIIRENTEGEYSGLEHESVPG-----VVESLK 165

Query: 170 RISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDK 229
            +++  + RIA  A D AL+    N    +   HK+N++   DGLFR     V E    +
Sbjct: 166 IMTKAKSERIARFAFDFALK----NNRKAVCAVHKANIMKLGDGLFRNT---VSEIGAKE 218

Query: 230 YGQVAYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE 289
           Y +V  +  IVD+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP AN G E
Sbjct: 219 YPEVNVSSIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANFGRE 278

Query: 290 IVIGEP-CHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVK 348
             + EP C     DI G+ ++NP A I S+ LML  LG N+ A  I RA    + E K  
Sbjct: 279 YAVFEPGCRHVGLDIKGQDVANPTAMILSSTLMLRHLGLNEYADRISRATYETIAEGKRT 338

Query: 349 TPDLGGNSTTQQVVEDILSKL 369
           T D+GG +TT +    ++ KL
Sbjct: 339 TKDIGGTATTTEFTNAVIDKL 359

>TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {ON}
           Anc_2.278 YNL037C
          Length = 361

 Score =  186 bits (473), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 147/385 (38%), Positives = 197/385 (51%), Gaps = 43/385 (11%)

Query: 1   MLRSAIGRLATRRAYASA-------PKS----MVIGLIPGDGIGKEVIPAGKQVLE--NL 47
           MLRSA+G+    R +AS        PK      V+ LIPGDG+GKEV  +   + E  NL
Sbjct: 1   MLRSAVGK----RMFASVAAAEKVLPKKYGGRFVVTLIPGDGVGKEVTDSVVSIFEAENL 56

Query: 48  SGKHGLNFDFIDLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSP 107
                +++D +D+    G   E G    +  V  LK    G L G   +      G  S 
Sbjct: 57  P----IDWDRVDIS---GLDHEEG---VQAAVDSLKRNKIG-LKGIWHTSAADQAGKGSL 105

Query: 108 IVALRKELGLYANVRPVKSVEGTKDR--PVDMVIVRENTEDLYIKLEKTYVDKATGTRVA 165
            VALRKEL +YANV   KSV G K +   VD+V++RENTE  Y  LE   V       V 
Sbjct: 106 NVALRKELDIYANVALFKSVPGVKTKIPNVDLVVIRENTEGEYSGLEHESVPG-----VV 160

Query: 166 EATKRISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYES 225
           E+ K ++E  T RIA  A D A    K N HA +T  HK+N++   DGLFR +   V E 
Sbjct: 161 ESLKIMTEDKTERIARFAFDFAK---KYNRHA-VTAVHKANIMKLGDGLFRNVVTRVGEQ 216

Query: 226 NKDKYGQVAYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSAN 285
              +Y  V     IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN
Sbjct: 217 ---EYPDVKVGSIIVDNASMQTVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGAN 273

Query: 286 VGPEIVIGEP-CHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLRE 344
            G E  + EP       DI  K I+NP A I S  LML+ LG +  A  I  AV   + E
Sbjct: 274 YGREYAVFEPGSRHVGLDIKDKNIANPTAMILSASLMLDHLGLSTSATKISNAVHQVIAE 333

Query: 345 DKVKTPDLGGNSTTQQVVEDILSKL 369
            K  TPD+GG+++T +  + ++ KL
Sbjct: 334 GKSTTPDIGGSASTTEFTQAVIEKL 358

>Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C
           (IDH1) - alpha-4-beta-4 subunit of mitochondrial
           isocitrate dehydrogenase 1 [contig 7] FULL
          Length = 361

 Score =  185 bits (469), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 138/383 (36%), Positives = 195/383 (50%), Gaps = 39/383 (10%)

Query: 1   MLRSAIG----RLATRRAYASAPKSM----VIGLIPGDGIGKEVIPAGKQVLENLSGKHG 52
           MLRS +G     LAT  A    PK       + LIPGDG+GKEV  +   + E+      
Sbjct: 1   MLRSGLGVSKRSLATMAAEQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFESE----- 55

Query: 53  LNFDFIDLQAGWGTFQETGKALPE---QTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIV 109
                 ++   W T + +G    E   + V+ LK    G L G   +P+ +  G+ S  V
Sbjct: 56  ------NIPIDWETVEISGLDNQEGVQKAVESLKRNKVG-LKGIWHTPSDQT-GHGSLNV 107

Query: 110 ALRKELGLYANVRPVKSVEGTKDRP--VDMVIVRENTEDLYIKLEKTYVDKATGTRVAEA 167
           ALRK+L ++ANV   KSV G   R   VDMV++RENTE  Y  LE   V       V E+
Sbjct: 108 ALRKQLDIFANVALFKSVPGVPSRHSNVDMVVIRENTEGEYSGLEHESVPG-----VVES 162

Query: 168 TKRISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNK 227
            K +++  + RI   A D A++    N   ++   HK+N++   DGLFR    +V     
Sbjct: 163 LKIMTKAKSERIGRFAFDFAVK----NNRKSVCAVHKANIMKLGDGLFRNCINEV---GA 215

Query: 228 DKYGQVAYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVG 287
            +Y ++     IVD+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP AN G
Sbjct: 216 KEYPEIDVKNIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANFG 275

Query: 288 PEIVIGEP-CHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDK 346
            E  + EP       DI G+ ++NP A I S+ LML  LG N  A  I +A    + E K
Sbjct: 276 REYAVFEPGSRHVGLDIKGQNVANPTAMILSSSLMLRHLGLNAYADRISKATYDVIAEAK 335

Query: 347 VKTPDLGGNSTTQQVVEDILSKL 369
             T D+GG+++T +  E I+SKL
Sbjct: 336 TTTQDIGGSASTTEFTEAIISKL 358

>NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473
          Length = 422

 Score =  184 bits (468), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 135/390 (34%), Positives = 200/390 (51%), Gaps = 42/390 (10%)

Query: 1   MLRSAIGRLATRR-----------AYASAPK----SMVIGLIPGDGIGKEVIPAGKQVLE 45
           M RS+I R  TRR            Y   P        +  I GDGIG E+  + KQ+  
Sbjct: 54  MFRSSILRTTTRRLLSVKHQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFS 113

Query: 46  NLSGKHGLNFDFIDLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYS 105
             + K  + ++  D+      F +    +PE  VQ + N+   AL G + +P  K  G+ 
Sbjct: 114 --AAKVPIEWETCDVTP---LFIDGLTTIPEPAVQSI-NKNLVALKGPLATPIGK--GHR 165

Query: 106 SPIVALRKELGLYANVRPVKSVEGTKDR--PVDMVIVRENTEDLYIKLEKTYVDKATGTR 163
           S  + LRK  GL+ANVRP +SV+G K     VD+V++RENTE  Y  +E           
Sbjct: 166 SLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDLVLIRENTEGEYSGIEHVVTPG----- 220

Query: 164 VAEATKRISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVY 223
           V ++ K I+  A+ R+    +  A +  +  G   L V HKS +   SDGLF  + K++ 
Sbjct: 221 VVQSIKLITREASERV----IRYAFEYCRAIGRPRLVVVHKSTIQRLSDGLFVNVAKEL- 275

Query: 224 ESNKDKYGQVAYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAAL-VGSLGV 280
                +Y  + +  +++D+ V ++   P  +   V V PNLYGDILSD  + L  GSLG+
Sbjct: 276 ---SKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGL 332

Query: 281 VPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDA 340
            PS N+G EI I E  HGSAPDIAGK ++NP A + S+ +ML  +G +K A  I  AV +
Sbjct: 333 TPSGNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSSVMMLNHMGLSKHADQIENAVLS 392

Query: 341 NLRE-DKVKTPDLGGNSTTQQVVEDILSKL 369
            +    + +T DL G +TT    + ++ KL
Sbjct: 393 TIASGPESRTGDLAGTATTSTFTDAVIKKL 422

>TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {ON}
           Anc_2.278 YNL037C
          Length = 360

 Score =  182 bits (463), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 138/385 (35%), Positives = 198/385 (51%), Gaps = 44/385 (11%)

Query: 1   MLRSAIGRLATRRAYASAPKS-----------MVIGLIPGDGIGKEVIPAGKQVLENLSG 49
           MLR  +    ++R+ AS  K+             + LIPGDGIGKEV  +  ++      
Sbjct: 1   MLRQVV----SKRSIASFTKNHNIVPKKYGGRYTVTLIPGDGIGKEVTDSVVKIF----A 52

Query: 50  KHGLNFDF--IDLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSP 107
             GL  D+  ID+  G     E  KA     V+ LK    G     +   +    GY S 
Sbjct: 53  SQGLPIDWERIDV-PGMSNENEVKKA-----VESLKRNKIG--LKGIWHTSADQTGYGSL 104

Query: 108 IVALRKELGLYANVRPVKSVEGTKDR--PVDMVIVRENTEDLYIKLEKTYVDKATGTRVA 165
            VALRK+L ++ANV   KS++G K +   VD+V++RENTE  Y  LE   V       V 
Sbjct: 105 NVALRKQLDIFANVAIFKSLKGVKTKIPDVDLVVIRENTEGEYSGLEHESVPG-----VV 159

Query: 166 EATKRISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYES 225
           E+ K I++  T RIA  A D AL+    N  +T+T  HK+N++  SDGLF+    +V E 
Sbjct: 160 ESLKIITKPKTERIARFAFDFALE----NNRSTVTAVHKANIMKLSDGLFKNTVAEVGEK 215

Query: 226 NKDKYGQVAYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSAN 285
              +Y  +  N  IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G++P AN
Sbjct: 216 ---EYPDIKVNTIIVDNASMQAVAKPHQFDVMVTPSMYGTILGNIGAALIGGPGLIPGAN 272

Query: 286 VGPEIVIGEP-CHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLRE 344
            G E  + EP       DI  + I+NP A I S  LML  LG  + ++ I  AV A + E
Sbjct: 273 YGREHAVFEPGSRHVGLDIENQNIANPTAMILSATLMLNQLGLREESKRISNAVYAVIEE 332

Query: 345 DKVKTPDLGGNSTTQQVVEDILSKL 369
            K  T D+GGN++T +  + ++ KL
Sbjct: 333 GKTTTKDIGGNASTTEFTDAVIDKL 357

>KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON}
           uniprot|O94229 Kluyveromyces lactis KLLA0F04103g IDH1
           Isocitrate dehydrogenase subunit 1
          Length = 361

 Score =  181 bits (458), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 134/383 (34%), Positives = 191/383 (49%), Gaps = 39/383 (10%)

Query: 1   MLRSAIG----RLATRRAYASAPKSM----VIGLIPGDGIGKEVIPAGKQVLENLSGKHG 52
           MLR  I       AT  A    PK       + LIPGDG+GKEV  +  ++ EN      
Sbjct: 1   MLRQGIAAQKKSFATLAAEQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVKIFENE----- 55

Query: 53  LNFDFIDLQAGWGTFQETGKALPE---QTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIV 109
                 ++   W T   +G    E   + V+ LK    G L G   +P  +  G+ S  V
Sbjct: 56  ------NIPIDWETIDISGLENTENVQRAVESLKRNKVG-LKGIWHTPADQT-GHGSLNV 107

Query: 110 ALRKELGLYANVRPVKSVEGTKDR--PVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEA 167
           ALRK+L ++ANV   KS+ G K R   +DMVI+RENTE  Y  LE   V       V E+
Sbjct: 108 ALRKQLDIFANVALFKSIPGVKTRLNNIDMVIIRENTEGEYSGLEHESVPG-----VVES 162

Query: 168 TKRISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNK 227
            K ++   + RIA  A D AL+    N   ++   HK+N++   DGLFR    ++     
Sbjct: 163 LKIMTRAKSERIARFAFDFALK----NNRKSVCAVHKANIMKLGDGLFRNTVNEI---GA 215

Query: 228 DKYGQVAYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVG 287
           ++Y ++     IVD+   +   +P  FDV+V PNLYG IL +  +AL+G  G+VP AN G
Sbjct: 216 NEYPELDVKNIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGSALIGGPGLVPGANFG 275

Query: 288 PEIVIGEP-CHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDK 346
            E  + EP       DI G+ ++NP A I S+ LML  LG N  A  I +A    + E K
Sbjct: 276 REYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLMLRHLGLNAYADRISKATYDVISEGK 335

Query: 347 VKTPDLGGNSTTQQVVEDILSKL 369
             T D+GG+++T +    ++ KL
Sbjct: 336 STTRDIGGSASTSEFTNAVIEKL 358

>Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar to
           Ashbya gossypii ADL223W
          Length = 362

 Score =  180 bits (456), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 135/380 (35%), Positives = 201/380 (52%), Gaps = 32/380 (8%)

Query: 1   MLRSAIGRLATRR-AYASA---PKSM----VIGLIPGDGIGKEVIPAGKQVLENLSGKHG 52
           MLR+   +++ RR A AS    PK       + LIPGDG+GKEV  +   + E  +    
Sbjct: 1   MLRNTFVQISKRRFALASGQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVNIFE--AENVP 58

Query: 53  LNFDFIDLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALR 112
           ++++ ++L       +E  + + ++ V+ LK    G L G   +P  +  G+ S  VA R
Sbjct: 59  IDWESVELSG----LEENMEGV-QKAVESLKRNKVG-LKGIWSTPADQT-GHGSLNVAFR 111

Query: 113 KELGLYANVRPVKSVEG--TKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKR 170
           K+L ++ANV   KS  G  TK + VD+VI+RENTE  Y  LE   V       V E+ K 
Sbjct: 112 KQLDIFANVALFKSFPGVKTKLKDVDLVIIRENTEGEYSGLEHESVPG-----VVESLKI 166

Query: 171 ISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKY 230
           +++  + RIA  A D AL+    N   ++   HK+N++   DGLFR    ++      +Y
Sbjct: 167 MTKAKSERIARFAFDFALK----NNRRSVCAVHKANIMKLGDGLFRNTVNEI---GAKEY 219

Query: 231 GQVAYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEI 290
            ++     IVD+   +   +P  FDV+V PNLYG IL +  AAL+GS G+VP AN G E 
Sbjct: 220 PELEVKSIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNVGAALIGSPGLVPGANFGREY 279

Query: 291 VIGEP-CHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKT 349
            + EP       DI G+ ++NP A I S+ LML  LG N  A  I +A    + E K  T
Sbjct: 280 AVFEPGSRHVGLDIKGQDVANPTAMILSSTLMLRHLGLNDYADRISKATYEVIAEGKHTT 339

Query: 350 PDLGGNSTTQQVVEDILSKL 369
            D+GG+++T Q  + I+ KL
Sbjct: 340 KDIGGHASTTQFTKAIVDKL 359

>SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037C IDH1 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 361

 Score =  177 bits (449), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 127/352 (36%), Positives = 182/352 (51%), Gaps = 31/352 (8%)

Query: 24  IGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDLQAGWGTFQETGKALPE---QTVQ 80
           + LIPGDG+GKEV  +   +           F+  ++   W T   TG    E   + V+
Sbjct: 32  VTLIPGDGVGKEVTDSVVSI-----------FEAENVPIDWETINITGVDSEEGVQKAVE 80

Query: 81  VLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYANVRPVKSVEGTKDR--PVDMV 138
            LK    G L G   +P  +  G+ S  VA RK+L ++ANV   K+V G K +   +D+V
Sbjct: 81  SLKRNKIG-LKGIWHTPADQT-GHGSLNVAFRKQLDIFANVALFKNVPGVKTKLSNIDLV 138

Query: 139 IVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATIALDIALQRLKTNGHAT 198
           ++RENTE  Y  LE   V       V E+ K I++  + RIA  A D AL+    N   +
Sbjct: 139 VIRENTEGEYSGLEHESVPG-----VVESLKIITKAKSERIARFAFDFALK----NNRKS 189

Query: 199 LTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDSMVYRMFREPECFDVVV 258
           +   HK+N++   DGLFR    +V  S   +Y ++     IVD+   +   +P  FDV+V
Sbjct: 190 VCAVHKANIMKLGDGLFRNTVNEVGAS---EYPEIDVKNIIVDNASMQAVAKPHQFDVLV 246

Query: 259 APNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIRS 317
            PNLYG IL +  AAL+G  G+VP AN G E  + EP       DI GK ++NP A I S
Sbjct: 247 TPNLYGSILGNIGAALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGKDLANPTAMILS 306

Query: 318 TGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQVVEDILSKL 369
           + LML  LG N  A  I +A    + E K  T D+GG+S+T +  + ++ KL
Sbjct: 307 STLMLRHLGLNGYADRISKATYDVIAEGKHTTKDIGGSSSTTEFTKSVIDKL 358

>NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {ON}
           Anc_5.473
          Length = 369

 Score =  177 bits (448), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 132/390 (33%), Positives = 200/390 (51%), Gaps = 42/390 (10%)

Query: 1   MLRSAIGRLATRR-----------AYASAPK----SMVIGLIPGDGIGKEVIPAGKQVLE 45
           M R+ I R  TRR            +   P        +  I GDGIG E+  + KQ+ +
Sbjct: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60

Query: 46  NLSGKHGLNFDFIDLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYS 105
             + K  ++++  D+      F      +PE  VQ + N+   AL G + +P  K  G+ 
Sbjct: 61  --AAKVPIDWEPCDVSP---LFINGLTTIPEPAVQSI-NKNLVALKGPLATPIGK--GHR 112

Query: 106 SPIVALRKELGLYANVRPVKSVEGTKD--RPVDMVIVRENTEDLYIKLEKTYVDKATGTR 163
           S  + LRK  GL+ANVRP KS+EG K     VD+VI+RENTE  Y  +E           
Sbjct: 113 SLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPG----- 167

Query: 164 VAEATKRISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVY 223
           V ++ K I+  A+ R+   A + A    +  G   + V HKS +   +DGLF ++ K++ 
Sbjct: 168 VVQSIKLITRDASERVIRYAYEYA----RAIGRPRVIVVHKSTIQRLADGLFVDVAKELS 223

Query: 224 ESNKDKYGQVAYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAAL-VGSLGV 280
           +    +Y  +    +++D+ V  +   P  +   V V PNLYGDILSD  + L  GSLG+
Sbjct: 224 Q----EYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDILSDLNSGLSAGSLGL 279

Query: 281 VPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDA 340
            PSAN+G E+ I E  HGSAPDIAG+  +NP A + S+ +ML  +G N  A  I +AV +
Sbjct: 280 TPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLS 339

Query: 341 NLRE-DKVKTPDLGGNSTTQQVVEDILSKL 369
            +    + +T DL G +TT    + ++ +L
Sbjct: 340 TIASGPEGRTGDLAGKATTSSFTDAVIGRL 369

>Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}
           similar to Ashbya gossypii AFR137C
          Length = 370

 Score =  176 bits (446), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 123/352 (34%), Positives = 188/352 (53%), Gaps = 27/352 (7%)

Query: 24  IGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDLQAGWGTFQETGKALPEQTVQVLK 83
           +  I GDGIG E+  + K +    + K  + +++ D+      F      +P+  VQ + 
Sbjct: 40  VSFIEGDGIGPEISQSVKDIFS--AAKVPVEWEYCDVTP---IFINGLTTIPDPAVQSI- 93

Query: 84  NQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYANVRPVKSVEGTKD--RPVDMVIVR 141
           N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+EG K     VD+V++R
Sbjct: 94  NKNLVALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIR 151

Query: 142 ENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATIALDIALQRLKTNGHATLTV 201
           ENTE  Y  +E           V ++ K I+  A+ R+   A + A    +  G   + V
Sbjct: 152 ENTEGEYSGIEHV-----VSPGVVQSIKLITRDASERVIRYAFEYA----RAVGRPKVVV 202

Query: 202 THKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDSMVYRMFREPECFD--VVVA 259
            HKS +   +DGLF  + ++V      +Y  +    +++D+ V  +  +PE +   V V 
Sbjct: 203 VHKSTIQRLADGLFVNVAQEV----GKEYPDIELQPELIDNTVLNVVSKPEKYSDSVAVC 258

Query: 260 PNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRST 318
           PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDIAG+  +NP A + S+
Sbjct: 259 PNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPDIAGQNCANPTALLLSS 318

Query: 319 GLMLEFLGHNKPAQDIYRAVDANLREDKV-KTPDLGGNSTTQQVVEDILSKL 369
            +ML  +G ++ A  I  AV A +  DK  +T DL G +TT    + ++ +L
Sbjct: 319 VMMLNHMGLHEHADQIESAVLATVASDKKNRTADLAGTATTSSFTKAVIERL 370

>Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  176 bits (445), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 129/391 (32%), Positives = 198/391 (50%), Gaps = 44/391 (11%)

Query: 1   MLRSAIGRLATRRAYASAPKSMV---------------IGLIPGDGIGKEVIPAGKQVLE 45
           MLR+   R  +RR  ++  +  +               +  I GDGIG E+  + K++  
Sbjct: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 46  NLSGKHGLNFDFIDLQAGWGTFQETGKALPEQTVQ-VLKNQCQGALFGAVQSPTTKVEGY 104
             +    +N++F D+      F      +P+  VQ + KN    AL G + +P  K  G+
Sbjct: 61  --AADVPINWEFCDVNP---IFVNGLTTIPDPAVQSITKNLV--ALKGPLATPIGK--GH 111

Query: 105 SSPIVALRKELGLYANVRPVKSVEGTKD--RPVDMVIVRENTEDLYIKLEKTYVDKATGT 162
            S  + LRK  GL+ANVRP KS+EG K     VD+V++RENTE  Y  +E          
Sbjct: 112 RSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPG---- 167

Query: 163 RVAEATKRISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDV 222
            V ++ K I+  A+ R+   A + A    +  G   + V HKS +   +DGLF  + K++
Sbjct: 168 -VVQSIKLITREASERVIRYAFEYA----RAIGRPRIIVVHKSTIQRLADGLFVNVAKEL 222

Query: 223 YESNKDKYGQVAYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAAL-VGSLG 279
                 +Y  + +  +++D+ V  +   P  +   V V PNLYGDILSD  + L  GSLG
Sbjct: 223 ----SKEYPDITFETELIDNKVLNVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLG 278

Query: 280 VVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVD 339
           + PSAN+G ++ I E  HGSAPDIAGK  +NP A + S+ +ML  +G    A  I  AV 
Sbjct: 279 LTPSANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVL 338

Query: 340 ANLRE-DKVKTPDLGGNSTTQQVVEDILSKL 369
           + +    + +T DL G +TT    E ++ +L
Sbjct: 339 STIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037C
           (REAL)
          Length = 360

 Score =  175 bits (443), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 122/351 (34%), Positives = 188/351 (53%), Gaps = 25/351 (7%)

Query: 22  MVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDLQAGWGTFQETGKALPEQTVQV 81
             + LIPGDG+GKE+  + K + E  + K  ++++ ++++      Q   K    + V+ 
Sbjct: 29  FTVTLIPGDGVGKEITDSVKTIFE--AEKIPVDWETVNIK------QTDHKEGVYEAVES 80

Query: 82  LKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYANVRPVKSVEGTKDR--PVDMVI 139
           LK    G L G   +P  +  G+ S  VALRK+L +YANV   KS++G K R   +D+++
Sbjct: 81  LKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIV 138

Query: 140 VRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATIALDIALQRLKTNGHATL 199
           +RENTE  +  LE   V       V E+ K ++   T RIA  A D A    K      +
Sbjct: 139 IRENTEGEFSGLEHESVPG-----VVESLKIMTRPKTERIARFAFDFA----KKYNRKAV 189

Query: 200 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDSMVYRMFREPECFDVVVA 259
           T  HK+N++   DGLFR I  ++    + +Y  +  +  IVD+   +   +P  FDV+V 
Sbjct: 190 TAVHKANIMKLGDGLFRNIITEI---GQKEYPDIDVSSIIVDNASMQAVAKPHQFDVLVT 246

Query: 260 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIRST 318
           P++YG IL +  AAL+G  G+V  AN G +  + EP       DI G+ ++NP A I S+
Sbjct: 247 PSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSS 306

Query: 319 GLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQVVEDILSKL 369
            LML  LG N+ A  I +AV   + E K  T D+GG+S+T     +I++KL
Sbjct: 307 VLMLNHLGLNEYATRISKAVHETIAEGKHTTKDIGGSSSTTDFTNEIINKL 357

>KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|P28834 Saccharomyces cerevisiae
           YNL037C IDH1 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  174 bits (441), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 131/384 (34%), Positives = 195/384 (50%), Gaps = 42/384 (10%)

Query: 1   MLRSAIGRLATRRAYASAPKSMV---------IGLIPGDGIGKEVIPAGKQVLENLSGKH 51
           MLR+  G   ++R+ A+  + ++         + LIPGDG+GKEV  +   + E+     
Sbjct: 1   MLRNGFG--ISKRSLATVAEQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFESE---- 54

Query: 52  GLNFDFIDLQAGWGTFQETGKALPE---QTVQVLKNQCQGALFGAVQSPTTKVEGYSSPI 108
                  ++   W T + +G    E   + V  LK    G L G   +P+ +  G+ S  
Sbjct: 55  -------NVPIDWETVEISGLDNEEGVQKAVDSLKRNKVG-LKGIWHTPSDQT-GHGSLN 105

Query: 109 VALRKELGLYANVRPVKSVEGTKDRP--VDMVIVRENTEDLYIKLEKTYVDKATGTRVAE 166
           VALRK+L ++ANV   K+V G   R   VD+V++RENTE  Y  LE   V       V E
Sbjct: 106 VALRKQLDIFANVALFKTVPGVPSRHSNVDLVVIRENTEGEYSGLEHESVPG-----VVE 160

Query: 167 ATKRISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESN 226
           + K +++  + RI   A D AL+    N   ++   HK+N++   DGLFR  C  + E  
Sbjct: 161 SLKIMTKAKSDRIGRFAFDFALK----NNRKSVCAVHKANIMKLGDGLFRN-C--INEIG 213

Query: 227 KDKYGQVAYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANV 286
             +Y ++     IVD+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP AN 
Sbjct: 214 AKEYPEIEVKNIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANF 273

Query: 287 GPEIVIGEP-CHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLRED 345
           G E  + EP       DI G+ ++NP A I S+ LML  LG N  A  I +A    + E 
Sbjct: 274 GREFAVFEPGSRHVGLDIKGQNVANPTAMILSSALMLRHLGLNSYADRISKATYDVIAEA 333

Query: 346 KVKTPDLGGNSTTQQVVEDILSKL 369
           K  T D+GG+++T    + I+ KL
Sbjct: 334 KNTTKDIGGSASTTDFTQAIIEKL 357

>YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON}
           IDH1Subunit of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  174 bits (441), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 131/381 (34%), Positives = 201/381 (52%), Gaps = 36/381 (9%)

Query: 1   MLRSAIGR--LATR-RAYASAPKS----MVIGLIPGDGIGKEVIPAGKQVLE--NLSGKH 51
           ML   I +  LAT  +A  + PK       + LIPGDG+GKE+  + + + E  N+    
Sbjct: 1   MLNRTIAKRTLATAAQAERTLPKKYGGRFTVTLIPGDGVGKEITDSVRTIFEAENIP--- 57

Query: 52  GLNFDFIDLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVAL 111
            ++++ I+++      Q   K    + V+ LK    G L G   +P  +  G+ S  VAL
Sbjct: 58  -IDWETINIK------QTDHKEGVYEAVESLKRNKIG-LKGLWHTPADQT-GHGSLNVAL 108

Query: 112 RKELGLYANVRPVKSVEGTKDR--PVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATK 169
           RK+L +YANV   KS++G K R   +D++++RENTE  +  LE   V       V E+ K
Sbjct: 109 RKQLDIYANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPG-----VVESLK 163

Query: 170 RISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDK 229
            ++   T RIA  A D A    K     ++T  HK+N++   DGLFR I  ++    + +
Sbjct: 164 VMTRPKTERIARFAFDFA----KKYNRKSVTAVHKANIMKLGDGLFRNIITEI---GQKE 216

Query: 230 YGQVAYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE 289
           Y  +  +  IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G +
Sbjct: 217 YPDIDVSSIIVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRD 276

Query: 290 IVIGEP-CHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVK 348
             + EP       DI G+ ++NP A I S+ LML  LG N+ A  I +AV   + E K  
Sbjct: 277 YAVFEPGSRHVGLDIKGQNVANPTAMILSSTLMLNHLGLNEYATRISKAVHETIAEGKHT 336

Query: 349 TPDLGGNSTTQQVVEDILSKL 369
           T D+GG+S+T     +I++KL
Sbjct: 337 TRDIGGSSSTTDFTNEIINKL 357

>KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  174 bits (441), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 126/352 (35%), Positives = 189/352 (53%), Gaps = 27/352 (7%)

Query: 24  IGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDLQAGWGTFQETGKALPEQTVQVLK 83
           +  I GDGIG E+  + K + +  + +  +N++F D+      F      +P+  V  + 
Sbjct: 43  VSFIEGDGIGPEISQSVKDIFK--AAEVPINWEFCDVTP---IFVNGLTTIPDPAVASI- 96

Query: 84  NQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYANVRPVKSVEGTKD--RPVDMVIVR 141
           N+   AL G + +P  K  G+ S  + LRK   L+ANVRP KS+EG K     VD+V++R
Sbjct: 97  NKNLIALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIR 154

Query: 142 ENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATIALDIALQRLKTNGHATLTV 201
           ENTE  Y  +E      A G  V ++ K I+  A+ R+   A + A    K  G   + V
Sbjct: 155 ENTEGEYSGIEHVV---APG--VVQSIKLITRDASERVIRYAFEYA----KAIGRPRVVV 205

Query: 202 THKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDSMVYRMFREPECFD--VVVA 259
            HKS +   +DGLF  + K++ +    +Y ++    +++D+ V  +   P  +   V V 
Sbjct: 206 VHKSTIQRLADGLFVNVAKELSK----EYPEIKLETELIDNTVLNVVSNPAGYTDAVSVC 261

Query: 260 PNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRST 318
           PNLYGDILSD  + L  GSLG+ PSAN+G EI I E  HGSAPDIAG+  +NP A + S+
Sbjct: 262 PNLYGDILSDLNSGLSAGSLGLTPSANIGNEISIFEAVHGSAPDIAGQNKANPTALLLSS 321

Query: 319 GLMLEFLGHNKPAQDIYRAVDANL-REDKVKTPDLGGNSTTQQVVEDILSKL 369
            +ML  +G    A  I RAV   +    K +T DLGG++TT    + ++  L
Sbjct: 322 VMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373

>KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  174 bits (441), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 122/352 (34%), Positives = 192/352 (54%), Gaps = 27/352 (7%)

Query: 24  IGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDLQAGWGTFQETGKALPEQTVQVLK 83
           +  I GDG+G E+  + K +    + K  + ++  D+      F      +P+  V  + 
Sbjct: 38  VSFIEGDGVGPEISKSVKAIFS--AAKVPIEWESCDVSP---IFVNGLTTIPDPAVASI- 91

Query: 84  NQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYANVRPVKSVEGTKD--RPVDMVIVR 141
           N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+EG K     V++V++R
Sbjct: 92  NKNLIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLIR 149

Query: 142 ENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATIALDIALQRLKTNGHATLTV 201
           ENTE  Y  +E      A G  V ++ K I++ A+ R+   A + A    +    + + V
Sbjct: 150 ENTEGEYSGIEHVV---APG--VVQSIKLITQDASERVIRYAFEYA----RAVDRSKVLV 200

Query: 202 THKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDSMVYRMFREPECFD--VVVA 259
            HKS +   +DGLF ++ K +      +Y  +    +++D+ V +  + PE +D  VVV 
Sbjct: 201 VHKSTIQRLADGLFVDVAKKL----SSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVVC 256

Query: 260 PNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRST 318
           PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDIAG+  +NP A + S+
Sbjct: 257 PNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLSS 316

Query: 319 GLMLEFLGHNKPAQDIYRAVDANLRED-KVKTPDLGGNSTTQQVVEDILSKL 369
            +ML  +G  + A  I +AV   +  D K +T DLGG+++T    + ++ +L
Sbjct: 317 VMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368

>Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037C
           (REAL)
          Length = 361

 Score =  174 bits (440), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 129/379 (34%), Positives = 202/379 (53%), Gaps = 32/379 (8%)

Query: 1   MLRSAIGR--LATR-RAYASAPKS----MVIGLIPGDGIGKEVIPAGKQVLENLSGKHGL 53
           ML   I +  LAT  +A  + PK       + LIPGDG+GKE+  + + + E  + +  +
Sbjct: 1   MLNRTIAKRTLATAAQAERTLPKKYGGRFTVTLIPGDGVGKEITDSVRTIFE--AERIPV 58

Query: 54  NFDFIDLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRK 113
           +++ I+++      Q   K    + V+ LK    G L G   +P  +  G+ S  VALRK
Sbjct: 59  DWETINIK------QTDHKEGVYEAVESLKRNKIG-LKGLWHTPADQT-GHGSLNVALRK 110

Query: 114 ELGLYANVRPVKSVEGTKDR--PVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRI 171
           +L +YANV   KS++G K R   +D++++RENTE  +  LE   V       V E+ K +
Sbjct: 111 QLDIYANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPG-----VVESLKVM 165

Query: 172 SEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYG 231
           ++  T RIA  A D A    K      +T  HK+N++   DGLFR I  ++ ++   +Y 
Sbjct: 166 TKPKTERIARFAFDFA----KKYNRKAVTAVHKANIMKLGDGLFRNIITEIGQT---EYP 218

Query: 232 QVAYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIV 291
            +  +  IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G +  
Sbjct: 219 DIDVSSIIVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYA 278

Query: 292 IGEP-CHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTP 350
           + EP       DI G+ ++NP A I S+ LML  LG N+ A  I +AV   + E K  T 
Sbjct: 279 VFEPGSRHVGLDIKGQNVANPTAMILSSVLMLNHLGLNENATRISKAVHETIAEGKHTTR 338

Query: 351 DLGGNSTTQQVVEDILSKL 369
           D+GG+S+T     ++++KL
Sbjct: 339 DIGGSSSTTDFTNEVINKL 357

>NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa]
           {ON} Anc_2.278
          Length = 359

 Score =  173 bits (439), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 123/353 (34%), Positives = 188/353 (53%), Gaps = 30/353 (8%)

Query: 22  MVIGLIPGDGIGKEVIPAGKQVL--ENLSGKHGLNFDFIDLQAGWGTFQETGKALPEQTV 79
           M + L+PGDG+GKE+  +   +   EN+     ++++ +D+       Q   +      V
Sbjct: 29  MTVTLLPGDGVGKEITDSVVSIFQAENVP----IDWETVDIS------QLDHEDGVNAAV 78

Query: 80  QVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYANVRPVKSVEGTKDR--PVDM 137
           + LK    G L G   +   +V G+ S  VA RK+L +YANV   KS+ G K +   VD+
Sbjct: 79  ESLKRNKIG-LKGIWHTSADQV-GHGSLNVAFRKQLDIYANVAFCKSIPGVKTKIPNVDL 136

Query: 138 VIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATIALDIALQRLKTNGHA 197
           VI+RENTE  Y  LE   V       V E+ K +++V + RIA  A D A++    +   
Sbjct: 137 VIIRENTEGEYSGLEHESVPG-----VVESLKIVTKVNSERIAKFAFDFAMR----HDRK 187

Query: 198 TLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDSMVYRMFREPECFDVV 257
            +T  HK+N++  SDGLFR     V E+    Y Q+  +  IVD+   +   +P  FDV+
Sbjct: 188 MVTAVHKANIMKLSDGLFRNTVARVGEA----YPQIKNDSIIVDNASMQAVAKPHQFDVM 243

Query: 258 VAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIR 316
           V P++YG IL +  AAL+G  G+VP  N G E  + EP       DI G+ ++NP A I 
Sbjct: 244 VTPSMYGTILGNIGAALIGGPGLVPGVNYGREYAVFEPGSRHVGLDIKGQNVANPTAMIL 303

Query: 317 STGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQVVEDILSKL 369
           S+ L+L+ LG N  A  I +AV   ++E    T D+GGN++T +  + ++ KL
Sbjct: 304 SSTLLLQHLGLNDTASRISKAVYDVIKEGNATTKDIGGNASTTEFTKAVIDKL 356

>Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  172 bits (437), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 129/390 (33%), Positives = 197/390 (50%), Gaps = 42/390 (10%)

Query: 1   MLRSAIGRLATRRAYASAPKSMV---------------IGLIPGDGIGKEVIPAGKQVLE 45
           MLRS + R  +RR  A+  +  +               +  I GDGIG E+  + K++  
Sbjct: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60

Query: 46  NLSGKHGLNFDFIDLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYS 105
             +    + ++  D+      F      +P+  VQ + N    AL G + +P  K  G+ 
Sbjct: 61  --AANVPIEWESCDVNP---IFVNGLTTIPDAAVQSITNNLI-ALKGPLATPIGK--GHR 112

Query: 106 SPIVALRKELGLYANVRPVKSVEGTKD--RPVDMVIVRENTEDLYIKLEKTYVDKATGTR 163
           S  + LRK  GL+ANVRP KSVEG K     VD+V++RENTE  Y  +E           
Sbjct: 113 SLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPG----- 167

Query: 164 VAEATKRISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVY 223
           V ++ K I+  A+ R+   A + A    +  G   + V HKS +   +DGLF  + K++ 
Sbjct: 168 VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAKELS 223

Query: 224 ESNKDKYGQVAYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAAL-VGSLGV 280
           +    +Y  +    +++D+ V ++   P  +   V V PNLYGDILSD  + L  GSLG+
Sbjct: 224 K----EYPDIILETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGL 279

Query: 281 VPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDA 340
            PSAN+G +I I E  HGSAPDIAG+  +NP A + S+ +ML  +G    A  I  AV +
Sbjct: 280 TPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLS 339

Query: 341 NLRE-DKVKTPDLGGNSTTQQVVEDILSKL 369
            +    + +T DL G +TT    E ++ +L
Sbjct: 340 TIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  172 bits (437), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 130/391 (33%), Positives = 197/391 (50%), Gaps = 44/391 (11%)

Query: 1   MLRSAIGRLATRRAYASAPKSMV---------------IGLIPGDGIGKEVIPAGKQVLE 45
           MLR+   R  +RR  A+  +  +               +  I GDGIG E+  + K++  
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 46  NLSGKHGLNFDFIDLQAGWGTFQETGKALPEQTVQ-VLKNQCQGALFGAVQSPTTKVEGY 104
             +    + ++F D+      F      +P+  VQ + KN    AL G + +P  K  G+
Sbjct: 61  --AANVPIEWEFCDVNP---IFVNGLTTIPDPAVQSITKNLV--ALKGPLATPIGK--GH 111

Query: 105 SSPIVALRKELGLYANVRPVKSVEGTKD--RPVDMVIVRENTEDLYIKLEKTYVDKATGT 162
            S  + LRK  GL+ANVRP KSVEG K     VD+V++RENTE  Y  +E          
Sbjct: 112 RSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPG---- 167

Query: 163 RVAEATKRISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDV 222
            V ++ K I+  A+ R+   A + A    +  G   + V HKS +   +DGLF  + K++
Sbjct: 168 -VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAKEL 222

Query: 223 YESNKDKYGQVAYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAAL-VGSLG 279
                 +Y  +    +++D+ V ++   P  +   V V PNLYGDILSD  + L  GSLG
Sbjct: 223 ----SKEYPDITLETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLG 278

Query: 280 VVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVD 339
           + PSAN+G +I I E  HGSAPDIAG+  +NP A + S+ +ML  +G    A  I  AV 
Sbjct: 279 LTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNYADQIQNAVL 338

Query: 340 ANLRE-DKVKTPDLGGNSTTQQVVEDILSKL 369
           + +    + +T DL G +TT    E ++ +L
Sbjct: 339 STIASGPENRTGDLAGAATTSSFTEAVIKRL 369

>TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score =  172 bits (435), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 126/351 (35%), Positives = 183/351 (52%), Gaps = 29/351 (8%)

Query: 24  IGLIPGDGIGKEVIPAGKQVL--ENLSGKHGLNFDFIDLQAGWGTFQETGKALPEQTVQV 81
           + LIPGDG+GKEV  +   +   ENL     ++++ +D+    G   E G    E  V  
Sbjct: 36  VTLIPGDGVGKEVTDSVVSIFNAENLP----IDWERVDIS---GLDHEEG---VEAAVNS 85

Query: 82  LKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYANVRPVKSVEGTKDR--PVDMVI 139
           LK    G     +   +     + S  VALRK+L +YANV   K++ G K R   VD+VI
Sbjct: 86  LKRNKIG--LKGIWHTSAGQSDHGSLNVALRKQLDIYANVAHFKTLPGVKTRIPDVDLVI 143

Query: 140 VRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATIALDIALQRLKTNGHATL 199
           +RENTE  Y  LE   V       V E+ K I++  + RIA  A D A    K      +
Sbjct: 144 IRENTEGEYSGLEHESVPG-----VVESLKIITKEKSERIARFAFDFA----KRFDRKLV 194

Query: 200 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDSMVYRMFREPECFDVVVA 259
           T  HK+N++   DGLFR     + E+   +Y  +  +  IVD+   +   +P  FDV+V 
Sbjct: 195 TAVHKANIMKLGDGLFRNSVTSIGET---EYPDIKVSSIIVDNASMQSVAKPHQFDVLVT 251

Query: 260 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIRST 318
           P++YG IL +  AAL+G  G+VP AN G E  + EP       DI G+ ++NP A I S+
Sbjct: 252 PSMYGTILGNIGAALIGGPGLVPGANYGTECAVFEPGSRHVGLDIKGQNVANPTAMILSS 311

Query: 319 GLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQVVEDILSKL 369
            L+L+ LG N  A+ I  AV   + E KV T D+GG+++T +   +I+ KL
Sbjct: 312 TLLLKHLGLNNEAKKIEDAVYKTIAEGKVTTRDIGGSASTTEFTNEIIKKL 362

>Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa]
           {ON} complement(108102..109181) [1080 nt, 360 aa]
          Length = 359

 Score =  171 bits (433), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 130/377 (34%), Positives = 192/377 (50%), Gaps = 41/377 (10%)

Query: 9   LATRRAYASA-------PKSM----VIGLIPGDGIGKEVIPAGKQVLE--NLSGKHGLNF 55
           L ++RA+ S        PK       + L+PGDG+G+E+  +   + E  NL     +++
Sbjct: 5   LISKRAFTSIASRENIIPKKYGGRYTVTLLPGDGVGREITDSVVSIFEAENLP----IDW 60

Query: 56  DFIDLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEL 115
           + ++L    G  QE         V+ LK    G     +   +   +G++S  VALRKEL
Sbjct: 61  ERVELS---GLEQED----VHTAVESLKRNKIG--LKGIWHTSADHDGHTSWNVALRKEL 111

Query: 116 GLYANVRPVKSVEGTKDR--PVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISE 173
            +YANV   KS +G   R   VD+VI+RENTE  Y  LE   V       V E+ K ++ 
Sbjct: 112 DIYANVAIFKSFKGVDTRIPDVDLVIIRENTEGEYSGLEHESVPG-----VVESLKIMTA 166

Query: 174 VATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQV 233
             T RIA  A D A++        ++T  HK+N++   DGLFR +   V E    +Y +V
Sbjct: 167 QKTERIARFAFDYAMKY----NRKSVTAVHKANIMKLGDGLFRNL---VTEIGAKEYPEV 219

Query: 234 AYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIG 293
             +  IVD+   +   +P  FDV+VAP++YG IL +  AAL+G  G+VP AN G +  + 
Sbjct: 220 GVSSIIVDNASMQAVAKPHQFDVMVAPSMYGTILGNIGAALIGGPGLVPGANYGRDYAVF 279

Query: 294 EP-CHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDL 352
           EP       DI  + I+NP A I S  LML  LG    A  I +AV   + E K  T D+
Sbjct: 280 EPGSRHVGLDIENQNIANPTAMILSATLMLNHLGFRNDAARISKAVHEVIAEGKTTTRDI 339

Query: 353 GGNSTTQQVVEDILSKL 369
           GG++TT +    +++KL
Sbjct: 340 GGSATTTEFTNAVIAKL 356

>NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {ON}
           Anc_2.278
          Length = 359

 Score =  171 bits (433), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 121/354 (34%), Positives = 183/354 (51%), Gaps = 31/354 (8%)

Query: 22  MVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDLQAGWGTFQETGKALPE---QT 78
             + L+PGDG+GKE+  +   +           F   ++   W T   +G    E     
Sbjct: 28  FTVTLLPGDGVGKEITDSVVSI-----------FKSENVPIDWETVDISGLDHTEGVKAA 76

Query: 79  VQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYANVRPVKSVEGTKDR--PVD 136
           V  LK    G L G   +P  +V G+ S  VA RK+L +YANV   KS+EG K +   VD
Sbjct: 77  VDSLKRNKIG-LKGIWHTPADQV-GHGSLNVAFRKQLDIYANVAIFKSIEGVKTKIPNVD 134

Query: 137 MVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATIALDIALQRLKTNGH 196
           +V++RENTE  Y  LE   V       V E+ K I++  + RIA  A D A    K N  
Sbjct: 135 LVVIRENTEGEYSGLEHESVPG-----VVESLKIITKSKSERIARFAFDFA----KRNNR 185

Query: 197 ATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDSMVYRMFREPECFDV 256
            ++T  HK+N++  SDGLFR     + E   ++Y ++  +  IVD+   +   +P  FDV
Sbjct: 186 KSVTAVHKANIMKLSDGLFRNTVSKIGE---EEYPEIQTSSIIVDNASMQAVAKPHQFDV 242

Query: 257 VVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATI 315
           +V P++YG I+ +  AAL+G  G+VP  N G +  + EP       DI G+ ++NP A +
Sbjct: 243 MVTPSMYGTIVGNIGAALIGGPGLVPGVNYGRDYAVFEPGSRHVGLDIKGQNVANPTAML 302

Query: 316 RSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQVVEDILSKL 369
            S  L+L+ LG  K A  I  AV   + E K  T D+GG+++T +  + +++KL
Sbjct: 303 LSATLLLDHLGLEKSANRIKSAVYDVIAEGKATTQDIGGSASTTEFTQAVINKL 356

>TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  171 bits (432), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 127/394 (32%), Positives = 203/394 (51%), Gaps = 46/394 (11%)

Query: 1   MLRSAIGRLATRRAYASAPKSMVIG-------------------LIPGDGIGKEVIPAGK 41
           MLR+   + + RR ++++    V G                    I GDG+G E+  + K
Sbjct: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60

Query: 42  QVLENLSGKHGLNFDFIDLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKV 101
            + +  + +  +++++ D+         T   +PE  VQ + N+ + AL G + +P  K 
Sbjct: 61  DIFK--AAQVPVDWEYCDVSPLLINGLTT---IPEPAVQQI-NKHKIALKGPLATPIGK- 113

Query: 102 EGYSSPIVALRKELGLYANVRPVKSVEG--TKDRPVDMVIVRENTEDLYIKLEKTYVDKA 159
            G+ S  + LRK  GL+ANVRP +S+ G  T  + VD+V++RENTE  Y  +E      A
Sbjct: 114 -GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVV---A 169

Query: 160 TGTRVAEATKRISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREIC 219
            G  V ++ K I+  A+ R+   A + A    +  G   L V HKS +   +DGLF  I 
Sbjct: 170 PG--VVQSIKLITRDASERVIRYAYEYA----RAIGRPRLVVVHKSTIQKLADGLFVNIA 223

Query: 220 KDVYESNKDKYGQVAYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAAL-VG 276
           K++      ++  +    +++D+ V  + R+P  +   V V PNLYGDILSD  + L  G
Sbjct: 224 KEL----APEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDILSDLNSGLSAG 279

Query: 277 SLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYR 336
           SLG+ PSAN+G E+ I E  HGSAPDIAG+  +NP A + S+ +ML ++G    +  I  
Sbjct: 280 SLGLTPSANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIEN 339

Query: 337 AVDANLRE-DKVKTPDLGGNSTTQQVVEDILSKL 369
           A+   +    + +T DL G +TT    E ++  L
Sbjct: 340 AILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373

>KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score =  169 bits (428), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 124/383 (32%), Positives = 197/383 (51%), Gaps = 41/383 (10%)

Query: 1   MLRSAIGRLATRRAYASAPKSM---------VIGLIPGDGIGKEVIPAGKQVL--ENLSG 49
           MLR    RL ++R+ A+ P+++          + L+PGDG+GKE   +   V   EN+  
Sbjct: 1   MLR----RLVSKRSLATLPETLFPNKYGGRYTVTLLPGDGVGKECTDSVVSVFNAENIP- 55

Query: 50  KHGLNFDFIDLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIV 109
              ++++ +++    G   + G A   Q+++  +N+    L G   +      G+ S  V
Sbjct: 56  ---IDWEIVNIS---GLDHKEGVAAAVQSLR--RNKI--GLKGLWHTSNADQSGHGSLNV 105

Query: 110 ALRKELGLYANVRPVKSVEGTKDR--PVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEA 167
           A RK+L +YANV   KS++G K     VD+V++RENTE  +  LE   V+      V E+
Sbjct: 106 AFRKQLDIYANVAVFKSLKGVKTMIPDVDLVVIRENTEGEFSGLEHESVEG-----VVES 160

Query: 168 TKRISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNK 227
            K  +   T RIA  A + A    + NG   +   HK+N++   DGLFR     + E   
Sbjct: 161 LKVTTLPKTERIARFAFNYA----QKNGRKAVCAVHKANIMKLGDGLFRNTVTSIGEK-- 214

Query: 228 DKYGQVAYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVG 287
            +Y  +  +  IVD+   +   +P  FDV+V P++YG I+ +  AAL+G  G+V  AN G
Sbjct: 215 -EYPDIETSSIIVDNASMQAVAKPHQFDVLVTPSMYGTIIGNIGAALIGGPGLVAGANFG 273

Query: 288 PEIVIGEP-CHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDK 346
            E  + EP       DI G+ I+NP A + S+ LML  LG  K  + I  AV   + E  
Sbjct: 274 REYAVFEPGSRHVGLDIKGQNIANPTAMLLSSALMLNHLGLTKSGKRISDAVREVIAEGD 333

Query: 347 VKTPDLGGNSTTQQVVEDILSKL 369
           V+T D+GG++TT +  + ++ KL
Sbjct: 334 VRTKDIGGDATTTEFTQAVIEKL 356

>Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {ON}
           YOR136W (IDH2) - NAD+-dependent isocitrate dehydrogenase
           [contig 130] FULL
          Length = 368

 Score =  169 bits (427), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 133/391 (34%), Positives = 203/391 (51%), Gaps = 45/391 (11%)

Query: 1   MLRSAIGR-----LATRRA-----YASAPK----SMVIGLIPGDGIGKEVIPAGKQVLEN 46
           M RS  GR      AT++      Y   P        +  I GDG+G E+  A K +   
Sbjct: 1   MFRSQFGRNTLRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFA- 59

Query: 47  LSGKHGLNFDFIDLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSS 106
            + K  + ++  D+      F      +P Q  Q   N+   AL G + +P  K  G+ S
Sbjct: 60  -AAKAPIQWETCDVTP---LFINGLTTIP-QPAQDSINKNLIALKGPLATPIGK--GHRS 112

Query: 107 PIVALRKELGLYANVRPVKSVEGTKDR--PVDMVIVRENTEDLYIKLEKTYVDKATGTRV 164
             + LRK  GL+ANVRP KS++G K     VD+V++RENTE  Y  +E      A G  V
Sbjct: 113 LNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVV---APG--V 167

Query: 165 AEATKRISEVATRRIATIALDIA--LQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDV 222
            ++ K I++ A+ R+   A + A  ++R K      + V HKS +   +DGLF  + + +
Sbjct: 168 VQSIKLITQDASERVIRYAFEYARAVERPK------VLVVHKSTIQRLADGLFVSVAEKL 221

Query: 223 YESNKDKYGQVAYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAAL-VGSLG 279
            +    +Y  +    +++D+ V    R+P  +   VVV PNLYGDILSD  + L  GSLG
Sbjct: 222 AK----EYPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLG 277

Query: 280 VVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVD 339
           + PSAN+G E+ I E  HGSAPDIAG+  +NP A + S+ +ML  +G  + A  I +AV 
Sbjct: 278 LTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVF 337

Query: 340 ANLRE-DKVKTPDLGGNSTTQQVVEDILSKL 369
           + +    + +T DL G+++T    E ++S+L
Sbjct: 338 STIASGPENRTGDLAGSASTSSFAEAVISRL 368

>KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]
           {ON} highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136W IDH2 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 368

 Score =  169 bits (427), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 123/354 (34%), Positives = 190/354 (53%), Gaps = 31/354 (8%)

Query: 24  IGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDLQAGWGTFQETGKALPEQTVQVLK 83
           +  I GDG+G E+  A K +    + K  + ++  D+      F      +P Q  Q   
Sbjct: 38  VSFIEGDGVGPEISKAVKDIFA--AAKAPIQWESCDVSP---LFINGLTTIP-QPAQDSI 91

Query: 84  NQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYANVRPVKSVEGTKDR--PVDMVIVR 141
           N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KSV+G K     VD+V++R
Sbjct: 92  NKNLIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVQGYKTAYDNVDLVLIR 149

Query: 142 ENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATIALDIA--LQRLKTNGHATL 199
           ENTE  Y  +E           V ++ K I++ A+ R+   A + A  ++R K      +
Sbjct: 150 ENTEGEYSGIEHV-----VSPGVVQSIKLITQDASERVIRYAFEYARAVERPK------V 198

Query: 200 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDSMVYRMFREPECFD--VV 257
            V HKS +   +DGLF  + + + +    +Y  +    +++D+ V    R+P  +   VV
Sbjct: 199 VVVHKSTIQRLADGLFVSVAEQLSK----EYPDIELQTELIDNTVLHTVRDPTKYSDVVV 254

Query: 258 VAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIR 316
           V PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAG+  +NP A + 
Sbjct: 255 VCPNLYGDILSDMNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKANPTALLL 314

Query: 317 STGLMLEFLGHNKPAQDIYRAVDANLRE-DKVKTPDLGGNSTTQQVVEDILSKL 369
           S+ +ML  +G  + A  I +AV   +    + +T DLGG+++T    E ++S+L
Sbjct: 315 SSVMMLNHMGLTEHADKIEKAVFTTIAAGPESRTGDLGGSASTSSFAEAVISRL 368

>CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2 isocitrate dehydrogenase
          Length = 368

 Score =  168 bits (426), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 129/388 (33%), Positives = 192/388 (49%), Gaps = 53/388 (13%)

Query: 8   RLATRRAYASAPKSM--------------VIGLIPGDGIGKEVIPAGKQVLENLSGKHGL 53
           RL  RR  A+A  S+               +  I GDGIG E+  + K++          
Sbjct: 8   RLNARRFLATAQPSIGRFTGKPNPSTGKFTVSFIEGDGIGPEISSSVKRI---------- 57

Query: 54  NFDFIDLQAGWGT------FQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSP 107
            F   D+   W T      F      +P+  VQ + N+   AL G + +P  K  G+ S 
Sbjct: 58  -FQAADVPVEWETCDVTPIFVNGLTTIPDPAVQSI-NKNLVALKGPLATPIGK--GHRSL 113

Query: 108 IVALRKELGLYANVRPVKSVEGTKD--RPVDMVIVRENTEDLYIKLEKTYVDKATGTRVA 165
            + LRK   L+ANVRP KS+EG K     VD+V++RENTE  Y  +E           V 
Sbjct: 114 NLTLRKTFNLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHL-----VSPGVV 168

Query: 166 EATKRISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYES 225
           ++ K I+  A+ R+   A + A    +  G   L V HKS +   +DGLF  + K++   
Sbjct: 169 QSIKLITRDASERVIRYAYEYA----RAIGRPRLIVVHKSTIQRLADGLFVNVAKEL--- 221

Query: 226 NKDKYGQVAYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAAL-VGSLGVVP 282
              +Y  +    +++D+    +   P  +   V V PNLYGDILSD  + L  GSLG+ P
Sbjct: 222 -AAEYPDIQLETELIDNTCLNVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTP 280

Query: 283 SANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANL 342
           SAN+G ++ I E  HGSAPDIAG+  +NP A + S+ +ML  +G  + A  I +AV   +
Sbjct: 281 SANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGMTEHADRIEKAVLGTI 340

Query: 343 R-EDKVKTPDLGGNSTTQQVVEDILSKL 369
               + +T DLGG+++T    + I+ KL
Sbjct: 341 AGGSEYRTGDLGGSASTTSFTDAIIKKL 368

>TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.473
           YOR136W
          Length = 371

 Score =  169 bits (427), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 134/398 (33%), Positives = 198/398 (49%), Gaps = 56/398 (14%)

Query: 1   MLRSAIGRLATRRAYASA---------------PKS--MVIGLIPGDGIGKEVIPAGKQV 43
           MLRS I R    R  ASA               PK+    +  I GDG+G E+  + K +
Sbjct: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60

Query: 44  LENLSGKHGLNFDFIDLQAGWGTFQETG------KALPEQTVQVLKNQCQGALFGAVQSP 97
                      F    +   W +   T         +PEQ  + + N+   AL G + +P
Sbjct: 61  -----------FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESI-NRNLVALKGPLATP 108

Query: 98  TTKVEGYSSPIVALRKELGLYANVRPVKSVEGTKD--RPVDMVIVRENTEDLYIKLEKTY 155
             K  G+ S  + LRK  GL+ANVRP KSVEG K     VD+V++RENTE  Y  +E   
Sbjct: 109 IGK--GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVI 166

Query: 156 VDKATGTRVAEATKRISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLF 215
           V       V ++ K I+  A+ R+   A + A    +  G   L V HKS +   +DGLF
Sbjct: 167 VPG-----VVQSIKLITREASERVIRYAYEYA----RAVGRPKLVVVHKSTIQRLADGLF 217

Query: 216 REICKDVYESNKDKYGQVAYNEQIVDSMVYRMFREPECF-DVV-VAPNLYGDILSDGAAA 273
             + K++      ++  +    +++D+ V  +   P  + DVV V PNLYGDILSD  + 
Sbjct: 218 VTVAKEL----AHEFPDIQLQTELIDNTVLNVVSNPSKYSDVVYVCPNLYGDILSDLNSG 273

Query: 274 L-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQ 332
           L  GSLG+ PS N+G ++ I E  HGSAPDIAG+  +NP A + S+ +ML  +G  + A 
Sbjct: 274 LSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLFEHAS 333

Query: 333 DIYRAVDANLRE-DKVKTPDLGGNSTTQQVVEDILSKL 369
            I +AV   +    + +T DL G+++T    E ++S+L
Sbjct: 334 KIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371

>AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR136W
           (IDH2)
          Length = 367

 Score =  168 bits (426), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 125/373 (33%), Positives = 197/373 (52%), Gaps = 34/373 (9%)

Query: 5   AIGRLATRRAYASAPKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDLQAGW 64
           +IGR A +    +A     +  I GDG+G E+  + K +    S    + +++ D+    
Sbjct: 21  SIGRYAGK---PNAAGKYTVSFIEGDGVGPEISQSVKDIFSAASVP--VEWEYCDVTP-- 73

Query: 65  GTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYANVRPV 124
                    +PE  V  + N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP 
Sbjct: 74  -LLVNGLTTIPEPAVASI-NKNLVALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPA 129

Query: 125 KSVEGTKD--RPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATI 182
           KS+EG K     VD+V++RENTE  Y  +E           V ++ K I+  A+ R+   
Sbjct: 130 KSIEGYKTTYSDVDLVLIRENTEGEYSGIEHV-----VSPGVVQSIKLITREASERVIRY 184

Query: 183 ALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDS 242
           A + A    +T G   + V HKS +   +DGLF  + +++      +Y  +    +++D+
Sbjct: 185 AFEYA----RTVGRPKVVVVHKSTIQRLADGLFVNVAQEL----GREYPDIELQTELLDN 236

Query: 243 MVYRMFREPECFDVVVA--PNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGS 299
            V  +  +PE +  VVA  PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGS
Sbjct: 237 TVLNVVTKPEAYKDVVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHQVSIFEAVHGS 296

Query: 300 APDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANL---REDKVKTPDLGGNS 356
           APDIAG+  +NP A + S+ +ML  +G ++ A  I +AV + +   RE+  +T DL G +
Sbjct: 297 APDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSREN--RTADLAGTA 354

Query: 357 TTQQVVEDILSKL 369
           +T      ++ +L
Sbjct: 355 STSSFTNAVIERL 367

>YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subunit
           of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle;
           phosphorylated
          Length = 369

 Score =  168 bits (426), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 128/391 (32%), Positives = 196/391 (50%), Gaps = 44/391 (11%)

Query: 1   MLRSAIGRLATRRAYASAPKSMV---------------IGLIPGDGIGKEVIPAGKQVLE 45
           MLR+   R  +RR  A+  +  +               +  I GDGIG E+  + K++  
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 46  NLSGKHGLNFDFIDLQAGWGTFQETGKALPEQTVQ-VLKNQCQGALFGAVQSPTTKVEGY 104
             +    + ++  D+      F      +P+  VQ + KN    AL G + +P  K  G+
Sbjct: 61  --AANVPIEWESCDVSP---IFVNGLTTIPDPAVQSITKNLV--ALKGPLATPIGK--GH 111

Query: 105 SSPIVALRKELGLYANVRPVKSVEGTKD--RPVDMVIVRENTEDLYIKLEKTYVDKATGT 162
            S  + LRK  GL+ANVRP KS+EG K     VD+V++RENTE  Y  +E          
Sbjct: 112 RSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPG---- 167

Query: 163 RVAEATKRISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDV 222
            V ++ K I+  A+ R+   A + A    +  G   + V HKS +   +DGLF  + K++
Sbjct: 168 -VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAKEL 222

Query: 223 YESNKDKYGQVAYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAAL-VGSLG 279
                 +Y  +    +++D+ V ++   P  +   V V PNLYGDILSD  + L  GSLG
Sbjct: 223 ----SKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDILSDLNSGLSAGSLG 278

Query: 280 VVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVD 339
           + PSAN+G +I I E  HGSAPDIAG+  +NP A + S+ +ML  +G    A  I  AV 
Sbjct: 279 LTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVL 338

Query: 340 ANLRE-DKVKTPDLGGNSTTQQVVEDILSKL 369
           + +    + +T DL G +TT    E ++ +L
Sbjct: 339 STIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa]
           {ON} Anc_5.473 YOR136W
          Length = 378

 Score =  168 bits (426), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 124/371 (33%), Positives = 190/371 (51%), Gaps = 27/371 (7%)

Query: 5   AIGRLATRRAYASAPKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDLQAGW 64
           +IGR   +  +A+      +  I GDGIG E+  + K + +  S    + ++  D+    
Sbjct: 29  SIGRFTGKPDHATG--KYTVSFIEGDGIGPEISRSVKDIFQAASVP--ITWETCDVSP-- 82

Query: 65  GTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYANVRPV 124
               +    +P++ V+ +     G L G + +P  K  G+ S  + LRK   L+ANVRP 
Sbjct: 83  -ILVDGLTTIPDEAVKSINKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPA 138

Query: 125 KSVEGTKDR--PVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATI 182
           KSV G K     VD+V++RENTE  Y  +E           V ++ K I+  A+ R+   
Sbjct: 139 KSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPG-----VVQSIKLITRDASERVIRY 193

Query: 183 ALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDS 242
           A + A    K  G   + V HKS +   SDGLF  + K++ +  +  +  +  + +++D+
Sbjct: 194 AFEYA----KAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQK--EKNFQNIELDTELIDN 247

Query: 243 MVYRMFREPECFD--VVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGS 299
            V  +   P  +   V V PNLYGDILSD  + L  GSLG+ PSAN+G +I I E  HGS
Sbjct: 248 TVLNVVMNPSKYSDAVFVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKISIFEAVHGS 307

Query: 300 APDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANL-REDKVKTPDLGGNSTT 358
           APDIAG+  +NP A + S+ +ML  +G N+    I  AV   +    K +T DLGG +TT
Sbjct: 308 APDIAGQNKANPTALLLSSVMMLHHMGLNEYGDKIENAVLKTIAASSKNRTGDLGGTATT 367

Query: 359 QQVVEDILSKL 369
               E ++  L
Sbjct: 368 TSFTEAVIDNL 378

>ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} similar
           to uniprot|P28834 Saccharomyces cerevisiae YNL037C IDH1
           Subunit of mitochondrial NAD( )-dependent isocitrate
           dehydrogenase which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 361

 Score =  166 bits (420), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 122/351 (34%), Positives = 186/351 (52%), Gaps = 28/351 (7%)

Query: 24  IGLIPGDGIGKEVIPAGKQVL--ENLSGKHGLNFDFIDLQAGWGTFQETGKALPEQTVQV 81
           + LIPGDG+GKEV  +   +   EN+     +++D +D+ +G    ++   A     V+ 
Sbjct: 31  VTLIPGDGVGKEVTDSVVSIFKAENVP----VDWDRVDI-SGVDRAEDVKSA-----VES 80

Query: 82  LKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYANVRPVKSVEGTKDR--PVDMVI 139
           LK    G L G   +      G+ S  VALRKEL +YANV   KS+ G + +   VD+V+
Sbjct: 81  LKRNRIG-LKGIWHTSPADQAGHGSLNVALRKELDIYANVARFKSIPGVQVKIPDVDLVV 139

Query: 140 VRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATIALDIALQRLKTNGHATL 199
           +RENTE  +  LE   V       V E+ K +++    RIA  A D A    K N    +
Sbjct: 140 IRENTEGEFSGLEHESVPG-----VVESLKIMTQDNIERIARFAFDYA----KKNDRKQV 190

Query: 200 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDSMVYRMFREPECFDVVVA 259
              HK+N++   DGLF+ + ++V E    +Y ++     IVD+   +    P  FDV+V 
Sbjct: 191 VAVHKANIMKMGDGLFKNLVQEVGEK---EYPELQVGNIIVDNASMQTVANPHQFDVLVT 247

Query: 260 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIRST 318
           P++YG IL +  AAL+G  G+V  AN G ++ + EP       DI G+ ++NP A I S+
Sbjct: 248 PSMYGTILGNIGAALIGGPGLVAGANYGRDVALFEPGSRHVGLDIKGQNVANPTAMILSS 307

Query: 319 GLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQVVEDILSKL 369
            L+L  LG N  A  I +AV A + E K  T D+GG ++T +  E +++KL
Sbjct: 308 VLLLNHLGLNTSADRISKAVHAVIAEGKSVTRDIGGTASTTEFTEAVINKL 358

>SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 369

 Score =  165 bits (418), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 126/390 (32%), Positives = 198/390 (50%), Gaps = 42/390 (10%)

Query: 1   MLRSAIGRLATRRAYASAPKSMV---------------IGLIPGDGIGKEVIPAGKQVLE 45
           MLRS + R   RR  +S  +  +               +  I GDG+G E+  + K +  
Sbjct: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA 60

Query: 46  NLSGKHGLNFDFIDLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYS 105
             + +  + ++  D+      F      +P+  V  + N+   AL G + +P  K  G+ 
Sbjct: 61  --AAEVPVEWESCDVTP---LFINGLTTIPQPAVDSI-NKNLIALKGPLATPIGK--GHR 112

Query: 106 SPIVALRKELGLYANVRPVKSVEGTKD--RPVDMVIVRENTEDLYIKLEKTYVDKATGTR 163
           S  + LRK  GL+ANVRP KSVEG K     VD+V++RENTE  Y  +E           
Sbjct: 113 SLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHV-----VSPG 167

Query: 164 VAEATKRISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVY 223
           V ++ K I+  A+ R+   A + A    +  G   + V HKS +   +DGLF ++ K++ 
Sbjct: 168 VVQSIKLITRDASERVIRYAFEYA----RAVGRPKVMVVHKSTIQRLADGLFVDVAKEL- 222

Query: 224 ESNKDKYGQVAYNEQIVDSMVYRMFREPECF--DVVVAPNLYGDILSDGAAAL-VGSLGV 280
                +Y  +    Q++D+ V  +   P  +   V V PNLYGDILSD  + L  GSLG+
Sbjct: 223 ---SSEYPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDILSDLNSGLSAGSLGL 279

Query: 281 VPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDA 340
            PSAN+G ++ I E  HGSAPDIAG+  +NP A + S+ +ML  +G  + A  I +AV +
Sbjct: 280 TPSANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLS 339

Query: 341 NLRE-DKVKTPDLGGNSTTQQVVEDILSKL 369
            +    + +T DL G+++T    E ++ +L
Sbjct: 340 TIASGPENRTADLAGSASTSSFTEAVIKRL 369

>ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  165 bits (417), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 125/389 (32%), Positives = 200/389 (51%), Gaps = 41/389 (10%)

Query: 1   MLRSAIGRLATRRAYASAPKSM--------------VIGLIPGDGIGKEVIPAGKQVLEN 46
           M +S + R A  R ++S   S+               +  I GDGIG E+  + K +   
Sbjct: 1   MFKSQVCRRAVARMFSSKQPSIGKFTGKPDPKTGNYKVSFIEGDGIGPEISKSVKDIFA- 59

Query: 47  LSGKHGLNFDFIDLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSS 106
            + K  ++F+ + ++           ++PE+  + + N    AL G + +P  K  G+ S
Sbjct: 60  -AAKVPVDFESVVVKP---ILVNGVTSIPEEAQKSI-NTNLVALKGPLATPVGK--GHRS 112

Query: 107 PIVALRKELGLYANVRPVKSVEGTKD--RPVDMVIVRENTEDLYIKLEKTYVDKATGTRV 164
             + LRK  GL+AN+RP KSVEG K     V++V++RENTE  Y  +E   V       V
Sbjct: 113 MNLTLRKTFGLFANLRPAKSVEGFKTIYDNVNLVLIRENTEGEYAGIEHAIVPG-----V 167

Query: 165 AEATKRISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYE 224
            ++ K I+  A+ R+   A + A    +      L V HKS +   SDGLF ++ K++  
Sbjct: 168 VQSIKLITREASERVIRFAYEYA----RAAERPRLIVVHKSTIQRLSDGLFVDVAKEL-- 221

Query: 225 SNKDKYGQVAYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAAL-VGSLGVV 281
             + ++  +    +++D+ V     +P  +   V V PNLYGDILSD  + L  GSLG+ 
Sbjct: 222 --QSEFPDIKLETELIDNAVLNTVTDPTKYSDAVSVCPNLYGDILSDMNSGLSAGSLGLT 279

Query: 282 PSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDAN 341
           PS N+G ++ I E  HGSAPDIAGK  +NP A + S+ +ML  +G ++ A  I +AV   
Sbjct: 280 PSGNIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSSVMMLHHMGLHEHASQIEKAVLTT 339

Query: 342 LRE-DKVKTPDLGGNSTTQQVVEDILSKL 369
           +    + +T DL G+++T    E ++ KL
Sbjct: 340 IAAGPESRTGDLKGSASTSSFTEAVIKKL 368

>Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON}
           (32084..33190) [1107 nt, 369 aa]
          Length = 368

 Score =  164 bits (416), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 117/352 (33%), Positives = 186/352 (52%), Gaps = 27/352 (7%)

Query: 24  IGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDLQAGWGTFQETGKALPEQTVQVLK 83
           +  I GDG+G E+  + K +    + K  + ++  D+      F      +P+  VQ + 
Sbjct: 38  VPFIEGDGVGPEISKSVKDIFA--AAKVPIEWEPCDVGP---IFVNGLTTIPDAAVQSI- 91

Query: 84  NQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYANVRPVKSVEGTKD--RPVDMVIVR 141
           N+   AL G + +P  K  G+ S  + LRK   L+ANVRP +SV   K   + VD+V++R
Sbjct: 92  NKHLVALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPARSVPNYKTTYQNVDLVLIR 149

Query: 142 ENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATIALDIALQRLKTNGHATLTV 201
           ENTE  Y  +E           V ++ K I++ A+ R+    +  A +  +  G   L V
Sbjct: 150 ENTEGEYSGIEH-----VISPGVIQSIKLITKDASERV----IRYAFEYTRAIGRPRLVV 200

Query: 202 THKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDSMVYRMFREPECFD--VVVA 259
            HKS +   +DGLF  + K++      +Y  +    +++D+ +  +   PE +   V V 
Sbjct: 201 VHKSTIQRMADGLFVNVAKEL----ASEYPDIELQTELIDNTILNVVTHPESYTDAVSVC 256

Query: 260 PNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRST 318
           PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAG+  +NP A + S+
Sbjct: 257 PNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLLSS 316

Query: 319 GLMLEFLGHNKPAQDIYRAVDANLRE-DKVKTPDLGGNSTTQQVVEDILSKL 369
            +ML  +G N+ A  I  A+ + +    + +T DL G +TT    E +++KL
Sbjct: 317 VMMLNHMGLNEHATKIENAILSTIASGSENRTGDLAGTATTSSFTEAVINKL 368

>Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON}
           (21411..22517) [1107 nt, 369 aa]
          Length = 368

 Score =  164 bits (414), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 120/371 (32%), Positives = 195/371 (52%), Gaps = 29/371 (7%)

Query: 5   AIGRLATRRAYASAPKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDLQAGW 64
           +IGR   +   A+      +  I GDG+G E+  + K++    + K  + +   D+   +
Sbjct: 21  SIGRFTGKPDPATG--KFTVPFIEGDGVGPEISESVKKIFS--AAKVPIEWVPCDVGPIF 76

Query: 65  GTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYANVRPV 124
              Q T   +PE  V+++ N+   AL G + +P  K  G+ S  + LRK   L+ANVRP 
Sbjct: 77  VNGQTT---IPEPAVELI-NKHLIALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPA 130

Query: 125 KSVEGTKD--RPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATI 182
           +S+   K     VD+V++RENTE  Y  +E           V ++ K I+  AT R+   
Sbjct: 131 RSIPNYKSTYENVDLVLIRENTEGEYSGIEHVITPG-----VIQSIKLITREATERV--- 182

Query: 183 ALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDS 242
            +  A +  +  G   L V HKS +   +DGLF ++ +++      +Y  +    +I+D 
Sbjct: 183 -VRYAFEYTQAIGRPRLLVIHKSTIQRMADGLFVKVAEEL----ASEYPDIKLETEIIDK 237

Query: 243 MVYRMFREPECFD--VVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGS 299
            +  +  +PE +   V V PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGS
Sbjct: 238 SILNVVSKPELYSDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGS 297

Query: 300 APDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLRE-DKVKTPDLGGNSTT 358
           APDIAG+  +NP A + S+ +ML+ +G ++ A  I  AV   +    + +T DL G ++T
Sbjct: 298 APDIAGQNKANPTALLLSSVMMLKHMGLDEHANKIENAVLTTIASGSENRTADLSGTAST 357

Query: 359 QQVVEDILSKL 369
               E+++ +L
Sbjct: 358 SSFTEEVIQRL 368

>CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037c IDH1 or uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2
          Length = 358

 Score =  163 bits (412), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 122/377 (32%), Positives = 190/377 (50%), Gaps = 39/377 (10%)

Query: 8   RLATRRAYASAPKSMV----------IGLIPGDGIGKEVIPAGKQVLE--NLSGKHGLNF 55
           R   RR  AS  K +V          + LIPGDG+GKE+  +   + E  N+     +++
Sbjct: 3   RTVQRRGMASMAKELVLPKKYGGRYTVTLIPGDGVGKEITDSVVSIFEAENIP----VDW 58

Query: 56  DFIDLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEL 115
           + +D+       Q+       Q V+ LK    G     +   +  +  + S  VALRK+L
Sbjct: 59  ERVDISTS-DNIQDV-----SQAVESLKRNKIG--LKGIWHTSADIADHGSFNVALRKQL 110

Query: 116 GLYANVRPVKSVEGTKDR--PVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISE 173
            ++A+V   KSV G K +   VD+V++RENTE  Y  LE   V       V E+ K I++
Sbjct: 111 DMFAHVAFFKSVPGVKTKIPNVDLVVIRENTEGEYSGLEHESVPG-----VVESLKIITK 165

Query: 174 VATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQV 233
             + RIA  A D A    K     ++   HK+N++   DGLFR     V E   ++Y  +
Sbjct: 166 AKSERIARFAFDFA----KKYNRKSVCAVHKANIMKMGDGLFRNT---VTEIGANEYPDI 218

Query: 234 AYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIG 293
             +  IVD+   +   +P  FDV+V P++YG I+ +  AAL+G  G+V  A+ G E  + 
Sbjct: 219 QTSSIIVDNASMQAVAKPHQFDVMVTPSMYGTIIGNIGAALIGGPGLVAGAHYGREHAVF 278

Query: 294 EP-CHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDL 352
           EP       DI GK ++NP A I S+ LML+ LG  + A+ I +A    +   +V T D+
Sbjct: 279 EPGSQHVGLDIKGKNVANPTAMILSSTLMLQHLGLTESAKRIAKATHDVISLGQVTTKDI 338

Query: 353 GGNSTTQQVVEDILSKL 369
           GG+++T +  E I+ +L
Sbjct: 339 GGSASTTEFTEAIIKRL 355

>TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2.278
           YNL037C
          Length = 376

 Score =  162 bits (410), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 124/376 (32%), Positives = 186/376 (49%), Gaps = 42/376 (11%)

Query: 6   IGRLATRRAYASAPKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDLQAGWG 65
           IGR   +    ++  +  +  I GDG+G E+  + K +           F   ++   W 
Sbjct: 31  IGRFTGK---TNSSGTYTVPFIEGDGVGPEISKSVKDI-----------FSAANVPIQWQ 76

Query: 66  ------TFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYA 119
                  F      +PE  V+ +K     AL G + +P  K  G+ S  + LRK   L+A
Sbjct: 77  PCDVGPIFVNGLTTIPEPAVKAIKESLV-ALKGPLATPVGK--GHRSLNLTLRKTFDLFA 133

Query: 120 NVRPVKSVEGTKD--RPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATR 177
           NVRP KSV   K     VD+V++RENTE  Y  +E           V ++ K I+  A+ 
Sbjct: 134 NVRPAKSVPNYKSTYENVDLVLIRENTEGEYSGIEHIVTPG-----VVQSIKLITREASE 188

Query: 178 RIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNE 237
           ++   A + A+      G   L V HKS +    DGLF +I  ++    + +Y  +    
Sbjct: 189 KVIRYAYEYAIAV----GRPRLIVVHKSTIQRLGDGLFVQIANEL----QSEYPSIKLET 240

Query: 238 QIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGE 294
           QI+D+ V  +   P  +   V V PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E
Sbjct: 241 QILDNTVLNVVSNPTLYKDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFE 300

Query: 295 PCHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLRE-DKVKTPDLG 353
             HGSAPDIAG+  +NP A + S+ +ML  +G  + A  I  AV + +    + +T DLG
Sbjct: 301 AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLEEHASRIENAVLSTIASGPESRTGDLG 360

Query: 354 GNSTTQQVVEDILSKL 369
           G++TT    E ++ KL
Sbjct: 361 GSATTSSFTECVIKKL 376

>TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {ON}
           Anc_5.473 YOR136W
          Length = 377

 Score =  160 bits (406), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 124/386 (32%), Positives = 194/386 (50%), Gaps = 44/386 (11%)

Query: 6   IGRLATRRAYASAPKSMVIG----------------LIPGDGIGKEVIPAGKQVLENLSG 49
           IG ++  R + +A   + IG                 I GDG+G E+  + + + +  + 
Sbjct: 13  IGTISKLRYFMTAADKISIGNFKGKPNPETGNYTVPFIEGDGVGPEISKSVRTIFK--AA 70

Query: 50  KHGLNFDFIDLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIV 109
           K  +++   D+    G     G+    QT     N    AL G + +P    +G+ S  +
Sbjct: 71  KVPIDWVNCDI----GPLLINGETTIPQTAVDQINNSLIALKGPLATPVG--QGHRSINL 124

Query: 110 ALRKELGLYANVRPVKSVE--GTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEA 167
            LRK  GL+ANVRP KS+    +    VD++++RENTE  Y  +E   V       V ++
Sbjct: 125 TLRKTFGLFANVRPAKSIPNLASTYENVDLIVIRENTEGEYSGIEHEIVPG-----VVQS 179

Query: 168 TKRISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNK 227
            K I+  A+ ++    +  A +  ++ G + L V HK+ +  + DGLF +  +++     
Sbjct: 180 IKLITRKASEKV----IKYAFEYTRSIGRSNLIVVHKATIQRRGDGLFVQTAQEM----A 231

Query: 228 DKYGQVAYNEQIVDSMVYRMFREPECF--DVVVAPNLYGDILSDGAAAL-VGSLGVVPSA 284
           DKY  V    +++D+ V      PE +   V V PNLYGDILSD  + L  GSLG+ PSA
Sbjct: 232 DKYPDVNLKLELIDNTVLNCIMNPEKYADSVSVCPNLYGDILSDLNSGLSTGSLGLTPSA 291

Query: 285 NVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLRE 344
           N+G E V+ E  HGSAPDIAG+  +NP A + S+ +ML  +G  K A  I  AV   +  
Sbjct: 292 NIG-ETVLYEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLQKYADMIETAVLTTITS 350

Query: 345 DK-VKTPDLGGNSTTQQVVEDILSKL 369
            K  +T DLGG++TT    + ++  L
Sbjct: 351 GKEFRTADLGGSATTTSFTKAVIENL 376

>KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {ON}
           Anc_2.278 YNL037C
          Length = 350

 Score =  159 bits (403), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 115/378 (30%), Positives = 190/378 (50%), Gaps = 41/378 (10%)

Query: 1   MLRSAIGRLATRRAYASAPKS----MVIGLIPGDGIGKEVIPAGKQVL--ENLSGKHGLN 54
           MLR+ + R   R     +PK       I LIPG+GIGKEV  + + +   ENL     ++
Sbjct: 1   MLRNTLLR---RSISTISPKKYGGRFQITLIPGNGIGKEVTDSVRSIFQAENLP----ID 53

Query: 55  FDFIDLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKE 114
           ++ +++++     +    ++    + +        + G++              VALRK+
Sbjct: 54  WEIVNIESHRDGIKTAVDSIKRNKIALKGIWSSDPIDGSLN-------------VALRKQ 100

Query: 115 LGLYANVRPVKSVEGTKDR--PVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRIS 172
           L ++ANV   KS +    R   VD+V++RENTE  +  LE   VD      V E+ K ++
Sbjct: 101 LDIFANVAIFKSFDNVNTRIPNVDLVVIRENTEGEFSGLEHESVDG-----VVESLKIVT 155

Query: 173 EVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQ 232
           +  T RIA  A D A    K +    +T  HK+N++   DGLF+ I   +     ++Y +
Sbjct: 156 KPKTERIARFAFDFA----KKHNRNHVTAVHKANIMKLGDGLFKNIVAHI---GNNEYPE 208

Query: 233 VAYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVI 292
           +  +  IVD+   +   +P  FDV+V+P++YG IL +  AAL+G  G+VP AN G +  +
Sbjct: 209 IKNSSIIVDNASMQAVAKPHQFDVLVSPSMYGTILGNIGAALIGGPGLVPGANFGRDYAV 268

Query: 293 GEP-CHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPD 351
            EP       DI G+ ++NP A I S   ML  LG   PA+ I  AV   + +    T D
Sbjct: 269 FEPGSRHVGLDIKGQNVANPTAMILSATWMLRHLGLTSPAERITNAVKHVIAQGTTVTKD 328

Query: 352 LGGNSTTQQVVEDILSKL 369
           +GG ++T +  + ++++L
Sbjct: 329 IGGTASTTEFTDAVINEL 346

>Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar to
           Ashbya gossypii AAL012C
          Length = 363

 Score =  151 bits (382), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 129/367 (35%), Positives = 190/367 (51%), Gaps = 39/367 (10%)

Query: 17  SAPKSMVIGLIPGDGIGKEVIPAGKQVLENL-SGKHGLNFDFIDLQAGWGTFQETGKALP 75
           S+ K +V+  +PGD IG+EVI    +VL  +   +  +NF+F     G      TG  L 
Sbjct: 2   SSTKKVVV--LPGDYIGQEVIAETIKVLNAIQEARPSINFEFEYHLIGGAAINATGAPLS 59

Query: 76  EQTVQVLKNQCQGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANVRPV----KSVE 128
           ++T++  K      L GAV  P     G   P   ++A+RKELGLYAN+RP     KS+ 
Sbjct: 60  DKTIEAAK-AADAVLLGAVGGPEWD-SGAVRPEQGLLAIRKELGLYANLRPCSFISKSLL 117

Query: 129 GTKD-RP-----VDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATI 182
           G    +P      D VI+RE    +Y    K   D   G         +SEV   RI  +
Sbjct: 118 GLSPLKPEIAQGTDFVILRELVGGIYFGERKE--DDGDGVAWDSEKYTVSEV--ERITRM 173

Query: 183 ALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDS 242
              +ALQ    +    L    K+NVL+ S  L+R   + V E+ K ++ Q++   Q++DS
Sbjct: 174 GAFLALQH---DPPLPLWSFDKANVLASSR-LWR---RTVNETIKREFPQLSVQHQLIDS 226

Query: 243 MVYRMFREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE------IVIGEP 295
               M + P  F+ +V+  N++GDI+SD A+ + GSLG++PSA++  E        + EP
Sbjct: 227 AAMIMIKNPRKFNGIVITSNIFGDIISDAASVIPGSLGLLPSASLASEPDKNNAFGLYEP 286

Query: 296 CHGSAPDIAGKGISNPIATIRSTGLMLEF-LGHNKPAQDIYRAVDANLREDKVKTPDLGG 354
           CHGSAPD+  KG +NPIA I S  +ML+  L      + I  AV   + E  ++T DLGG
Sbjct: 287 CHGSAPDLE-KGQANPIACILSAAMMLKLSLNMVDEGKAIENAVK-QVIESGIRTGDLGG 344

Query: 355 NSTTQQV 361
           N+TT +V
Sbjct: 345 NNTTTEV 351

>KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 364

 Score =  146 bits (368), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 121/371 (32%), Positives = 192/371 (51%), Gaps = 47/371 (12%)

Query: 17  SAPKSMVIGLIPGDGIGKEVIPAGKQVLENLSG-KHGLNFDFIDLQAGWGTFQETGKALP 75
           SAPK +V+  +PGD +G+E+     +VL+ +S  +  + F+F     G      TG+ LP
Sbjct: 2   SAPKKIVV--LPGDHVGQEITDEAIKVLKAISEVRSSVKFEFQQHLIGGAAIDATGEPLP 59

Query: 76  EQTVQVLKNQCQGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANVRP--------- 123
           + +++  K +    L GAV  P     G   P   ++ +RKEL LYAN+RP         
Sbjct: 60  DASLEAAK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASESLL 117

Query: 124 -VKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATI 182
            +  ++    R  D V+VRE    +Y    K    +  G  VA  +++ S    +RI  +
Sbjct: 118 DLSPLKAEHARGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRM 173

Query: 183 ALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDS 242
           A  +ALQ    N    +    K+NVL+ S  L+R   K V E+ K+++  +    Q++DS
Sbjct: 174 AAFLALQH---NPPLPVWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDS 226

Query: 243 MVYRMFREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEP 295
               M + P   + V++  N++GDI+SD A+ + GSLG++PSA++   P+      + EP
Sbjct: 227 AAMIMVKNPTQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEP 286

Query: 296 CHGSAPDIAGKGISNPIATIRSTGLMLE-----FLGHNKPAQDIYRAVDANLREDKVKTP 350
           CHGSAPD+  KG  NPIATI S  +MLE     F       + + R +D+ +R     T 
Sbjct: 287 CHGSAPDLE-KGKVNPIATILSAAMMLELSLDMFEEGTAVEEAVRRVLDSGIR-----TG 340

Query: 351 DLGGNSTTQQV 361
           DL G+++TQ+V
Sbjct: 341 DLRGSNSTQEV 351

>TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  145 bits (366), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 117/368 (31%), Positives = 194/368 (52%), Gaps = 38/368 (10%)

Query: 24  IGLIPGDGIGKEVIPAGKQVLENLSGK-HGLNFDFIDLQAGWGTFQETGKALPEQTVQVL 82
           I ++PGD +G+E++    +VL+ +  K HG+ F+F     G     +TG  LP++T++  
Sbjct: 7   IVVLPGDHVGQEIVEEAVKVLKIVEEKRHGVKFNFQYHLIGGDAIDKTGDPLPDETLEAA 66

Query: 83  KNQCQGALFGAVQSP---TTKVEGYSSPIVALRKELGLYANVRPVKSVEGT-------KD 132
           K Q    L GAV  P   T KV      ++ +RKELGLY N+RP K +          K+
Sbjct: 67  K-QSDAVLLGAVGGPKWGTGKVRPEQG-LLKIRKELGLYGNLRPCKFISDKLIGLSPLKE 124

Query: 133 ---RPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATIALDIALQ 189
              +  D V+VRE    +Y   E+   D   G+ VA  +++ S    +RI  +A   A  
Sbjct: 125 EVCKGTDFVVVRELVGGIYFG-ERQEDD---GSGVAWDSEKYSIEEVKRITKMA---AFL 177

Query: 190 RLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDSMVYRMFR 249
            L+ +    +    K+NVL+ S      + +   +    ++  +    Q++DS    + +
Sbjct: 178 SLQNDPPLPIWSLDKANVLASS-----RLWRAAVDETIAEFPNLKVQHQLIDSAAMMLVK 232

Query: 250 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 302
            P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 233 NPTQLNGIILTNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNKAFGLYEPCHGSAPD 292

Query: 303 IAGKGISNPIATIRSTGLMLEF-LGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQV 361
           +A +G  NP+ATI S  +ML+  L   +  + I RAV   L +  ++T DLGGNSTT ++
Sbjct: 293 LA-RGKVNPVATILSAAMMLKLSLDMVQEGEAIERAVSVVL-DRGIRTADLGGNSTTSEL 350

Query: 362 VEDILSKL 369
            + +  +L
Sbjct: 351 GDAVAQEL 358

>NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa]
           {ON} Anc_1.402
          Length = 363

 Score =  142 bits (358), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 122/364 (33%), Positives = 192/364 (52%), Gaps = 37/364 (10%)

Query: 24  IGLIPGDGIGKEVIPAGKQVLENLSG-KHGLNFDFIDLQAGWGTFQETGKALPEQTVQVL 82
           I ++PGD +G+E+     +VL+ ++   + +NFDF     G      TG  LP++ ++  
Sbjct: 6   IVVLPGDHVGEEITAEAVKVLKAIAEVDNSINFDFQYHLIGGAAIDATGVPLPDEALEAS 65

Query: 83  KNQCQGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANVRPV----KSVEGTKD-RP 134
           KN     L GAV  P     G   P   ++ +RKELGLYAN+RP     +S+ G    RP
Sbjct: 66  KN-SDAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASESLLGLSPLRP 123

Query: 135 -----VDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATIALDIALQ 189
                 D ++VRE    +Y    K    +  G  VA  +++ S    +RI  +A  +ALQ
Sbjct: 124 EIAKGTDFMVVRELVGGIYFGKRK----EDEGDGVAWDSEQYSVPEVQRITRMAAFLALQ 179

Query: 190 RLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDSMVYRMFR 249
               N    +    K+NVL+ S  L+R   K V E+ K+++  +    Q++DS    + +
Sbjct: 180 H---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQNQLIDSAAMILVK 232

Query: 250 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 302
            P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 233 NPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPD 292

Query: 303 IAGKGISNPIATIRSTGLMLEF-LGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQV 361
           +  KG  NPIATI S  +ML+  L   K    I  AV   L +  ++T DLGG+++T +V
Sbjct: 293 LP-KGKVNPIATILSAAMMLKLSLNLVKQGDAIEEAVKKVL-DAGIRTGDLGGSNSTTEV 350

Query: 362 VEDI 365
            + I
Sbjct: 351 GDAI 354

>Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  139 bits (350), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 118/372 (31%), Positives = 193/372 (51%), Gaps = 49/372 (13%)

Query: 17  SAPKSMVIGLIPGDGIGKEVIPAGKQVLENLSG-KHGLNFDFIDLQAGWGTFQETGKALP 75
           SAPK +V+  +PGD +G+E+     +VL+ +S  +  +NFDF +   G      TG  LP
Sbjct: 2   SAPKKIVV--LPGDHVGQEITAEAIKVLKAISEVRSDVNFDFENHLIGGAAIDATGVPLP 59

Query: 76  EQTVQVLKNQCQGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANVRP--------- 123
           ++ ++  K +    L GAV  P     G   P   ++ +RKEL LYAN+RP         
Sbjct: 60  DEALEASK-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLL 117

Query: 124 -VKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATI 182
            +  ++    +  D V+VRE    +Y    K    +  G  VA  +++ +    +RI  +
Sbjct: 118 DLSPIKPQFAKGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRM 173

Query: 183 ALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDS 242
           A  +ALQ         +    K+NVL+ S  L+R   K V E+ K+++  +    Q++DS
Sbjct: 174 AAFMALQH---EPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDS 226

Query: 243 MVYRMFREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEP 295
               + + P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EP
Sbjct: 227 AAMILVKNPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEP 286

Query: 296 CHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQD------IYRAVDANLREDKVKT 349
           CHGSAPD+  K   NPIATI S  +ML+ L  N P +       + + +DA +R     T
Sbjct: 287 CHGSAPDLP-KNKVNPIATILSAAMMLK-LSLNLPEEGKAIEDAVKKVLDAGIR-----T 339

Query: 350 PDLGGNSTTQQV 361
            DLGG+++T +V
Sbjct: 340 GDLGGSNSTTEV 351

>TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON}
           Anc_1.402 YCL018W
          Length = 362

 Score =  139 bits (350), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 115/360 (31%), Positives = 190/360 (52%), Gaps = 37/360 (10%)

Query: 24  IGLIPGDGIGKEVIPAGKQVLENLSG-KHGLNFDFIDLQAGWGTFQETGKALPEQTVQVL 82
           I ++PGD +G+E+     +VL+ +S  +    F+F     G      TG  LP++ ++  
Sbjct: 5   IVVLPGDHVGQEITEEAIKVLKAISEVRPNATFNFQHHLIGGAAIDATGVPLPDEALEAS 64

Query: 83  KNQCQGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANVRP----------VKSVEG 129
           K +    L GAV  P     G   P   ++ +RKEL LYAN+RP          +  ++ 
Sbjct: 65  K-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASDSLLELSPLKA 122

Query: 130 TKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATIALDIALQ 189
              +  D V+VRE    +Y    K    +  G  VA  +++ S    +RI  +A  +ALQ
Sbjct: 123 QYAQGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEQYSVPEVQRITRMAAFLALQ 178

Query: 190 RLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDSMVYRMFR 249
               N    +    K+NVL+ S  L+R   K V ++ K+++  ++ N Q++DS    + +
Sbjct: 179 H---NPPLPIWSLDKANVLASSR-LWR---KTVEKTIKEEFPTLSVNHQLIDSAAMILVK 231

Query: 250 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 302
            P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 232 NPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPD 291

Query: 303 IAGKGISNPIATIRSTGLMLEF-LGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQV 361
           +A KG  NP+ATI S  +ML+  L   +    I +AV   L +D ++T DLGG+++T +V
Sbjct: 292 LA-KGKVNPVATILSAAMMLKLSLNMVEEGVAIEKAVKKVL-DDGIRTGDLGGSNSTSEV 349

>Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C
           (REAL)
          Length = 300

 Score =  137 bits (345), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 106/322 (32%), Positives = 165/322 (51%), Gaps = 40/322 (12%)

Query: 6   IGRLATRRAYASA-------PKS----MVIGLIPGDGIGKEVIPAGKQVLE--NLSGKHG 52
           + R   +R+ A+A       PK       + LIPGDG+GKEV  + K + E  N+     
Sbjct: 2   LNRTIAKRSLATAAQVEHILPKKYGGRFTVTLIPGDGVGKEVTDSVKTIFEAENIP---- 57

Query: 53  LNFDFIDLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALR 112
           ++++ I+++      Q   K    + V+ L+    G L G   +P  +  G+ S  VALR
Sbjct: 58  IDWETINIK------QTDHKEGVNEAVESLRRNKIG-LKGLWHTPADQT-GHGSLNVALR 109

Query: 113 KELGLYANVRPVKSVEGTKDR--PVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKR 170
           K+L +YANV   KS++G K R   +D++++RENTE  +  LE   V       V E+ K 
Sbjct: 110 KQLDIYANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPG-----VVESLKI 164

Query: 171 ISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKY 230
           +++  T RIA  A D A    K      +T  HK+N++   DGLFR I   + E  + +Y
Sbjct: 165 MTKPKTERIARFAFDFA----KKYNRKAVTAVHKANIMKLGDGLFRNI---ITEIGQKEY 217

Query: 231 GQVAYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEI 290
             +  +  IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G + 
Sbjct: 218 PDIDVSSIIVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDY 277

Query: 291 VIGEP-CHGSAPDIAGKGISNP 311
            + EP       DI G+ ++NP
Sbjct: 278 AVFEPGSRHVGLDIKGQNVANP 299

>KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 362

 Score =  138 bits (348), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 117/360 (32%), Positives = 188/360 (52%), Gaps = 37/360 (10%)

Query: 24  IGLIPGDGIGKEVIPAGKQVLENLSG-KHGLNFDFIDLQAGWGTFQETGKALPEQTVQVL 82
           I ++PGD +GKEV     +VL  ++  +  + F+F     G      TG  LP++ ++  
Sbjct: 5   IVVLPGDHVGKEVTDEAIKVLNAIAEVRPEIKFNFQHHLIGGAAIDATGTPLPDEALEAS 64

Query: 83  KNQCQGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANVRP----------VKSVEG 129
           K +    L GAV  P     G   P   ++ +RKELGLYAN+RP          +  ++ 
Sbjct: 65  K-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASDSLLDLSPLKP 122

Query: 130 TKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATIALDIALQ 189
              +  D V+VRE    +Y    K    +  G  VA  +++ S    +RI  +A  +ALQ
Sbjct: 123 EYAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFLALQ 178

Query: 190 RLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDSMVYRMFR 249
           +   N    +    K+NVL+ S  L+R   K V E+ K ++ Q+    Q++DS    + +
Sbjct: 179 Q---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKTEFPQLTVQHQLIDSAAMILVK 231

Query: 250 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 302
            P   + VV+  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 232 SPTKLNGVVITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNKAFGLYEPCHGSAPD 291

Query: 303 IAGKGISNPIATIRSTGLMLEF-LGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQV 361
           +    + NPIATI S  +ML+  L   +  + +  AV  N+ +  V+T DLGG+++T +V
Sbjct: 292 LPANKV-NPIATILSAAMMLKLSLDLVEEGRALEEAV-RNVLDAGVRTGDLGGSNSTTEV 349

>AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL018W
           (LEU2)
          Length = 372

 Score =  138 bits (348), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 124/368 (33%), Positives = 195/368 (52%), Gaps = 45/368 (12%)

Query: 24  IGLIPGDGIGKEVIPAGKQVL----ENLSGKHGLNFDFIDLQAGWGTFQETGKALPEQTV 79
           I ++PGD IG+EV+    +VL    ++LS  H   FDF     G      TG ALP++ +
Sbjct: 7   IVVLPGDHIGREVVEEAVKVLGAVEQSLSDVH---FDFQYHLVGGAAIDATGSALPDEAL 63

Query: 80  QVLKNQCQGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANVRPVKS-----VEGTK 131
              K +    L GAV  P  +  G   P   ++ LR+ELG+YAN+RP        +E + 
Sbjct: 64  GAAK-EADAVLLGAVGGPKWQ-GGAVRPEQGLLKLRQELGVYANLRPCNFAADSLLELSP 121

Query: 132 DRP-----VDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATIALDI 186
            RP      D+++VRE     Y    + + D+  G  VA  T + +    +RIA +A  +
Sbjct: 122 LRPEIARDTDIMVVRELLGGSYFG--ERHEDEGDG--VAWDTDKYTVKEVQRIARMAGFL 177

Query: 187 ALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDSMVYR 246
           ALQ    +    +    K+NVL+ S  L+R+  ++ ++S   ++  V    Q++DS    
Sbjct: 178 ALQH---DPPLPVWSLDKANVLASSR-LWRKTVEETFQS---EFPNVQLQHQLIDSAAMI 230

Query: 247 MFREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGS 299
           + + P  F+ VVV  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGS
Sbjct: 231 LVKNPRAFNGVVVTSNMFGDIISDEASVIPGSLGLLPSASLASLPDSKSAFGLYEPCHGS 290

Query: 300 APDI-AGKGISNPIATIRSTGLMLEF-LGHNKPAQDIYRAVDANLREDKVKTPDLGGNST 357
           APD+ AGK  +NPI  I S  +ML+  L      + + +AV   L +  V+T DL G+S+
Sbjct: 291 APDLPAGK--ANPIGCILSAAMMLKLSLNMVAAGEAVEQAVQEVL-DSGVRTGDLLGSSS 347

Query: 358 TQQVVEDI 365
           T +V + I
Sbjct: 348 TSEVGDAI 355

>YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}
           LEU2Beta-isopropylmalate dehydrogenase (IMDH), catalyzes
           the third step in the leucine biosynthesis pathway
          Length = 364

 Score =  137 bits (345), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 192/372 (51%), Gaps = 49/372 (13%)

Query: 17  SAPKSMVIGLIPGDGIGKEVIPAGKQVLENLSG-KHGLNFDFIDLQAGWGTFQETGKALP 75
           SAPK +V+  +PGD +G+E+     +VL+ +S  +  + FDF +   G      TG  LP
Sbjct: 2   SAPKKIVV--LPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLP 59

Query: 76  EQTVQVLKNQCQGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANVRP--------- 123
           ++ ++  K +    L GAV  P     G   P   ++ +RKEL LYAN+RP         
Sbjct: 60  DEALEASK-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLL 117

Query: 124 -VKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATI 182
            +  ++    +  D V+VRE    +Y    K    +  G  VA  +++ +    +RI  +
Sbjct: 118 DLSPIKPQFAKGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRM 173

Query: 183 ALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDS 242
           A  +ALQ         +    K+NVL+ S  L+R   K V E+ K+++  +    Q++DS
Sbjct: 174 AAFMALQH---EPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDS 226

Query: 243 MVYRMFREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEP 295
               + + P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EP
Sbjct: 227 AAMILVKNPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEP 286

Query: 296 CHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQD------IYRAVDANLREDKVKT 349
           CHGSAPD+  K   NPIATI S  +ML+ L  N P +       + + +DA +R     T
Sbjct: 287 CHGSAPDLP-KNKVNPIATILSAAMMLK-LSLNLPEEGKAIEDAVKKVLDAGIR-----T 339

Query: 350 PDLGGNSTTQQV 361
            DLGG+++T +V
Sbjct: 340 GDLGGSNSTTEV 351

>Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  137 bits (345), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 191/372 (51%), Gaps = 49/372 (13%)

Query: 17  SAPKSMVIGLIPGDGIGKEVIPAGKQVLENLSG-KHGLNFDFIDLQAGWGTFQETGKALP 75
           SAPK +V+  +PGD +G+E+     +VL+ +S  +  + FDF +   G      TG  LP
Sbjct: 2   SAPKKIVV--LPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLP 59

Query: 76  EQTVQVLKNQCQGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANVRP--------- 123
           ++ ++  K +    L GAV  P     G   P   ++ +RKEL LYAN+RP         
Sbjct: 60  DEALEASK-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLL 117

Query: 124 -VKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATI 182
            +  ++    +  D V+VRE    +Y    K    +  G  VA   ++ +    +RI  +
Sbjct: 118 DLSPIKPQFAKGTDFVVVRELVGGIYFGERK----EDDGDGVAWDCEQYTVPEVQRITRM 173

Query: 183 ALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDS 242
           A  +ALQ         +    K+NVL+ S  L+R   K V E+ K+++  +    Q++DS
Sbjct: 174 AAFMALQH---EPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDS 226

Query: 243 MVYRMFREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEP 295
               + + P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EP
Sbjct: 227 AAMILVKNPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEP 286

Query: 296 CHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQD------IYRAVDANLREDKVKT 349
           CHGSAPD+  K   NP+ATI S  +ML+ L  N P +       + R +DA +R     T
Sbjct: 287 CHGSAPDLP-KNKVNPVATILSAAMMLK-LSLNLPEEGKAIEDAVKRVLDAGIR-----T 339

Query: 350 PDLGGNSTTQQV 361
            DLGG+++T +V
Sbjct: 340 GDLGGSNSTTEV 351

>KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {ON}
           Anc_1.402 YCL018W
          Length = 447

 Score =  138 bits (348), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 125/379 (32%), Positives = 195/379 (51%), Gaps = 49/379 (12%)

Query: 14  AYASAPKSMVIGLIPGDGIGKEVIPAGKQVLENLSG-KHGLNFDFIDLQAGWGTFQETGK 72
           A A   K +V+  +PGD +G+E+     +VL  +S  +  +NFDF     G      TG 
Sbjct: 82  AMAQTTKHIVV--LPGDHVGQEITEEAIKVLNAISSVRPNVNFDFQHHLIGGAAIDATGV 139

Query: 73  ALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANVRPV----- 124
            LP++ ++  K +    L GAV  P     G   P   ++ +RKEL LYAN+RP      
Sbjct: 140 PLPDEALEASK-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASD 197

Query: 125 ----------KSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEV 174
                     + V+GT     D+ IVRE    +Y    K   D+  G  VA  +++ S  
Sbjct: 198 SLLDLSPLKPEIVKGT-----DICIVRELVGGIYFGERKE--DEGDG--VAWDSEKYSVS 248

Query: 175 ATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVA 234
             +RI  +A  +ALQ    N    +    K+NVL+ S  L+R   K V E+ K+++  + 
Sbjct: 249 EVQRITRMAGFLALQH---NPPLPVWSLDKANVLASSR-LWR---KTVEETIKNEFPTLT 301

Query: 235 YNEQIVDSMVYRMFREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE-- 289
              Q++DS    + + P   + VV+A N++GDI+SD A+ + GSLG++PSA++   P+  
Sbjct: 302 VQHQLIDSAAMILVKNPTHLNGVVIANNMFGDIISDEASVIPGSLGLLPSASLASLPDTN 361

Query: 290 --IVIGEPCHGSAPDIAGKGISNPIATIRSTGLMLEF-LGHNKPAQDIYRAVDANLREDK 346
               + EPCHGSAPD+  KG  NP+ATI S  +ML+  L   +    + +AV   L +  
Sbjct: 362 TAFGLYEPCHGSAPDLP-KGKVNPVATILSVAMMLKLSLNMTEEGIAVEKAVKQVL-DSG 419

Query: 347 VKTPDLGGNSTTQQVVEDI 365
           V+T DL G+++T +V + I
Sbjct: 420 VRTADLRGSNSTSEVGDAI 438

>Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W
           (LEU2) - beta-IPM (isopropylmalate) dehydrogenase
           [contig 82] FULL
          Length = 364

 Score =  136 bits (343), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 122/373 (32%), Positives = 192/373 (51%), Gaps = 47/373 (12%)

Query: 24  IGLIPGDGIGKEVIPAGKQVLENLSG-KHGLNFDFIDLQAGWGTFQETGKALPEQTVQVL 82
           I ++PGD +G+E+     +VL+ +S  +    F+F     G      TG+ LP+ +++  
Sbjct: 7   IVVLPGDHVGQEITEEAVKVLKAISEVRPEKQFEFQYHLIGGAAIDATGEPLPDASLEAA 66

Query: 83  KNQCQGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANVRPVK-SVEGTKD------ 132
           K +    L GAV  P     G   P   ++ +RKEL LYAN+RP   + E   D      
Sbjct: 67  K-KSDAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPLKP 124

Query: 133 ---RPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATIALDIALQ 189
              R  D V+VRE    +Y    K    + TG  VA  +++ S    +RI  +A  +ALQ
Sbjct: 125 ECARGTDFVVVRELVGGIYFGERK----EDTGDGVAWDSEQYSVPEVQRITRMAAFLALQ 180

Query: 190 RLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDSMVYRMFR 249
                   +L    K+NVL+ S  L+R   K V E+ K+++  +    Q++DS    + +
Sbjct: 181 HSPPLPVWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMILVK 233

Query: 250 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 302
            P   + V++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 234 NPTQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPD 293

Query: 303 IAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYR---AVDANLR---EDKVKTPDLGGNS 356
           +  KG  NPIATI S  +ML+       + D++    AV+  +R   +  V+T DL G S
Sbjct: 294 LP-KGKVNPIATILSAAMMLKL------SLDMFEEGAAVEEAVRKVLDSGVRTADLKGTS 346

Query: 357 TTQQVVEDILSKL 369
           TT +V E ++  L
Sbjct: 347 TTSEVGEAVVKAL 359

>KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.402
           YCL018W
          Length = 365

 Score =  134 bits (336), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 123/366 (33%), Positives = 184/366 (50%), Gaps = 49/366 (13%)

Query: 24  IGLIPGDGIGKEVIPAGKQVLE-------NLSGKHGLNFDFIDLQAGWGTFQETGKALPE 76
           I + PGD IG E++    +VL+       N+S K+  N+  I    G      TG+ L +
Sbjct: 7   ITVFPGDHIGTEIVRETVKVLDAIAEVSPNVSFKY--NYQLI----GGAAIDATGEPLTD 60

Query: 77  QTVQVLKNQCQGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANVRPVKSVEGTK-- 131
           + +QV KN     L GAV  P     G   P   ++ +RKELG+YAN+RP + V  T   
Sbjct: 61  EALQVAKNS-DAILLGAVGGPKWG-HGLVRPEQGLLKIRKELGVYANLRPCQFVSETLLD 118

Query: 132 ----DRPV----DMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATIA 183
                R +    D VIVRE    +Y    +   D      VA   +  S    +RI  +A
Sbjct: 119 LSPLKREIVQGTDFVIVRELVGGIYFGERQEAGDDG----VAWDKESYSVPEIQRITRMA 174

Query: 184 LDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDSM 243
             +ALQ    N    +    K+NVL+ S  L+R   K V E+ K+++  +  N  ++DS 
Sbjct: 175 AFLALQH---NPPLPVWSLDKANVLATSR-LWR---KTVEETIKNEFPTLTINHHLIDSA 227

Query: 244 VYRMFREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPC 296
              + + P   + VV+  N++GDI+SD A+ + GSLG++PSA++   P+    + + EPC
Sbjct: 228 AMTLVQNPTKLNGVVITTNMFGDIISDEASVIPGSLGLLPSASLASLPDKNDALGLYEPC 287

Query: 297 HGSAPDIAGKGISNPIATIRSTGLMLEF-LGHNKPAQDIYRAVDANLREDKVKTPDLGGN 355
           HGSAPD+     +NPIATI S  +M +  L   K    I  AV   + +  +KT DLGG 
Sbjct: 288 HGSAPDLPADH-ANPIATILSAAMMCKLSLNLTKEGNAIEEAVKRTI-DAGIKTGDLGGK 345

Query: 356 STTQQV 361
           +TT +V
Sbjct: 346 NTTTEV 351

>ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON}
           uniprot|Q96WI0 Zygosaccharomyces rouxii LEU2 3-
           isopropylmalate dehydrogenase
          Length = 362

 Score =  133 bits (335), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 118/364 (32%), Positives = 187/364 (51%), Gaps = 37/364 (10%)

Query: 24  IGLIPGDGIGKEVIPAGKQVLENLSG-KHGLNFDFIDLQAGWGTFQETGKALPEQTVQVL 82
           I ++PGD  G+E+     +VLE +S       F+F     G      TG  LP+  +   
Sbjct: 5   IVVLPGDHAGQEIAQEAIKVLEAISEVSPEAKFNFQHHLIGGAAIDATGSPLPDDALAAA 64

Query: 83  KNQCQGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANVRP----------VKSVEG 129
           K      L GAV  P     G   P   ++ +RKEL LYAN+RP          +  ++ 
Sbjct: 65  KKADA-VLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPLKP 122

Query: 130 TKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATIALDIALQ 189
              +  D V+VRE    +Y    K    +  G  VA  +++ ++   +R+  +A  +ALQ
Sbjct: 123 QHAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYTKPEVQRLTRMAAFLALQ 178

Query: 190 RLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDSMVYRMFR 249
               N    +    K+NVL+ S  L+R   K V E+ K+++ Q+  N Q++DS    + +
Sbjct: 179 H---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPQLKLNHQLIDSAAMILVK 231

Query: 250 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 302
            P   + +V+  NL+GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 232 SPTQLNGIVLTSNLFGDIISDEASVIPGSLGLLPSASLASLPDTNEAFGLYEPCHGSAPD 291

Query: 303 IAGKGISNPIATIRSTGLMLEF-LGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQV 361
           +  KG  NPIA I S  +ML+  L  +K  + + +AV   L +  V+T DLGG+++T +V
Sbjct: 292 LP-KGKVNPIAMILSAAMMLKLSLNLSKEGEAVEKAVKQVL-DSGVRTGDLGGSNSTSEV 349

Query: 362 VEDI 365
            + I
Sbjct: 350 GDAI 353

>CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}
          Length = 365

 Score =  132 bits (332), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 114/361 (31%), Positives = 184/361 (50%), Gaps = 38/361 (10%)

Query: 24  IGLIPGDGIGKEVIPAGKQVLENLSG--KHGLNFDFIDLQAGWGTFQETGKALPEQTVQV 81
           I ++PGD +G+E+     +VL  +       +NF F     G      TG  LP++ ++ 
Sbjct: 7   IVVLPGDHVGQEITEEAIKVLNAIQECRPDKVNFKFDHHLIGGAAIDATGVPLPDEALEA 66

Query: 82  LKNQCQGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANVRP----------VKSVE 128
            K +    L GAV  P     G   P   ++ +RKEL LYAN+RP          +  ++
Sbjct: 67  SK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPLK 124

Query: 129 GTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATIALDIAL 188
               R  D V+VRE    +Y    K    +  G  VA  +++ S    +RI  +A  +AL
Sbjct: 125 PEIARGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFMAL 180

Query: 189 QRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDSMVYRMF 248
           Q    N    +    K+NVL+ S  L+R   K V E+ K+++ Q+    Q++DS    + 
Sbjct: 181 QH---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPQLTVQHQLIDSAAMILV 233

Query: 249 REPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAP 301
           + P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAP
Sbjct: 234 KNPTHLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAP 293

Query: 302 DIAGKGISNPIATIRSTGLMLEF-LGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQ 360
           D+  KG  NP+ATI S  +ML+  L   +  + I +AV   L +  ++T DL G ++T +
Sbjct: 294 DLP-KGKVNPVATILSAAMMLKLSLDLFEEGEIIEQAVKKVL-DSGIRTADLKGTNSTTE 351

Query: 361 V 361
           V
Sbjct: 352 V 352

>Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON}
           (182096..183190) [1095 nt, 365 aa]
          Length = 364

 Score =  132 bits (331), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 117/366 (31%), Positives = 183/366 (50%), Gaps = 48/366 (13%)

Query: 24  IGLIPGDGIGKEVIPAGKQVLENL--SGKHGLNFDFIDLQAGWGTFQETGKALPEQTVQV 81
           I ++PGD +G+E++    +VLE +  S   G+ F+F     G  +   TG  LP++ +  
Sbjct: 6   IVVLPGDHVGEEIVDEAIKVLEAVASSSSKGIKFEFQRHLIGGASIDATGTPLPDEALDA 65

Query: 82  LKNQCQGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANVRPVKSVEGTK------- 131
            KN     L GAV  P     G   P   ++ +RKEL LYAN+RP   V  +        
Sbjct: 66  AKNS-DAVLLGAVGGPKWGT-GDVRPEQGLLKIRKELQLYANLRPCNFVSDSLLGLSPLK 123

Query: 132 ---DRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATIALDIAL 188
               +  D  +VRE    +Y    K   D   G+        I EV  +RI  +A  +AL
Sbjct: 124 EEIAKGTDFTVVRELVGGIYFGDRKE--DDGDGSAWDCEKYTIPEV--QRITRMAAFLAL 179

Query: 189 QRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDSMVYRMF 248
           Q    +    +    K+NVL+ S  L+R   K V E+ K+++  +    Q++DS    + 
Sbjct: 180 QH---DPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPNLKVQHQLIDSAAMILV 232

Query: 249 REPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAP 301
           + P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAP
Sbjct: 233 KSPRQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAP 292

Query: 302 DIAGKGISNPIATIRSTGLMLEFLGHN------KPAQDIYRAVDANLREDKVKTPDLGGN 355
           D+  KG  NPIATI S  +ML+ L  N         Q + + +DA +R     T DL G+
Sbjct: 293 DLP-KGKVNPIATILSAAMMLK-LSLNLVDEGIAIEQAVKQVLDAGIR-----TADLKGS 345

Query: 356 STTQQV 361
           ++T +V
Sbjct: 346 NSTSEV 351

>SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {ON}
           highly similar to uniprot|P04173 Saccharomyces
           cerevisiae YCL018W LEU2 Beta-isopropylmalate
           dehydrogenase catalyzes the third step in the leucine
           biosynthesis pathway
          Length = 364

 Score =  130 bits (327), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 117/371 (31%), Positives = 188/371 (50%), Gaps = 47/371 (12%)

Query: 17  SAPKSMVIGLIPGDGIGKEVIPAGKQVLENLSG-KHGLNFDFIDLQAGWGTFQETGKALP 75
           SAPK +V+  +PGD +G+E+     +VL+ +S  +  + FD+     G      TG  LP
Sbjct: 2   SAPKKIVV--LPGDHVGQEITAEAIRVLDAISEVRPDVKFDYQYHLIGGAAIDATGVPLP 59

Query: 76  EQTVQVLKNQCQGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANVRP--------- 123
           ++ +   K      L GAV  P     G   P   ++ +RKEL LYAN+RP         
Sbjct: 60  DEALDAAKKADA-VLLGAVGGPKWGT-GQVRPEQGLLKIRKELQLYANLRPCNFASDSLL 117

Query: 124 -VKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATI 182
            +  ++    +  D V+VRE    +Y    K    +  G  VA  +++ S    +RI  +
Sbjct: 118 DLSPLKPEYAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRM 173

Query: 183 ALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDS 242
           A  +ALQ+   N    +    K+NVL+ S  L+R   K V E+ K+++  +    Q++DS
Sbjct: 174 AAFLALQQ---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDS 226

Query: 243 MVYRMFREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEP 295
               + + P   + +V+  N++GDI+SD A+ + GSLG++PSA++   P+      + EP
Sbjct: 227 AAMILVKSPTKLNGIVITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEP 286

Query: 296 CHGSAPDIAGKGISNPIATIRSTGLMLEFLGH-----NKPAQDIYRAVDANLREDKVKTP 350
           CHGSAPD+  K   NPIATI S  +ML+   +     N   + + R +DA +R     T 
Sbjct: 287 CHGSAPDLP-KNKVNPIATILSAAMMLKLSLNLVEEGNAVEEAVRRVLDAGIR-----TA 340

Query: 351 DLGGNSTTQQV 361
           DL G ++T +V
Sbjct: 341 DLRGENSTSEV 351

>Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  128 bits (322), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 114/360 (31%), Positives = 184/360 (51%), Gaps = 37/360 (10%)

Query: 24  IGLIPGDGIGKEVIPAGKQVLENLSG-KHGLNFDFIDLQAGWGTFQETGKALPEQTVQVL 82
           I ++PGD +G+E+     +VL+ +S  +  + FDF     G      TG  L ++ ++  
Sbjct: 7   IVVLPGDHVGQEITEEAIKVLKAISEVRPNVKFDFEYHLIGGAAIDATGVPLTDEALEAS 66

Query: 83  KNQCQGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANVRP----------VKSVEG 129
           K +    L GAV  P     G   P   ++ +RKEL LYAN+RP          +  ++ 
Sbjct: 67  K-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLELSPIKP 124

Query: 130 TKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATIALDIALQ 189
              R  D V+VRE    +Y    K    +  G  VA  +++ +    +RI  +A  +ALQ
Sbjct: 125 QFARGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRMAAFMALQ 180

Query: 190 RLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDSMVYRMFR 249
                   +L    K+NVL+ S  L+R   K V E+ K+++  +    Q++DS    + +
Sbjct: 181 HQPPLPIWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILVK 233

Query: 250 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 302
            P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 234 NPTQLNGIIITSNMFGDIISDEASCIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 293

Query: 303 IAGKGISNPIATIRSTGLMLEF-LGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQV 361
           +  K   NPIATI S  +ML+  L      Q I  AV   L +  ++T DLGG+++T +V
Sbjct: 294 LP-KNKVNPIATILSAAMMLKLSLNMTAEGQAIEDAVKKVL-DAGIRTGDLGGSNSTIEV 351

>NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {ON}
           Anc_1.402
          Length = 365

 Score =  125 bits (314), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 114/365 (31%), Positives = 182/365 (49%), Gaps = 38/365 (10%)

Query: 24  IGLIPGDGIGKEVIPAGKQVLENLSG--KHGLNFDFIDLQAGWGTFQETGKALPEQTVQV 81
           I ++PGD +G E+     +VL+ +       + FDF     G       G  L ++ ++ 
Sbjct: 7   IVVLPGDHVGGEITEEAIKVLKAIEQVESSKVKFDFQYHLIGGAAIDAAGVPLTDEALEA 66

Query: 82  LKNQCQGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANVRPVKSVEG-----TKDR 133
            K +    L GAV  P     G   P   ++ +RKELGLYAN+RP           +  R
Sbjct: 67  SK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASEPLLGLSPLR 124

Query: 134 P-----VDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATIALDIAL 188
           P      D ++VRE    +Y    K    +  G  VA  +++ S     RI  +A  +AL
Sbjct: 125 PEIAKGTDFMVVRELVGGIYFGERK----EDDGDGVAWDSEKYSVPEVERITRMAAFLAL 180

Query: 189 QRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDSMVYRMF 248
           Q    N    +    K+NVL+ S  L+R   K V  + K+++  +    Q++DS    + 
Sbjct: 181 QH---NPPLPIWSLDKANVLASSR-LWR---KTVEATIKNEFPTLTVQNQLIDSAAMILV 233

Query: 249 REPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAP 301
           + P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAP
Sbjct: 234 KNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAP 293

Query: 302 DIAGKGISNPIATIRSTGLMLEF-LGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQ 360
           D+  K   NP+ATI S  +ML+  L   K  + +  AV   L +  V+T DLGG+++TQ+
Sbjct: 294 DLP-KNKVNPVATILSAAMMLKLSLNMVKEGEAVEEAVRRVL-DAGVRTGDLGGSNSTQE 351

Query: 361 VVEDI 365
           V + I
Sbjct: 352 VGDAI 356

>TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  110 bits (275), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 107/370 (28%), Positives = 182/370 (49%), Gaps = 46/370 (12%)

Query: 19  PKSMVIGLIPGDGIGKEVIPAGKQVLENLSG--KHGLNFDFIDLQAGWGTFQETGKALPE 76
           P+   I ++PGD +G EV     ++L+ +     + + F+F     G      TG  LP+
Sbjct: 2   PEIKNIVVLPGDHVGGEVTEEAVKILKAIEEVRNNKVKFNFEYHLIGGAAIDATGNPLPD 61

Query: 77  QTVQVLKNQCQGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANVRP---------- 123
           ++++  K +    L GAV  P     G   P   ++ +RKEL LYAN+RP          
Sbjct: 62  ESLEASK-RADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLD 119

Query: 124 VKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATIA 183
           +  ++    +  D  +VRE    +Y    K    +  G  VA  +++ S    +RI  +A
Sbjct: 120 LSPLKEKYAKGTDFTVVRELVGGIYFGKRK----EDDGDGVAWDSEQYSVPEVQRITRMA 175

Query: 184 LDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDSM 243
             +A+Q    N    +    K+NVL+ S  L+R   K V E+ ++++  +  + Q++DS 
Sbjct: 176 AFLAMQH---NPPLPIWSLDKANVLASSR-LWR---KTVEETIQNEFPSLKVSHQLIDSA 228

Query: 244 VYRMFREPECFD-VVVAPNLYGDILSDGAAALVG--------SLGVVPSANVGPEIVIGE 294
              + + P   + +++  N++GDI+SD A+ + G        SL  +P  N      + E
Sbjct: 229 AMILVKNPTQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLSSLPDTNSA--FGLYE 286

Query: 295 PCHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLR---EDKVKTPD 351
           PCHGSAPD+  KG  NPI TI S  +ML+ L  N   + I  AV+  +R   ++ ++T D
Sbjct: 287 PCHGSAPDLP-KGKVNPIGTILSVAMMLK-LSLNLKEEGI--AVEEAVRRVLDNNIRTAD 342

Query: 352 LGGNSTTQQV 361
           LGG+++T  +
Sbjct: 343 LGGSNSTSDI 352

>Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W
           (IDP1) - Mitochondrial form of NADP-specific isocitrate
           dehydrogenase [contig 1] FULL
          Length = 422

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 94/204 (46%), Gaps = 16/204 (7%)

Query: 101 VEGYSSPIVALRKELGLYANVRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKAT 160
           V G+  PI+     +G +A+    ++ +   ++   + +V    +    K+ + +  K T
Sbjct: 129 VPGWQKPII-----IGRHAHGDQYRATDAIIEKAGKLELVHRPADGSEPKILQVHEFKGT 183

Query: 161 GTRVAEATKRISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICK 220
           G R        ++ + R  A  +  +AL +        L ++ K+ +L Q DG F++I +
Sbjct: 184 GARGVALAMYNTDESIRGFAHASFKLALSK-----RLNLFMSTKNTILKQYDGRFKDIFQ 238

Query: 221 DVYESNKDKYGQ---VAYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGS 277
           +VY        +   ++Y  +++D MV +M +    F V+   N  GD+LSD  A   GS
Sbjct: 239 EVYAQEYQTQFRDEGISYEHRLIDDMVAQMIKSRGGF-VMALKNYDGDVLSDIVAQGFGS 297

Query: 278 LGVVPSANVGPE--IVIGEPCHGS 299
           LG++ S  V P+      E  HG+
Sbjct: 298 LGLMTSMLVTPDGKTFESEAAHGT 321

>KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {ON}
           Anc_1.396 YLR174W
          Length = 421

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 67/126 (53%), Gaps = 11/126 (8%)

Query: 179 IATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQVA--Y 235
            A  + ++AL+R        L  T K+ VL + DG F++I +++YES+ K ++ ++   Y
Sbjct: 195 FARASFEMALKR-----KMPLFFTTKNTVLKRYDGKFKDIFQEMYESDYKVQFDEIGILY 249

Query: 236 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 293
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      
Sbjct: 250 EHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSMLVAPDGKTFES 308

Query: 294 EPCHGS 299
           E  HG+
Sbjct: 309 EAAHGT 314

>Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON}
           (207889..209172) [1284 nt, 428 aa]
          Length = 427

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 63/115 (54%), Gaps = 6/115 (5%)

Query: 190 RLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--VAYNEQIVDSMVYR 246
           +L  N    L ++ K+ +L + DG F++I +++YES+ K ++    ++Y  +++D MV +
Sbjct: 209 KLAINKKLNLFLSTKNTILKKYDGRFKDIFQEIYESDYKSQFENLGISYEHRLIDDMVAQ 268

Query: 247 MFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 299
           M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 269 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGT 322

>CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066w IDP1 isocitrate dehydrogenase or uniprot|P41939
           Saccharomyces cerevisiae YLR174w IDP2 or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3
          Length = 423

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 72/133 (54%), Gaps = 11/133 (8%)

Query: 172 SEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKY 230
           ++ + R  A  +  +ALQ+ K N    L ++ K+ +L + DG F++I ++VY+S  K K+
Sbjct: 197 TDESIRGFAHSSFKLALQK-KLN----LFLSTKNTILKKYDGRFKDIFQEVYDSEYKQKF 251

Query: 231 GQ--VAYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP 288
            +  + Y  +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  + P
Sbjct: 252 AELNITYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILITP 310

Query: 289 E--IVIGEPCHGS 299
           +      E  HG+
Sbjct: 311 DGKTFESEAAHGT 323

>TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.254
           YDL066W
          Length = 433

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 88/182 (48%), Gaps = 19/182 (10%)

Query: 190 RLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYG--QVAYNEQIVDSMVYR 246
           +L  +    L ++ K+ +L + DG F+++ ++V++S  KDK+    + Y  +++D MV +
Sbjct: 220 KLAIDKKLDLFLSTKNTILKKYDGRFKDVFQEVFDSTYKDKFEALNIKYEHRLIDDMVAQ 279

Query: 247 MFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGSAP--- 301
           M +    + ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+     
Sbjct: 280 MIKSKGGY-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGTVTRHY 338

Query: 302 --DIAGKGIS-NPIATI--RSTGLMLEFLGHNKP-----AQDIYRAVDANLREDKVKTPD 351
                GK  S N IA+I   S GL       N P     AQ + +A    ++ED + T D
Sbjct: 339 RQHQQGKQTSTNSIASIFAWSRGLAKRGELDNTPDVMKFAQTLEKATLDTVQEDGIMTKD 398

Query: 352 LG 353
           L 
Sbjct: 399 LA 400

>YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}
           IDP1Mitochondrial NADP-specific isocitrate
           dehydrogenase, catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate; not required for mitochondrial
           respiration and may function to divert
           alpha-ketoglutarate to biosynthetic processes
          Length = 428

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 100/207 (48%), Gaps = 28/207 (13%)

Query: 190 RLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--VAYNEQIVDSMVYR 246
           +L  +    L ++ K+ +L + DG F++I ++VYE+  K K+ Q  + Y  +++D MV +
Sbjct: 215 KLAIDKKLNLFLSTKNTILKKYDGRFKDIFQEVYEAQYKSKFEQLGIHYEHRLIDDMVAQ 274

Query: 247 MFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGSAPDIA 304
           M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+     
Sbjct: 275 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGTVTRHY 333

Query: 305 GK------GISNPIATI--RSTGLMLEFLGHNKPA----QDIYRAVDAN-LREDKVKTPD 351
            K        +N IA+I   S GL+      N PA     +I  +   N +++D + T D
Sbjct: 334 RKYQKGEETSTNSIASIFAWSRGLLKRGELDNTPALCKFANILESATLNTVQQDGIMTKD 393

Query: 352 LG---GNS------TTQQVVEDILSKL 369
           L    GN+      TT++ ++ +  +L
Sbjct: 394 LALACGNNERSAYVTTEEFLDAVEKRL 420

>SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 421

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 80/298 (26%), Positives = 137/298 (45%), Gaps = 46/298 (15%)

Query: 101 VEGYSSPIVALRKELGLYANVRPVKSVEGTKDRP--VDMVIVRENTEDLYIKLEKTYVDK 158
           V G+  PI+     +G +A+    K+ +     P  +++V   EN  +   K+ + Y  K
Sbjct: 133 VPGWEKPII-----IGRHAHGDQYKATDAVIPGPGKLELVYKPENGPE---KVMEVYDYK 184

Query: 159 ATGTRVAEATKRISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREI 218
             G  +A      +E + R  A  +  +AL + K N    L ++ K+ +L + DG F++I
Sbjct: 185 GPGVALAMYN---TEESIRGFAHASFKLALTK-KLN----LYLSTKNTILKKYDGRFKDI 236

Query: 219 CKDVYESNKDKYGQVA---YNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALV 275
            +++Y++   K  + A   Y  +++D MV +M +    F ++   N  GD+ SD  A   
Sbjct: 237 FQELYDAEYKKQFEAAGIYYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGF 295

Query: 276 GSLGVVPSANVGPE--IVIGEPCHGSAP-----DIAGKGIS-NPIATI--RSTGLMLEFL 325
           GSLG++ S  V P+      E  HG+          GK  S N IA+I   S GL     
Sbjct: 296 GSLGLMTSVLVTPDGKTFESEAAHGTVTRHYRQHQQGKETSTNSIASIFAWSRGLAKRGE 355

Query: 326 GHNKPA----QDIYRAVDAN-LREDKVKTPDL---GGNS------TTQQVVEDILSKL 369
             N P      +I  A   N +++D + T DL   GGN+      TT + ++ + ++L
Sbjct: 356 LDNTPQVVRFANILEAATLNTVQQDGIMTKDLALAGGNTDRSAYVTTNEFLDAVEARL 413

>CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174w IDP2 isocitrate dehydrogenase or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3 or uniprot|P21954
           Saccharomyces cerevisiae YDL066w IDP1
          Length = 418

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 66/126 (52%), Gaps = 11/126 (8%)

Query: 179 IATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYGQ--VAY 235
            A  + ++A++R        L  T K+ +L + DG F++I + +Y E  K K+ +  ++Y
Sbjct: 193 FARASFELAIKR-----KLPLFFTTKNTILKKYDGRFKDIFQKMYDEDYKGKFKELGISY 247

Query: 236 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 293
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  + P+  I   
Sbjct: 248 EHRLIDDMVAQMIKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSTLLTPDGKIFES 306

Query: 294 EPCHGS 299
           E  HG+
Sbjct: 307 EAAHGT 312

>NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON}
           Anc_4.254
          Length = 424

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 62/115 (53%), Gaps = 6/115 (5%)

Query: 190 RLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--VAYNEQIVDSMVYR 246
           +L  +    L ++ K+ +L + DG F++I + +YE++ K K+ Q  + Y  +++D MV +
Sbjct: 215 KLAIDKKLNLFLSTKNTILKKYDGRFKDIFQSIYETHYKAKFQQLNINYEHRLIDDMVAQ 274

Query: 247 MFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 299
           M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 275 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii AAL022W
          Length = 415

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 63/126 (50%), Gaps = 11/126 (8%)

Query: 179 IATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQVA--Y 235
            A  + ++AL+R        L  T K+ +L + DG F++I + +YE   K K+  V   Y
Sbjct: 194 FAKSSFELALER-----KMPLYSTTKNTILKKYDGQFKDIFEGMYEREYKQKFEAVGIWY 248

Query: 236 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 293
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      
Sbjct: 249 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVSPDGKTFES 307

Query: 294 EPCHGS 299
           E  HG+
Sbjct: 308 EAAHGT 313

>Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 62/115 (53%), Gaps = 6/115 (5%)

Query: 190 RLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--VAYNEQIVDSMVYR 246
           +L  +    L ++ K+ +L + DG F++I ++VYE+  K K+ +  + Y  +++D MV +
Sbjct: 216 KLAIDKKLNLFLSTKNTILKKYDGRFKDIFQEVYEAEYKSKFEKLGIHYEHRLIDDMVAQ 275

Query: 247 MFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 299
           M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 276 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 329

>AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR174W (IDP2) and
           YNL009W (IDP3)
          Length = 415

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 179 IATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKY--GQVAY 235
            A  + ++ALQR        L  T K+ +L + DG F++I + +Y +  K+K+    + Y
Sbjct: 194 FAKSSFELALQR-----KMPLYSTTKNTILKKYDGKFKDIFEGMYAAEYKEKFEAAGIWY 248

Query: 236 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 293
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      
Sbjct: 249 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVSPDGKTFES 307

Query: 294 EPCHGS 299
           E  HG+
Sbjct: 308 EAAHGT 313

>NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa]
           {ON} Anc_1.396
          Length = 413

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 61/126 (48%), Gaps = 11/126 (8%)

Query: 179 IATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQ---VAY 235
            A  +  +AL+R        L  T K+ +L + DG F+ + +D+YE    +  +   + Y
Sbjct: 194 FARSSFQLALER-----QLPLYSTTKNTILKKYDGKFKSVFEDMYEREYKQQFEDLGIWY 248

Query: 236 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 293
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      
Sbjct: 249 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVAPDGKTFES 307

Query: 294 EPCHGS 299
           E  HG+
Sbjct: 308 EAAHGT 313

>KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 413

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 91/195 (46%), Gaps = 24/195 (12%)

Query: 177 RRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--V 233
           R  A  + ++ALQR        L  T K+ +L + DG F++  + +YE+  ++++ +  +
Sbjct: 192 RGFARASFELALQR-----KMPLYSTTKNTILKRYDGRFKDEFEAMYEAEYRERFERAGI 246

Query: 234 AYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IV 291
            Y  +++D MV +M +    F V+   N  GD+ SD  A   GSLG++ S  V P+    
Sbjct: 247 WYEHRLIDDMVAQMLKSAGGF-VIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGRAF 305

Query: 292 IGEPCHGSAP-----DIAGKGIS-NPIATI--RSTGLMLEFLGHNKP-----AQDIYRAV 338
             E  HG+          GK  S N IA+I   + GL+        P     A+ +  A 
Sbjct: 306 ESEAAHGTVTRHFRLHQQGKETSTNSIASIFAWTRGLLQRGRLDGTPEVEGFARALETAT 365

Query: 339 DANLREDKVKTPDLG 353
            A + ED + T DL 
Sbjct: 366 VATVNEDGIMTKDLA 380

>KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 429

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 99/204 (48%), Gaps = 19/204 (9%)

Query: 101 VEGYSSPIVALRKELGLYANVRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKAT 160
           V G+  PIV     +G +A+    K+ +     P  + +V + T+    K  + Y  K  
Sbjct: 140 VPGWEKPIV-----IGRHAHGDQYKATDLVVPGPGKLELVYKPTDGSETKTLEVYDYKGP 194

Query: 161 GTRVAEATKRISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICK 220
           G  +A      ++ + R  A  +  +A+ + K N    L ++ K+ +L + DG F++I +
Sbjct: 195 GIALAMYN---TDESIRGFAHASFKLAITK-KLN----LYLSTKNTILKKYDGRFKDIFQ 246

Query: 221 DVYESN-KDKYGQ--VAYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGS 277
           ++Y+S  K ++ +  + Y  +++D MV +M +    F ++   N  GD+ SD  A   GS
Sbjct: 247 EIYDSEYKSEFEKLGIWYEHRLIDDMVAQMIKSKGGF-ILAFKNYDGDVQSDIVAQGFGS 305

Query: 278 LGVVPSANVGPE--IVIGEPCHGS 299
           LG++ S  V P+      E  HG+
Sbjct: 306 LGLMTSVLVTPDGKAFESEAAHGT 329

>KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {ON}
           Anc_1.396 YLR174W
          Length = 412

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 58/106 (54%), Gaps = 6/106 (5%)

Query: 199 LTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--VAYNEQIVDSMVYRMFREPECFD 255
           L  T K+ +L + DG+F++I + +YE   K+K+ +  + Y  +++D MV +M +    + 
Sbjct: 210 LYSTTKNTILKKYDGMFKDIFEGMYEREYKEKFEELGIWYEHRLIDDMVAQMLKSSGGY- 268

Query: 256 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 299
           ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+
Sbjct: 269 IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFESEAAHGT 314

>KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.396
           YLR174W
          Length = 408

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 56/106 (52%), Gaps = 6/106 (5%)

Query: 199 LTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--VAYNEQIVDSMVYRMFREPECFD 255
           L  T K+ +L Q DG F++I K VYE+  K+ + +  + Y  +++D MV +M +    F 
Sbjct: 205 LYSTTKNTILKQYDGQFKDIFKTVYENEYKETFEELGIWYEHRLIDDMVAQMLKSKGGF- 263

Query: 256 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 299
           ++   N  GD+ SD  A   GSLG++ S  +  +      E  HG+
Sbjct: 264 IIAMKNYDGDVQSDIVAQGFGSLGLMTSTLIAADGKTFESEAAHGT 309

>Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa]
           {ON} complement(198298..199557) [1260 nt, 420 aa]
          Length = 419

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 56/106 (52%), Gaps = 6/106 (5%)

Query: 199 LTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--VAYNEQIVDSMVYRMFREPECFD 255
           L  T K+ +L + DG +++I  D+YE + KDK+    + Y  +++D MV +M +    F 
Sbjct: 212 LYSTTKNTILKKYDGQYKDIFNDMYEKDYKDKFEAKGIWYEHRLIDDMVAQMLKSKGGF- 270

Query: 256 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 299
           V+   N  GD+ SD  A   GSLG++ S  +  +      E  HG+
Sbjct: 271 VIAMKNYDGDVQSDVVAQGFGSLGLMSSILISDDGKTFESEAAHGT 316

>TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {ON}
           Anc_1.396 YLR174W
          Length = 418

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 179 IATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYG--QVAY 235
            A  + + AL+R        L  T K+ +L Q DG F++I +++Y +  +DK+    + Y
Sbjct: 198 FAKASFEFALER-----KIPLYSTTKNTILKQYDGKFKDIFEEMYAKEYEDKFKVLNIWY 252

Query: 236 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 293
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 253 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDVVAQGFGSLGLMTSVLLTPDGSSFES 311

Query: 294 EPCHGS 299
           E  HG+
Sbjct: 312 EAAHGT 317

>Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W
           (REAL)
          Length = 428

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 57/207 (27%), Positives = 98/207 (47%), Gaps = 28/207 (13%)

Query: 190 RLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--VAYNEQIVDSMVYR 246
           +L  +    L ++ K+ +L + DG F++I + VYE+  K K+    + Y  +++D MV +
Sbjct: 215 KLAIDKKLNLFLSTKNTILKKYDGRFKDIFQKVYEAQYKSKFEALGIHYEHRLIDDMVAQ 274

Query: 247 MFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGSAPDIA 304
           M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+     
Sbjct: 275 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGTVTRHY 333

Query: 305 GK------GISNPIATI--RSTGLMLEFLGHNKPA----QDIYRAVDAN-LREDKVKTPD 351
            K        +N IA+I   S GL+      N PA     +I  +   N +++D + T D
Sbjct: 334 RKYQKGEETSTNSIASIFAWSRGLLKRGELDNTPALCKFANILESATLNTVQQDGIMTKD 393

Query: 352 LG---GNS------TTQQVVEDILSKL 369
           L    GN+      TT++ ++ +  +L
Sbjct: 394 LALACGNNERSAYVTTEEFLDAVEKRL 420

>TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.254
           YDL066W
          Length = 423

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 62/115 (53%), Gaps = 6/115 (5%)

Query: 190 RLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKY--GQVAYNEQIVDSMVYR 246
           +L  N    L ++ K+ +L + DG F++I ++++++  K ++    ++Y  +++D MV +
Sbjct: 210 KLALNKKLNLFLSTKNTILKKYDGRFKDIFQEIFDAEYKTQFEAANISYEHRLIDDMVAQ 269

Query: 247 MFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 299
           M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 270 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGT 323

>KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.396
           YLR174W
          Length = 424

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 66/126 (52%), Gaps = 11/126 (8%)

Query: 179 IATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--VAY 235
            A  + ++AL+R        L    K+ +L + DGLF++I + +Y+ + K K+ +  + +
Sbjct: 195 FAKSSFELALKR-----KLPLFFATKNTILKEYDGLFKDIFEKLYKDHYKTKFEELGITF 249

Query: 236 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 293
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P+  +   
Sbjct: 250 EHRLIDDMVAQMLKSNGGF-ILSLKNYDGDVQSDIVAQGFGSLGLMTSMLVTPDDSVFES 308

Query: 294 EPCHGS 299
           E  HG+
Sbjct: 309 EAAHGT 314

>ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174W IDP2 Cytosolic NADP-specific
           isocitrate dehydrogenase catalyzes oxidation of
           isocitrate to alpha- ketoglutarate levels are elevated
           during growth on non- fermentable carbon sources and
           reduced during growth on glucose
          Length = 411

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 64/127 (50%), Gaps = 13/127 (10%)

Query: 179 IATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYE----SNKDKYGQVA 234
            A  + ++AL+R        L  T K+ +L + DG F++I + +YE    S  +K G + 
Sbjct: 193 FAKASFELALER-----KQPLYSTTKNTILKKYDGKFKDIFEAMYEKEYRSQFEKLG-IW 246

Query: 235 YNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVI 292
           Y  +++D MV +M +    + ++   N  GD+ SD  A   GSLG++ S  V P+     
Sbjct: 247 YEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFE 305

Query: 293 GEPCHGS 299
            E  HG+
Sbjct: 306 SEAAHGT 312

>Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP2)
           - Cytosolic form of NADP-dependent isocitrate
           dehydrogenase [contig 82] FULL
          Length = 411

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 55/194 (28%), Positives = 90/194 (46%), Gaps = 26/194 (13%)

Query: 179 IATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVY----ESNKDKYGQVA 234
            A  + ++ALQR        L  T K+ +L + DG F+++ + +Y    +S  ++ G + 
Sbjct: 192 FARASFELALQR-----RMPLYSTTKNTILKKYDGKFKDVFEAMYAAEYQSRFEELG-IW 245

Query: 235 YNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVI 292
           Y  +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P+     
Sbjct: 246 YEHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFE 304

Query: 293 GEPCHGSAP-----DIAGKGIS-NPIATI--RSTGLMLEFLGHNKP-----AQDIYRAVD 339
            E  HG+          GK  S N IA+I   + G++      N P     A+ +  A  
Sbjct: 305 SEAAHGTVTRHYRLHQQGKETSTNSIASIFAWTRGILQRGKLDNTPEVVHFAESLEAATI 364

Query: 340 ANLREDKVKTPDLG 353
           A + +D V T DL 
Sbjct: 365 ATVDQDGVMTKDLA 378

>SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 411

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 65/126 (51%), Gaps = 11/126 (8%)

Query: 179 IATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQVA--Y 235
            A  + ++AL+R        L  T K+ +L + DG F++I + +Y S+ +DK+  +   Y
Sbjct: 192 FAKASFELALER-----KLPLYSTTKNTILKRYDGKFKDIFESMYASDYQDKFEVIGIWY 246

Query: 236 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 293
             +++D MV +M +    + ++   N  GD+ SD  A   GSLG++ S  V P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMSSVLVTPDGKTFES 305

Query: 294 EPCHGS 299
           E  HG+
Sbjct: 306 EAAHGT 311

>Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 59/106 (55%), Gaps = 6/106 (5%)

Query: 199 LTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--VAYNEQIVDSMVYRMFREPECFD 255
           L ++ K+ +L + DG F++I +++YE+  K K+ +  + Y  +++D MV +M +    F 
Sbjct: 225 LFLSTKNTILKKYDGRFKDIFQNIYEAQYKPKFEELGIHYEHRLIDDMVAQMVKSKGGF- 283

Query: 256 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 299
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 284 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 329

>NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {ON}
           Anc_1.396
          Length = 418

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 65/128 (50%), Gaps = 12/128 (9%)

Query: 199 LTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYGQ--VAYNEQIVDSMVYRMFREPECFD 255
           L  T K+ +L + DG F++I  ++Y    KD++ +  + Y  +++D MV +M +    F 
Sbjct: 211 LYFTTKNTILKKYDGTFKDIFMEMYLNEYKDEFDKLGIFYEHRLIDDMVAQMLKSKGGF- 269

Query: 256 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGSAP-----DIAGKGI 308
           ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+         AGK  
Sbjct: 270 IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFQSEAAHGTVTRHYRLHQAGKPT 329

Query: 309 S-NPIATI 315
           S N IA+I
Sbjct: 330 STNSIASI 337

>NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396
          Length = 419

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 57/106 (53%), Gaps = 6/106 (5%)

Query: 199 LTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQV--AYNEQIVDSMVYRMFREPECFD 255
           L +  K+ +L + DG F+ I  D+Y++  K+K+ ++   Y  +++D MV +M +    F 
Sbjct: 210 LFLATKNTILKKYDGRFKSIFDDMYQNEFKEKFEKLGLTYEHRLIDDMVAQMLKSKGGF- 268

Query: 256 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 299
           ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+
Sbjct: 269 IIAMKNYDGDVQSDIVAQGFGSLGLMTSQLITPDGKTFQSEAAHGT 314

>KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {ON}
           Anc_4.254 YDL066W
          Length = 421

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 56/111 (50%), Gaps = 6/111 (5%)

Query: 194 NGHATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--VAYNEQIVDSMVYRMFRE 250
           N    L +  K+ +L + DG F++I + +Y    K K+ Q  + Y  +++D MV +M + 
Sbjct: 214 NKKLNLFLATKNTILKKYDGRFKDIFQQIYNGQYKAKFEQLGITYEHRLIDDMVAQMIKS 273

Query: 251 PECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 299
              F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 274 KGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVSPDGKTFESEAAHGT 323

>TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 58/114 (50%), Gaps = 6/114 (5%)

Query: 191 LKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQ---VAYNEQIVDSMVYRM 247
           L  N +  L +  K+ +L + DG F++I +++YE+   K  +   + Y  +++D MV +M
Sbjct: 214 LAVNKNMNLFLATKNTILKKYDGRFKDIFQEIYENEYKKEFERLNITYEHRLIDDMVAQM 273

Query: 248 FREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 299
            +    + ++   N  GD+ SD  A   GSLG++ S    P+      E  HG+
Sbjct: 274 IKSKGGY-IMALKNYDGDVQSDIVAQGFGSLGLMTSILASPDGKTFESEAAHGT 326

>TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa]
           {ON} Anc_1.396 YLR174W
          Length = 414

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 64/127 (50%), Gaps = 13/127 (10%)

Query: 179 IATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICK----DVYESNKDKYGQVA 234
            A  + ++AL+R        L  T K+ +L + DG F+++ +    D Y+S  ++ G + 
Sbjct: 191 FAKASFELALER-----KLPLYSTTKNTILKKYDGKFKDVFEQMYADQYQSRFEELG-IW 244

Query: 235 YNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVI 292
           Y  +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P+     
Sbjct: 245 YEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLVTPDGKTFE 303

Query: 293 GEPCHGS 299
            E  HG+
Sbjct: 304 SEAAHGT 310

>Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/218 (25%), Positives = 100/218 (45%), Gaps = 33/218 (15%)

Query: 179 IATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYGQ--VAY 235
            A  + ++A++R        L  T K+ +L + DG F+++ + +Y ES K+K+    + Y
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEGMYAESYKEKFESLGIWY 246

Query: 236 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 293
             +++D MV +M +    + ++   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKTFES 305

Query: 294 EPCHGSAP-----DIAGKGIS-NPIATI--RSTGLMLEFLGHNKP-----AQDIYRAVDA 340
           E  HG+          GK  S N IA+I   + G++      N P      Q +  A   
Sbjct: 306 EAAHGTVTRHFRQHQQGKETSTNSIASIFAWTRGIIQRGKLDNTPDVVKFGQILESATVN 365

Query: 341 NLREDKVKTPDLG---------GNSTTQQVVEDILSKL 369
            ++ED + T DL             TT++ ++ + S+L
Sbjct: 366 TVQEDGIMTKDLALILGKTERSAYVTTEEFIDAVESRL 403

>AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL066W
           (IDP1)
          Length = 425

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 70/137 (51%), Gaps = 12/137 (8%)

Query: 190 RLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--VAYNEQIVDSMVYR 246
           RL       L ++ K+ +L Q DG F+++ +++Y++  K ++ +  + Y  +++D MV +
Sbjct: 215 RLALAKQLNLFLSTKNTILKQYDGRFKDVFEELYQAQYKAEFERLGIYYEHRLIDDMVAQ 274

Query: 247 MFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGSAP--- 301
           M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+     
Sbjct: 275 MVKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHF 333

Query: 302 --DIAGKGIS-NPIATI 315
               AGK  S N IA+I
Sbjct: 334 RQHQAGKETSTNSIASI 350

>NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {ON}
           Anc_4.254
          Length = 426

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 74/144 (51%), Gaps = 12/144 (8%)

Query: 161 GTRVAEATKRISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICK 220
           G+ VA A     E + R  A  +  +AL + K N    L ++ K+ +L + DG F++I +
Sbjct: 190 GSGVALAMYNTDE-SIRGFAHSSFKLALTK-KLN----LFLSTKNTILKKYDGRFKDIFQ 243

Query: 221 DVYESN-KDKYGQ--VAYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGS 277
           ++++   K K+    ++Y  +++D MV +M +    F ++   N  GD+ SD  A   GS
Sbjct: 244 EIFDMEYKTKFANLGISYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 302

Query: 278 LGVVPSANVGPE--IVIGEPCHGS 299
           LG++ S  V P+      E  HG+
Sbjct: 303 LGLMTSILVTPDGKTFESEAAHGT 326

>YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}
           IDP3Peroxisomal NADP-dependent isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to alpha-ketoglutarate
           with the formation of NADP(H+), required for growth on
           unsaturated fatty acids
          Length = 420

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 63/126 (50%), Gaps = 11/126 (8%)

Query: 179 IATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYG--QVAY 235
            A  + ++AL+R        L  T K+ +L   D  F++I  ++++   K+K+   ++ Y
Sbjct: 192 FAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDNLFDKEYKEKFQALKITY 246

Query: 236 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 293
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILITPDGKTFES 305

Query: 294 EPCHGS 299
           E  HG+
Sbjct: 306 EAAHGT 311

>Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009W
           (REAL)
          Length = 420

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 62/126 (49%), Gaps = 11/126 (8%)

Query: 179 IATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--VAY 235
            A  + ++AL+R        L  T K+ +L   D  F+EI   ++++  K+K+    + Y
Sbjct: 192 FAKASFELALKR-----RLPLFFTTKNTILKSYDNQFKEIFDKLFDAEYKEKFQALGITY 246

Query: 236 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 293
             +++D MV +M +    F +V   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSRGGF-IVAMKNYDGDVQSDIVAQGFGSLGLMTSLLITPDAKTFES 305

Query: 294 EPCHGS 299
           E  HG+
Sbjct: 306 EAAHGT 311

>KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 420

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 59/115 (51%), Gaps = 6/115 (5%)

Query: 190 RLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQ---VAYNEQIVDSMVYR 246
           RL  +    L +  K+ +L Q DG F+++ + +Y++   +  +   ++Y  +++D MV +
Sbjct: 207 RLALSKQLNLFLATKNTILKQYDGRFKDLFQQLYDAEYREAFERAGISYEHRLIDDMVAQ 266

Query: 247 MFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 299
           M +    F V+   N  GD+ SD  A   GSLG++ S  + P+      E  HG+
Sbjct: 267 MIKSRGGF-VLALKNYDGDVQSDIVAQGFGSLGLMSSVLITPDGNAFESEAAHGT 320

>CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174w IDP2 isocitrate dehydrogenase or
           uniprot|P53982 Saccharomyces cerevisiae YNL009w IDP3 or
           uniprot|P21954 Saccharomyces cerevisiae YDL066w IDP1
          Length = 411

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 65/130 (50%), Gaps = 11/130 (8%)

Query: 175 ATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ- 232
           + R  A  + ++AL+         L  T K+ +L + DG F++  + +YE+  K+++   
Sbjct: 188 SIRGFARASFNMALEH-----EMPLYSTTKNTILKKYDGKFKDTFESMYEAEYKEQFEAK 242

Query: 233 -VAYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE-- 289
            + Y  +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  + P+  
Sbjct: 243 GIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLISPDGK 301

Query: 290 IVIGEPCHGS 299
               E  HG+
Sbjct: 302 TFESEAAHGT 311

>KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 67/128 (52%), Gaps = 12/128 (9%)

Query: 199 LTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--VAYNEQIVDSMVYRMFREPECFD 255
           L ++ K+ +L + DG F+++ ++++++  K ++ +  + Y  +++D MV +M +    F 
Sbjct: 224 LFLSTKNTILKRYDGRFKDLFQEIFDAEYKQQFEESGIQYQHRLIDDMVAQMIKSKGGF- 282

Query: 256 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGSAPDIAGK------G 307
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+      K       
Sbjct: 283 IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHYRKYQRGEET 342

Query: 308 ISNPIATI 315
            +NPIA+I
Sbjct: 343 STNPIASI 350

>Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 179 IATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--VAY 235
            A  + ++A++R        L  T K+ +L + DG F+++ + +Y  N K+K+    + Y
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYAENYKEKFESLGIWY 246

Query: 236 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 293
             +++D MV +M +    + ++   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSMLITPDGKTFES 305

Query: 294 EPCHGS 299
           E  HG+
Sbjct: 306 EAAHGT 311

>YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}
           IDP2Cytosolic NADP-specific isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to
           alpha-ketoglutarate; levels are elevated during growth
           on non-fermentable carbon sources and reduced during
           growth on glucose
          Length = 412

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 101/218 (46%), Gaps = 33/218 (15%)

Query: 179 IATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYGQ--VAY 235
            A  + ++A++R        L  T K+ +L + DG F+++ + +Y  S K+K+    + Y
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYARSYKEKFESLGIWY 246

Query: 236 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 293
             +++D MV +M +    + ++   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKTFES 305

Query: 294 EPCHGSAP-----DIAGKGIS-NPIATI--RSTGLMLEFLGHNKP-----AQDIYRAVDA 340
           E  HG+          GK  S N IA+I   + G++      N P      Q +  A   
Sbjct: 306 EAAHGTVTRHFRQHQQGKETSTNSIASIFAWTRGIIQRGKLDNTPDVVKFGQILESATVN 365

Query: 341 NLREDKVKTPDLG---GNS------TTQQVVEDILSKL 369
            ++ED + T DL    G S      TT++ ++ + S+L
Sbjct: 366 TVQEDGIMTKDLALILGKSERSAYVTTEEFIDAVESRL 403

>KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 415

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 51/198 (25%), Positives = 90/198 (45%), Gaps = 28/198 (14%)

Query: 199 LTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQ---VAYNEQIVDSMVYRMFREPECFD 255
           L  T K+ +L + DG F+++ + +YES      +   + Y  +++D MV +M +    + 
Sbjct: 210 LYSTTKNTILKKYDGKFKDVFESLYESQYKSAFEAKGIWYEHRLIDDMVAQMLKSKGGY- 268

Query: 256 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGSAP-----DIAGKGI 308
           ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+          GK  
Sbjct: 269 IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKAFESEAAHGTVTRHYRQHQQGKET 328

Query: 309 S-NPIATI--RSTGLMLEFLGHNKP-----AQDIYRAVDANLREDKVKTPDLG------- 353
           S N IA+I   + GL+      + P     A+ +  A    ++ED++ T DL        
Sbjct: 329 STNSIASIFAWTRGLIQRGKLDSTPDVVKFAELVESATVNTVQEDEIMTKDLALILGKTD 388

Query: 354 --GNSTTQQVVEDILSKL 369
                TT++ +E +  +L
Sbjct: 389 RSSYVTTEEFIEAVHKRL 406

>Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 179 IATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYGQ--VAY 235
            A  + ++AL+R        L  T K+ +L + DG F+++ + +Y E  K+K+    + Y
Sbjct: 192 FAKASFELALER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYAEVYKEKFEALGIWY 246

Query: 236 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 293
             +++D MV +M +    + ++   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSLLITPDGKTFES 305

Query: 294 EPCHGS 299
           E  HG+
Sbjct: 306 EAAHGT 311

>ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 422

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 62/115 (53%), Gaps = 6/115 (5%)

Query: 190 RLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--VAYNEQIVDSMVYR 246
           +L  +    L ++ K+ +L + DG F++I +++Y++  K ++ +  + Y  +++D MV +
Sbjct: 209 KLALDKKLNLYLSTKNTILKKYDGRFKDIFQELYDTQYKAEFEKAGIFYEHRLIDDMVAQ 268

Query: 247 MFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 299
           M +    F ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+
Sbjct: 269 MVKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFESEAAHGT 322

>Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009W
           (REAL)
          Length = 417

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 60/126 (47%), Gaps = 11/126 (8%)

Query: 179 IATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQ---VAY 235
            A  + ++AL+R        L  T K+ +L   D  F++I   ++++   +  Q   + Y
Sbjct: 192 FAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDKLFDAEYKEQFQALGITY 246

Query: 236 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 293
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILITPDGKTFES 305

Query: 294 EPCHGS 299
           E  HG+
Sbjct: 306 EAAHGT 311

>TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.396
           YLR174W
          Length = 422

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 62/126 (49%), Gaps = 11/126 (8%)

Query: 179 IATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYG--QVAY 235
            A  + + AL+R        L  T K+ +L + DG F++I + +Y E  ++K+    + Y
Sbjct: 203 FARSSFEFALER-----KLPLYSTTKNTILKKYDGQFKDIFESMYKEEYEEKFKALNIWY 257

Query: 236 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 293
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  +  +      
Sbjct: 258 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISDDGKTFES 316

Query: 294 EPCHGS 299
           E  HG+
Sbjct: 317 EAAHGT 322

>Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174W
           (REAL)
          Length = 418

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 61/126 (48%), Gaps = 11/126 (8%)

Query: 179 IATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYGQ--VAY 235
            A  + ++AL+R        L  T K+ +L   D  F++I   ++ E  ++K+    + Y
Sbjct: 192 FAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDGLFNEKYREKFQALGIKY 246

Query: 236 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 293
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFES 305

Query: 294 EPCHGS 299
           E  HG+
Sbjct: 306 EAAHGT 311

>Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar to
           Ashbya gossypii AER061C
          Length = 424

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 56/107 (52%), Gaps = 8/107 (7%)

Query: 199 LTVTHKSNVLSQSDGLFREICKDVYESNK----DKYGQVAYNEQIVDSMVYRMFREPECF 254
           L ++ K+ +L   DG F++I +++Y++      + +G + Y  +++D MV +M +    F
Sbjct: 220 LFLSTKNTILKTYDGRFKDIFQELYDTQYKTEFENHG-IYYEHRLIDDMVAQMIKSKGGF 278

Query: 255 DVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 299
            ++   N  GD+ SD  A   GSLG++ S    P+      E  HG+
Sbjct: 279 -IMALKNYDGDVQSDIVAQGFGSLGLMTSILATPDGKTFESEAAHGT 324

>NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa]
           {ON} Anc_1.396
          Length = 420

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 61/126 (48%), Gaps = 11/126 (8%)

Query: 179 IATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQ---VAY 235
            A  +  +AL+R        L  T K+ +L + DG F++I +++YE    +  +   + Y
Sbjct: 200 FALSSFKLALER-----KMPLYSTTKNTILKRYDGKFKDIFENMYEEQFREQFEELGIWY 254

Query: 236 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 293
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  +  +      
Sbjct: 255 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISSDGKSFES 313

Query: 294 EPCHGS 299
           E  HG+
Sbjct: 314 EAAHGT 319

>Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C
           (REAL)
          Length = 53

 Score = 38.9 bits (89), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 30/50 (60%)

Query: 320 LMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQVVEDILSKL 369
           LML  LG N+ A  I +AV   + E K  T D+GG+S+T     +I++KL
Sbjct: 1   LMLNHLGLNESATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEIINKL 50

>SAKL0E09218g Chr5 (765587..766813) [1227 bp, 408 aa] {ON} some
           similarities with uniprot|P40463 Saccharomyces
           cerevisiae YIL135C VHS2 Gene whose overexpression
           suppresses the synthetic lethality of the hal3 sit4
           double mutation
          Length = 408

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 174 VATRRIATIALDIALQRLKTNGHATL 199
           + +RR +TI LD+AL R +TN H+ L
Sbjct: 116 IYSRRPSTIGLDMALGRTRTNSHSNL 141

>Ecym_5020 Chr5 complement(43098..45470) [2373 bp, 790 aa] {ON}
           similar to Ashbya gossypii ADR400W
          Length = 790

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 59/142 (41%), Gaps = 11/142 (7%)

Query: 47  LSGKHGLNFDFIDLQAGWGTFQETGKALPEQTVQVLKN-QCQGALFGAVQSPTTKVEGYS 105
           L   H L     +L+   GT  +    L +Q   + K+    G   GA  S  T +    
Sbjct: 588 LDENHMLQQKICELEEQHGTLIKDNYRLAQQASAITKDFDSIGEFEGAYSSLKTHL---- 643

Query: 106 SPIVALRKELGLYANVRPVKSVEGT--KDRPVDMVIVRENTEDLYIKLEK--TYVDKATG 161
             +V LRK   ++ N+    SV     K   ++ +    N     +KLE   T+++ ATG
Sbjct: 644 --VVHLRKMFKIFENILQQDSVNQAVKKLDNINRLQSLNNCRKAQLKLESIYTFIENATG 701

Query: 162 TRVAEATKRISEVATRRIATIA 183
           + V E  K + +   RRI  ++
Sbjct: 702 SIVDEHVKLLLKEKDRRIKRLS 723

>KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON}
           Anc_3.455 YPR122W
          Length = 1201

 Score = 32.3 bits (72), Expect = 2.3,   Method: Composition-based stats.
 Identities = 22/83 (26%), Positives = 38/83 (45%), Gaps = 3/83 (3%)

Query: 190 RLKTNGHATLTVT--HKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDSMVYRM 247
           ++ T  H TL     ++ N++ Q   L+R + KD  E   D  G +  N Q++D + Y  
Sbjct: 406 KILTTKHTTLMADFLNEQNIIEQVRFLYRGVEKDPMEECSDLSGLLQENMQVLD-IKYLF 464

Query: 248 FREPECFDVVVAPNLYGDILSDG 270
              P    +    N Y + ++DG
Sbjct: 465 KGSPSITQLYSGKNQYSESMTDG 487

>KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1223

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 43/97 (44%), Gaps = 19/97 (19%)

Query: 255  DVVVAPNLYGDILSDGAAALVGS------LGVVPSANVGPEIVIGEPCHGSAPDIAGKGI 308
            +V+V  N +  I+  G+AA V S      +G +  A   PE++ GEP  G   DI   G+
Sbjct: 1102 NVIVDSNGFVKIIDFGSAAYVKSGPFDVFVGTIDYA--APEVLGGEPYEGKPQDIWAIGV 1159

Query: 309  SNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLRED 345
                       L+   +    P  +I   +DA+LR D
Sbjct: 1160 -----------LLYTIIFKENPFYNIDEILDADLRVD 1185

>ZYRO0A00990g Chr1 complement(70521..71861) [1341 bp, 446 aa] {ON}
           some similarities with uniprot|P40463 Saccharomyces
           cerevisiae YIL135C VHS2 Gene whose overexpression
           suppresses the synthetic lethality of the hal3 sit4
           double mutation
          Length = 446

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 174 VATRRIATIALDIALQRLKTNGHATLTVTH 203
           V  R+ +TI LD+AL R ++N +ATL   H
Sbjct: 139 VYMRKPSTIGLDLALGRTRSNSYATLREEH 168

>KNAG0A03750 Chr1 (487451..489943) [2493 bp, 830 aa] {ON} Anc_8.531
           YBR202W
          Length = 830

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 41/85 (48%), Gaps = 1/85 (1%)

Query: 119 ANVRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRR 178
           A +R V  VE  +D    + +VR + E LY    KT  D+   TR+    KR+S+     
Sbjct: 703 AKLRLVNRVE-VEDVEEALRLVRVSKESLYQDNTKTREDQNPTTRIYNLIKRMSQDTLEN 761

Query: 179 IATIALDIALQRLKTNGHATLTVTH 203
             T++ D  ++ +++ G   L + +
Sbjct: 762 RGTLSYDTIVKTVRSRGFTMLQLNN 786

>KNAG0F00220 Chr6 complement(21846..22952) [1107 bp, 368 aa] {ON}
           Anc_1.32 YDR517W
          Length = 368

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 2/58 (3%)

Query: 194 NGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQ--IVDSMVYRMFR 249
           NGHA    T K NV S   G FR++  D+   + D    V  ++   + D+  +  FR
Sbjct: 119 NGHAAEGTTLKLNVWSAKGGQFRDVYVDLQPRDADSMDDVPVSDDPGVADTRQHATFR 176

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,970,407
Number of extensions: 1515665
Number of successful extensions: 4330
Number of sequences better than 10.0: 148
Number of HSP's gapped: 4113
Number of HSP's successfully gapped: 148
Length of query: 369
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 258
Effective length of database: 40,753,473
Effective search space: 10514396034
Effective search space used: 10514396034
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)