Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G021602.285ON71471438570.0
ZYRO0A01870g2.285ON70770532350.0
Smik_14.3102.285ON70671230050.0
Suva_14.3262.285ON70671030010.0
YNL021W (HDA1)2.285ON70667429900.0
CAGL0J03454g2.285ON69369629860.0
Skud_14.3082.285ON70669529760.0
NCAS0G038002.285ON72670229710.0
NDAI0G006502.285ON68966729550.0
SAKL0E07700g2.285ON71270429470.0
KNAG0H020102.285ON69368128990.0
KAFR0H033202.285ON70269928740.0
KLTH0G10340g2.285ON70869828700.0
Kwal_27.115372.285ON70869728420.0
Ecym_33242.285ON70669928320.0
ADL216C2.285ON70570227040.0
KLLA0E08383g2.285ON70466726860.0
Kpol_1039.322.285ON65965526800.0
TPHA0C033902.285ON70169426200.0
TBLA0B069502.285ON79547920120.0
Kpol_1003.372.285ON57829713231e-175
NDAI0B027108.153ON4533233597e-36
NCAS0B054808.153ON4513533562e-35
KAFR0C029208.153ON4533543552e-35
TPHA0H003208.153ON4503243553e-35
SAKL0H25124g8.153ON4483323518e-35
TBLA0D021408.153ON4563253492e-34
KLTH0E06446g8.153ON4493223473e-34
TDEL0B045808.153ON4463563446e-34
Kpol_246.58.153ON4533243446e-34
Skud_7.798.153ON4523233448e-34
Ecym_23468.153ON4853313458e-34
Kwal_55.207908.153ON4493183421e-33
AFR172C8.153ON4493233421e-33
YGL194C (HOS2)8.153ON4523233412e-33
CAGL0A03322g8.153ON4503553412e-33
KNAG0G013508.153ON4513213402e-33
Smik_7.798.153ON4523233393e-33
Suva_7.718.153ON4523223351e-32
ZYRO0G19316g8.153ON4483193304e-32
KLLA0F09119g8.153ON4523243296e-32
KLTH0F19668g3.8ON4323383082e-29
Kpol_1038.113.8ON4333243065e-29
Kwal_55.221423.8ON4323383056e-29
TBLA0I005603.8ON4333243031e-28
Suva_14.113.8ON4333243031e-28
NCAS0C043203.8ON4343243022e-28
Ecym_20103.8ON4333233012e-28
ZYRO0C03498g3.8ON4333243012e-28
AGR395W3.8ON4333233002e-28
KNAG0A011603.8ON4333243002e-28
SAKL0C13706g3.8ON4333233003e-28
KLLA0E01981g3.8ON4323243003e-28
Skud_14.113.8ON4333243003e-28
NDAI0G037403.8ON4333242993e-28
CAGL0B01441g3.8ON4333242978e-28
KAFR0A086303.8ON4333242969e-28
Smik_14.23.8ON4333242942e-27
YNL330C (RPD3)3.8ON4333242932e-27
TPHA0A003003.8ON4333242914e-27
TDEL0A002703.8ON4333242905e-27
Suva_16.3963.362ON4771771974e-15
Skud_16.3533.362ON4711771949e-15
Ecym_82908.607ON7093021969e-15
TDEL0C050403.362ON4541811931e-14
KLTH0F10582g3.362ON4742221885e-14
Smik_16.3093.362ON4701771875e-14
NDAI0A051203.362ON5082651877e-14
TDEL0A055208.607ON6743181887e-14
YPR068C (HOS1)3.362ON4701771869e-14
Kwal_23.37243.362ON4732311851e-13
ADL339W3.362ON4372421832e-13
ADL265W8.607ON6943261842e-13
TBLA0B023903.362ON5791761823e-13
SAKL0B07854g3.362ON4892301813e-13
CAGL0D01430g3.362ON4452891804e-13
KAFR0H008903.362ON4742081788e-13
KLLA0F00858g8.607ON7152671799e-13
ZYRO0C16390g3.362ON4362281761e-12
TBLA0E040808.607ON6942421781e-12
Kpol_376.153.362ON5181771761e-12
SAKL0H08338g8.607ON6903291772e-12
NCAS0A111803.362ON4902971743e-12
KAFR0H027908.607ON7173061744e-12
TPHA0A011208.607ON6982891744e-12
YPL116W (HOS3)8.607ON6973171734e-12
Suva_16.1948.607ON6993171726e-12
Kpol_479.68.607ON6882881727e-12
Smik_6.3158.607ON6973171717e-12
KLTH0D09592g8.607ON7052521691e-11
KNAG0H006303.362ON4561791672e-11
ZYRO0F10780g8.607ON6682811672e-11
KLLA0B09394g3.362ON4412331653e-11
KNAG0J013008.607ON6772911629e-11
CAGL0J06974g8.607ON6783231611e-10
Ecym_34653.362ON4452341582e-10
NCAS0C017608.607ON7003191592e-10
Kwal_26.85058.607ON7083211583e-10
Skud_16.1648.607ON6972951573e-10
NDAI0E024808.607ON6842831574e-10
TPHA0M015903.362ON4942721555e-10
SAKL0F12232g7.384ON62452715.9
Kwal_47.166214.351ON1178162708.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G02160
         (714 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {O...  1490   0.0  
ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {...  1250   0.0  
Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021...  1162   0.0  
Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021...  1160   0.0  
YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putat...  1156   0.0  
CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa] ...  1154   0.0  
Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021...  1150   0.0  
NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON}             1149   0.0  
NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {O...  1142   0.0  
SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly...  1139   0.0  
KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.2...  1121   0.0  
KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.2...  1111   0.0  
KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {...  1110   0.0  
Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021...  1099   0.0  
Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}...  1095   0.0  
ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON} S...  1046   0.0  
KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly...  1039   0.0  
Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON} (99859...  1036   0.0  
TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {O...  1013   0.0  
TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa] ...   779   0.0  
Kpol_1003.37 s1003 complement(91621..92301,92861..92869,92912..9...   514   e-175
NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153    142   7e-36
NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa] ...   141   2e-35
KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {O...   141   2e-35
TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}...   141   3e-35
SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} high...   139   8e-35
TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {O...   139   2e-34
KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {...   138   3e-34
TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {O...   137   6e-34
Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON} (11759..13...   137   6e-34
Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}...   137   8e-34
Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}...   137   8e-34
Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {...   136   1e-33
AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON} S...   136   1e-33
YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}  ...   135   2e-33
CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly...   135   2e-33
KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.1...   135   2e-33
Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}...   135   3e-33
Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}...   133   1e-32
ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} high...   131   4e-32
KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly...   131   6e-32
KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} high...   123   2e-29
Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {O...   122   5e-29
Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL3...   122   6e-29
TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8...   121   1e-28
Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}...   121   1e-28
NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8      120   2e-28
Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON} s...   120   2e-28
ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly...   120   2e-28
AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic ...   120   2e-28
KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON} A...   120   2e-28
SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} high...   120   3e-28
KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {...   120   3e-28
Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}...   120   3e-28
NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {O...   119   3e-28
CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {...   119   8e-28
KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3...   118   9e-28
Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON} YN...   117   2e-27
YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}  R...   117   2e-27
TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}...   116   4e-27
TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}...   116   5e-27
Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {...    80   4e-15
Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {...    79   9e-15
Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}...    80   9e-15
TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {O...    79   1e-14
KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} simila...    77   5e-14
Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {...    77   5e-14
NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON} Anc_3...    77   7e-14
TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {O...    77   7e-14
YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON} ...    76   9e-14
Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C...    76   1e-13
ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic ho...    75   2e-13
ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic ho...    75   2e-13
TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.3...    75   3e-13
SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {...    74   3e-13
CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} simila...    74   4e-13
KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.3...    73   8e-13
KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON...    74   9e-13
ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]...    72   1e-12
TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa] ...    73   1e-12
Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}...    72   1e-12
SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} simila...    73   2e-12
NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa] ...    72   3e-12
KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {O...    72   4e-12
TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.6...    72   4e-12
YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}  HOS3Trich...    71   4e-12
Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116...    71   6e-12
Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON} ...    71   7e-12
Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON...    70   7e-12
KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {...    70   1e-11
KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.3...    69   2e-11
ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {...    69   2e-11
KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} simila...    68   3e-11
KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8....    67   9e-11
CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highl...    67   1e-10
Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar t...    65   2e-10
NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.6...    66   2e-10
Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {O...    65   3e-10
Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116...    65   3e-10
NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.6...    65   4e-10
TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {...    64   5e-10
SAKL0F12232g Chr6 complement(952576..954450) [1875 bp, 624 aa] {...    32   5.9  
Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {O...    32   8.3  

>TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {ON}
           Anc_2.285 YNL021W
          Length = 714

 Score = 1490 bits (3857), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 714/714 (100%), Positives = 714/714 (100%)

Query: 1   MTISMDCDIVKPENDTTLQVKRKMEEQNDGLDPKKSQLARTQNGAAGKRVIVPACAPNLH 60
           MTISMDCDIVKPENDTTLQVKRKMEEQNDGLDPKKSQLARTQNGAAGKRVIVPACAPNLH
Sbjct: 1   MTISMDCDIVKPENDTTLQVKRKMEEQNDGLDPKKSQLARTQNGAAGKRVIVPACAPNLH 60

Query: 61  YTPLKTALCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGID 120
           YTPLKTALCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGID
Sbjct: 61  YTPLKTALCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGID 120

Query: 121 EIGDLMLKIPVREATDEEILEVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYV 180
           EIGDLMLKIPVREATDEEILEVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYV
Sbjct: 121 EIGDLMLKIPVREATDEEILEVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYV 180

Query: 181 SAKLSCGGVIDACKAVVEGRVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQY 240
           SAKLSCGGVIDACKAVVEGRVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQY
Sbjct: 181 SAKLSCGGVIDACKAVVEGRVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQY 240

Query: 241 PESVRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKG 300
           PESVRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKG
Sbjct: 241 PESVRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKG 300

Query: 301 EGFNCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTP 360
           EGFNCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTP
Sbjct: 301 EGFNCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTP 360

Query: 361 SCYGQMTHMLKSLARGNLCVALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDPKLE 420
           SCYGQMTHMLKSLARGNLCVALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDPKLE
Sbjct: 361 SCYGQMTHMLKSLARGNLCVALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDPKLE 420

Query: 421 AIEMIDTVIHTQSKYWKCFQRKFGNAGCNFSEPVTETVISKSFPLQTAIRQEQFRQLSKE 480
           AIEMIDTVIHTQSKYWKCFQRKFGNAGCNFSEPVTETVISKSFPLQTAIRQEQFRQLSKE
Sbjct: 421 AIEMIDTVIHTQSKYWKCFQRKFGNAGCNFSEPVTETVISKSFPLQTAIRQEQFRQLSKE 480

Query: 481 YGFVTLPISKLEIPDDSVLCSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVD 540
           YGFVTLPISKLEIPDDSVLCSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVD
Sbjct: 481 YGFVTLPISKLEIPDDSVLCSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVD 540

Query: 541 SPLDFTKWCMNRKYGVIDVNIPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAF 600
           SPLDFTKWCMNRKYGVIDVNIPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAF
Sbjct: 541 SPLDFTKWCMNRKYGVIDVNIPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAF 600

Query: 601 VGFGDAYAGIVHLLGHRDTRATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDK 660
           VGFGDAYAGIVHLLGHRDTRATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDK
Sbjct: 601 VGFGDAYAGIVHLLGHRDTRATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDK 660

Query: 661 NHPCWADNESKKPRKKFGRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE 714
           NHPCWADNESKKPRKKFGRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE
Sbjct: 661 NHPCWADNESKKPRKKFGRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE 714

>ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 707

 Score = 1250 bits (3235), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 580/705 (82%), Positives = 652/705 (92%), Gaps = 4/705 (0%)

Query: 10  VKPENDTTLQVKRKMEEQNDGLDPKKSQLARTQNGAAGKRVIVPACAPNLHYTPLKTALC 69
           VK E++ +   KRK+EE  +G   KK  +A   NG   +++IVPAC P +HYTPLKT LC
Sbjct: 7   VKQEDEGS---KRKLEESPNGPVEKKPNVASVSNGRQKRQIIVPACEPKIHYTPLKTGLC 63

Query: 70  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKI 129
           YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR+YKILAENGLINDPTLSG D+IG+LMLKI
Sbjct: 64  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGEDDIGELMLKI 123

Query: 130 PVREATDEEILEVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYVSAKLSCGGV 189
           PVREAT EE+L+VH+KE+LEF+E++S+M REELLKETE GDSVYFN+DSY +AKL CGG 
Sbjct: 124 PVREATVEELLQVHTKEHLEFIEKTSQMNREELLKETETGDSVYFNSDSYSAAKLPCGGA 183

Query: 190 IDACKAVVEGRVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILI 249
           I+ACKAVVEGRVKNALAV+RPPGHHAEPE  GGFCLFSNVAVAAQNILK YPESVRRILI
Sbjct: 184 IEACKAVVEGRVKNALAVIRPPGHHAEPEMAGGFCLFSNVAVAAQNILKNYPESVRRILI 243

Query: 250 LDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITW 309
           LDWDIHHGNGTQKAFYND RVLYISLHRFE+GKYYPGTI+G+YDQTGEGKGEGFNCNITW
Sbjct: 244 LDWDIHHGNGTQKAFYNDDRVLYISLHRFELGKYYPGTIHGQYDQTGEGKGEGFNCNITW 303

Query: 310 PVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHM 369
           PVGGVGDAEYMLAFEQIVMPMARE++PDLVIISSGFDAADGDTIGQCHV+PSCYG MTHM
Sbjct: 304 PVGGVGDAEYMLAFEQIVMPMAREYRPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHM 363

Query: 370 LKSLARGNLCVALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDPKLEAIEMIDTVI 429
           LKSLARGNLCVALEGGYNLDAIA SALSVAK+LIGEPP+ELPDP+K+PKLEAIEMID VI
Sbjct: 364 LKSLARGNLCVALEGGYNLDAIATSALSVAKILIGEPPEELPDPSKNPKLEAIEMIDKVI 423

Query: 430 HTQSKYWKCFQRKFGNAGCNFSEPVTETVISKSFPLQTAIRQEQFRQLSKEYGFVTLPIS 489
           H QSKYWKCF R+ GN+GCNF EPVTE++I+K+FPLQ AIRQEQF QL KEYGFVTLP+ 
Sbjct: 424 HVQSKYWKCF-RRLGNSGCNFKEPVTESLITKNFPLQKAIRQEQFHQLEKEYGFVTLPVP 482

Query: 490 KLEIPDDSVLCSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVDSPLDFTKWC 549
           KLE+P+D+VLCSP+VFQ+ST++I VHDTPEIWAKRDVITG+IDPSTSI VDSPLDF KW 
Sbjct: 483 KLELPEDTVLCSPDVFQESTVIIFVHDTPEIWAKRDVITGMIDPSTSITVDSPLDFIKWS 542

Query: 550 MNRKYGVIDVNIPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAFVGFGDAYAG 609
           + RKYGVIDVNIPQSLFEQDNYSAMITSQEVL+Y+WDN++KYFPSL+KVAFVG GDAY+G
Sbjct: 543 LARKYGVIDVNIPQSLFEQDNYSAMITSQEVLIYLWDNFVKYFPSLSKVAFVGVGDAYSG 602

Query: 610 IVHLLGHRDTRATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDKNHPCWADNE 669
           IVHLLGHRDTR+ VKAV++F+GRKQLKPLVPLVDESL DWYFKNSL+F+D+N+PCW DNE
Sbjct: 603 IVHLLGHRDTRSVVKAVINFVGRKQLKPLVPLVDESLGDWYFKNSLVFSDRNNPCWVDNE 662

Query: 670 SKKPRKKFGRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE 714
           +KKPR+KFGRVLRC++DG+N+NMEERF+EATDFILD FEEWSDSE
Sbjct: 663 NKKPRRKFGRVLRCESDGINNNMEERFDEATDFILDSFEEWSDSE 707

>Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1162 bits (3005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/712 (75%), Positives = 625/712 (87%), Gaps = 8/712 (1%)

Query: 5   MDCDIVKPE--NDTTLQVKRKMEEQNDGLDPKKSQLARTQNGAAGKRVIVPACAPNLHYT 62
           MD +IVK E   +    +KR++EE  +     ++ L+ T N    ++VIVPAC P +HY+
Sbjct: 1   MDSEIVKKEAWENPDGNLKRRLEETKE----DQNSLSTTSNNK--RQVIVPACTPKIHYS 54

Query: 63  PLKTALCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEI 122
           PLKT LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR+YKILAENGLINDPTLSG+D++
Sbjct: 55  PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDL 114

Query: 123 GDLMLKIPVREATDEEILEVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYVSA 182
           GDLMLKIPVR AT EEILEVH+KE+LEF+E + +M RE+LLKETEKGDSVYFNNDSY SA
Sbjct: 115 GDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASA 174

Query: 183 KLSCGGVIDACKAVVEGRVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPE 242
           +L CGG I+ACKAVVEGRVKN+LAVVRPPGHHAEP+A GGFCLFSNVAVAA+NILK YPE
Sbjct: 175 RLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPE 234

Query: 243 SVRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEG 302
           SVRRI+ILDWDIHHGNGTQK+FY D +VLY+SLHRFEMGKYYPGTI G+YDQ GEGKGEG
Sbjct: 235 SVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEG 294

Query: 303 FNCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSC 362
           FNCNITWPVGGVGDAEYM AFEQ+VMPM REF+PDLVIISSGFDAADGDTIGQCHVTPSC
Sbjct: 295 FNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSC 354

Query: 363 YGQMTHMLKSLARGNLCVALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDPKLEAI 422
           YG MTHMLKSLARGNLCV LEGGYNLDAIA SALSVAKVLIGEPPDELPD + DPK E I
Sbjct: 355 YGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPDELPDSSSDPKPEVI 414

Query: 423 EMIDTVIHTQSKYWKCFQRKFGNAGCNFSEPVTETVISKSFPLQTAIRQEQFRQLSKEYG 482
           EMID VI  QSKYW CF+R+  N+GCNF+EP+ ++++SK+FPLQ AIRQ+Q   LS E+ 
Sbjct: 415 EMIDKVIRLQSKYWNCFRRRHANSGCNFNEPINDSIVSKNFPLQKAIRQQQQHYLSDEFN 474

Query: 483 FVTLPISKLEIPDDSVLCSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVDSP 542
            VTLP+  +++PD++VLC+P V++ +T++++VHDT +IWAKR+VI+G ID S+S+I+D+ 
Sbjct: 475 LVTLPLINMDLPDNTVLCTPNVYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNC 534

Query: 543 LDFTKWCMNRKYGVIDVNIPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAFVG 602
           LDF KW ++RKYG+IDVNIP SLFE DNYS MITSQEVL+Y+WDNYIKYFP++AK+AFVG
Sbjct: 535 LDFIKWGLDRKYGIIDVNIPLSLFEPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVG 594

Query: 603 FGDAYAGIVHLLGHRDTRATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDKNH 662
            GD+Y+GIVHLLGHRDTRA  K V++F+G KQLKPLVPLVDE+LS+WYFKNSLIF++ +H
Sbjct: 595 IGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSH 654

Query: 663 PCWADNESKKPRKKFGRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE 714
            CW +NES+KPRKKFGRVLRCDTDGLN+ +EERFEEATDFILD FEEWSD E
Sbjct: 655 QCWKENESRKPRKKFGRVLRCDTDGLNNTIEERFEEATDFILDSFEEWSDEE 706

>Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1160 bits (3001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/710 (74%), Positives = 623/710 (87%), Gaps = 4/710 (0%)

Query: 5   MDCDIVKPENDTTLQVKRKMEEQNDGLDPKKSQLARTQNGAAGKRVIVPACAPNLHYTPL 64
           MD   VK  N+      + ++ + +G+  +++ L+ T      ++VIVPAC P LHYTPL
Sbjct: 1   MDSATVK--NEVLETPDQDLKHKLEGMKEEQNSLSTTSKNK--RQVIVPACTPKLHYTPL 56

Query: 65  KTALCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGD 124
           +T LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR+YKILAENGLINDPTLSG+D++GD
Sbjct: 57  RTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGD 116

Query: 125 LMLKIPVREATDEEILEVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYVSAKL 184
           LMLKIPVR AT EEILEVH+KE+LEF+E + +M RE+LLKETEKGDSVYFNNDSY SA+L
Sbjct: 117 LMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARL 176

Query: 185 SCGGVIDACKAVVEGRVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESV 244
            CGG I+ACKAVVEGRVKN+LAVVRPPGHHAEP+A GGFCLFSNVAVAA+NILK YPESV
Sbjct: 177 PCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESV 236

Query: 245 RRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFN 304
           RRI+ILDWDIHHGNGTQK+FY D +VLYISLHRFE+GKYYPGTI G+YDQTGEGKGEGFN
Sbjct: 237 RRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFN 296

Query: 305 CNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYG 364
           CNITWPVGGVGDAEYM AFEQ+VMPM REF+PDLVIISSGFDAADGDTIGQCHVTPSCYG
Sbjct: 297 CNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYG 356

Query: 365 QMTHMLKSLARGNLCVALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDPKLEAIEM 424
            MTHMLKSLARGNLCV LEGGYNLDAIAISALSVAKVLIGEPPDELPDP  DPK E IEM
Sbjct: 357 HMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAKVLIGEPPDELPDPLSDPKPEVIEM 416

Query: 425 IDTVIHTQSKYWKCFQRKFGNAGCNFSEPVTETVISKSFPLQTAIRQEQFRQLSKEYGFV 484
           ID V+  QSKYW CF+R+  N+GCNF+EP+ +++ISK+FPLQ AIRQ+Q   LS E+ FV
Sbjct: 417 IDKVVRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQLHYLSDEFNFV 476

Query: 485 TLPISKLEIPDDSVLCSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVDSPLD 544
           TLP+  +E+PD+ VLC+P V + ST++++VHDT ++WAKR+VI+G ID S+S+++D+ LD
Sbjct: 477 TLPLINMELPDNIVLCTPNVSESSTLLVVVHDTSDVWAKRNVISGTIDLSSSVVIDNCLD 536

Query: 545 FTKWCMNRKYGVIDVNIPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAFVGFG 604
           F KW ++RKYG+IDVNIP +LFE DNYS MITSQEVL+Y+WDNYIKYFP++AK+A++G G
Sbjct: 537 FIKWGLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPAVAKIAYIGIG 596

Query: 605 DAYAGIVHLLGHRDTRATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDKNHPC 664
           D+Y+GIVHLLGHRDTRA  K V++F+G KQLKPLVPLVDE+L++WYFKNSL+FT+ +H C
Sbjct: 597 DSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLTEWYFKNSLVFTNNSHQC 656

Query: 665 WADNESKKPRKKFGRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE 714
           W +NES+KPRKKFGRVLRCDTDGL++ +EERFEEATDFILD FEEWSD E
Sbjct: 657 WKENESRKPRKKFGRVLRCDTDGLSNTVEERFEEATDFILDSFEEWSDEE 706

>YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putative
           catalytic subunit of a class II histone deacetylase
           complex that also contains Hda2p and Hda3p; Hda1p
           interacts with the Hda2p-Hda3p subcomplex to form an
           active tetramer; deletion increases histone H2B, H3 and
           H4 acetylation
          Length = 706

 Score = 1156 bits (2990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/674 (77%), Positives = 605/674 (89%)

Query: 41  TQNGAAGKRVIVPACAPNLHYTPLKTALCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR 100
           +    + ++VIVP C P +HY+PLKT LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR
Sbjct: 33  STTSKSKRQVIVPVCMPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR 92

Query: 101 VYKILAENGLINDPTLSGIDEIGDLMLKIPVREATDEEILEVHSKENLEFVERSSRMKRE 160
           +YKILAENGLINDPTLSG+D++GDLMLKIPVR AT EEILEVH+KE+LEF+E + +M RE
Sbjct: 93  IYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSRE 152

Query: 161 ELLKETEKGDSVYFNNDSYVSAKLSCGGVIDACKAVVEGRVKNALAVVRPPGHHAEPEAP 220
           ELLKETEKGDSVYFNNDSY SA+L CGG I+ACKAVVEGRVKN+LAVVRPPGHHAEP+A 
Sbjct: 153 ELLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAA 212

Query: 221 GGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEM 280
           GGFCLFSNVAVAA+NILK YPESVRRI+ILDWDIHHGNGTQK+FY D +VLY+SLHRFEM
Sbjct: 213 GGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEM 272

Query: 281 GKYYPGTINGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVI 340
           GKYYPGTI G+YDQTGEGKGEGFNCNITWPVGGVGDAEYM AFEQ+VMPM REF+PDLVI
Sbjct: 273 GKYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVI 332

Query: 341 ISSGFDAADGDTIGQCHVTPSCYGQMTHMLKSLARGNLCVALEGGYNLDAIAISALSVAK 400
           ISSGFDAADGDTIGQCHVTPSCYG MTHMLKSLARGNLCV LEGGYNLDAIA SALSVAK
Sbjct: 333 ISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAK 392

Query: 401 VLIGEPPDELPDPTKDPKLEAIEMIDTVIHTQSKYWKCFQRKFGNAGCNFSEPVTETVIS 460
           VLIGEPPDELPDP  DPK E IEMID VI  QSKYW CF+R+  N+GCNF+EP+ +++IS
Sbjct: 393 VLIGEPPDELPDPLSDPKPEVIEMIDKVIRLQSKYWNCFRRRHANSGCNFNEPINDSIIS 452

Query: 461 KSFPLQTAIRQEQFRQLSKEYGFVTLPISKLEIPDDSVLCSPEVFQQSTIVIIVHDTPEI 520
           K+FPLQ AIRQ+Q   LS E+ FVTLP+  +++PD++VLC+P + + +TI+I+VHDT +I
Sbjct: 453 KNFPLQKAIRQQQQHYLSDEFNFVTLPLVSMDLPDNTVLCTPNISESNTIIIVVHDTSDI 512

Query: 521 WAKRDVITGVIDPSTSIIVDSPLDFTKWCMNRKYGVIDVNIPQSLFEQDNYSAMITSQEV 580
           WAKR+VI+G ID S+S+I+D+ LDF KW ++RKYG+IDVNIP +LFE DNYS MITSQEV
Sbjct: 513 WAKRNVISGTIDLSSSVIIDNSLDFIKWGLDRKYGIIDVNIPLTLFEPDNYSGMITSQEV 572

Query: 581 LLYIWDNYIKYFPSLAKVAFVGFGDAYAGIVHLLGHRDTRATVKAVVSFIGRKQLKPLVP 640
           L+Y+WDNYIKYFPS+AK+AF+G GD+Y+GIVHLLGHRDTRA  K V++F+G KQLKPLVP
Sbjct: 573 LIYLWDNYIKYFPSVAKIAFIGIGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVP 632

Query: 641 LVDESLSDWYFKNSLIFTDKNHPCWADNESKKPRKKFGRVLRCDTDGLNSNMEERFEEAT 700
           LVDE+LS+WYFKNSLIF++ +H CW +NES+KPRKKFGRVLRCDTDGLN+ +EERFEEAT
Sbjct: 633 LVDETLSEWYFKNSLIFSNNSHQCWKENESRKPRKKFGRVLRCDTDGLNNIIEERFEEAT 692

Query: 701 DFILDLFEEWSDSE 714
           DFILD FEEWSD E
Sbjct: 693 DFILDSFEEWSDEE 706

>CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa]
           {ON} highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021w HDA1 histone deacetylase A
          Length = 693

 Score = 1154 bits (2986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/696 (76%), Positives = 612/696 (87%), Gaps = 13/696 (1%)

Query: 19  QVKRKMEEQNDGLDPKKSQLARTQNGAAGKRVIVPACAPNLHYTPLKTALCYDVRMRYHA 78
           + KRK+E+     D K+              VIVP     +HYTPLKT +CYDVRMRYHA
Sbjct: 11  ESKRKLEDDVASQDVKRP-------------VIVPTRKAQIHYTPLKTGICYDVRMRYHA 57

Query: 79  KIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVREATDEE 138
           KIFTSYFEYIDPHPEDPRRIYR+YKILAENGLINDPTLSG+++IGDLMLKIP+R AT EE
Sbjct: 58  KIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIRAATAEE 117

Query: 139 ILEVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYVSAKLSCGGVIDACKAVVE 198
           ILEVHSKE+LEF+E++ +M REELLKETEKGDSVYFNNDSY +++L CGG I+ACKAVVE
Sbjct: 118 ILEVHSKEHLEFIEKTEKMNREELLKETEKGDSVYFNNDSYATSRLPCGGAIEACKAVVE 177

Query: 199 GRVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGN 258
           GRVKN+LAVVRPPGHHAEPEA GGFCLFSNVAVAA+NILK YPESVRRILILDWD+HHGN
Sbjct: 178 GRVKNSLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGN 237

Query: 259 GTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVGGVGDAE 318
           GTQKAFY+D RVLYISLHRFE+GKYYPGTI G+YDQ GEGKG+GFNCNITWPVGGVGDAE
Sbjct: 238 GTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAE 297

Query: 319 YMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHMLKSLARGNL 378
           YM AFEQ+VMPM REFQPDLVIISSGFDAADGDTIGQCHVTPSCYG MTHMLKSLARGNL
Sbjct: 298 YMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNL 357

Query: 379 CVALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDPKLEAIEMIDTVIHTQSKYWKC 438
           CV LEGGYNLDAIAISALSVAK+LIGEPPDELPDP ++PK EA+E+ID VI  QSKYWKC
Sbjct: 358 CVVLEGGYNLDAIAISALSVAKILIGEPPDELPDPLREPKAEALEIIDKVISLQSKYWKC 417

Query: 439 FQRKFGNAGCNFSEPVTETVISKSFPLQTAIRQEQFRQLSKEYGFVTLPISKLEIPDDSV 498
           F +++GN G      V   ++SKSFPLQTAIRQEQF QLS+++GFVTLP+  +E+P DSV
Sbjct: 418 FGKRYGNLGLPSENVVKALMMSKSFPLQTAIRQEQFHQLSEDFGFVTLPLLNMEVPQDSV 477

Query: 499 LCSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVDSPLDFTKWCMNRKYGVID 558
           +CSP +F ++TI+++VHDTPEIWAKR+VITG IDPSTS++VDS  +F KW + RKYG++D
Sbjct: 478 ICSPNLFNETTILVVVHDTPEIWAKRNVITGTIDPSTSLVVDSGAEFIKWGLERKYGIMD 537

Query: 559 VNIPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAFVGFGDAYAGIVHLLGHRD 618
           +NIPQSLFEQ+NY+A++TSQE+L+YIWDNY+K+FPSL KVAF+G GDA AGIVHLLGHRD
Sbjct: 538 INIPQSLFEQENYTAVLTSQEILIYIWDNYLKFFPSLTKVAFIGIGDASAGIVHLLGHRD 597

Query: 619 TRATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDKNHPCWADNESKKPRKKFG 678
           TR+ VK+VVSFIG+K LKPLVPLV+ESL DWYFKNSL+FTD +H CW DNE++KPRKKFG
Sbjct: 598 TRSVVKSVVSFIGKKSLKPLVPLVNESLGDWYFKNSLVFTDHSHSCWGDNENRKPRKKFG 657

Query: 679 RVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE 714
           RVLRCD +G+N+ +EER EE+TDFILD FEEWSDSE
Sbjct: 658 RVLRCDAEGMNNIIEERLEESTDFILDSFEEWSDSE 693

>Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1150 bits (2976), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/695 (75%), Positives = 613/695 (88%), Gaps = 6/695 (0%)

Query: 20  VKRKMEEQNDGLDPKKSQLARTQNGAAGKRVIVPACAPNLHYTPLKTALCYDVRMRYHAK 79
           +KR +E      + K+ Q + +      ++VIVPAC P +HY+PLKT LCYDVRMRYHAK
Sbjct: 18  LKRTLE------NTKEDQNSLSTTSRNKRQVIVPACTPKIHYSPLKTGLCYDVRMRYHAK 71

Query: 80  IFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVREATDEEI 139
           IFTSYFEYIDPHPEDPRRIYR+YKILAENGLINDPTLSG+D+IGDLMLKIPVR AT EEI
Sbjct: 72  IFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDIGDLMLKIPVRAATSEEI 131

Query: 140 LEVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYVSAKLSCGGVIDACKAVVEG 199
           LEVH+KE+LEF+E + +M RE+LLKETEKGDSVYFNNDSY SA+L CGG I+ACKAVVEG
Sbjct: 132 LEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEG 191

Query: 200 RVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNG 259
           RVKN+LAVVRPPGHHAEP+A GGFCLFSNVAVAA+NILK YPESVRRI+ILDWDIHHGNG
Sbjct: 192 RVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNG 251

Query: 260 TQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVGGVGDAEY 319
           TQK+FY D +VLY+SLHRFEMGKYYPGTI G+YDQTGEGKGEGFNCNITWPVGGVGDAEY
Sbjct: 252 TQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEY 311

Query: 320 MLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHMLKSLARGNLC 379
           M AFEQ+VMPM REF+PDLVIISSGFDAADGDTIGQCHV+PSCYG MTHMLKSLARGNLC
Sbjct: 312 MWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLC 371

Query: 380 VALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDPKLEAIEMIDTVIHTQSKYWKCF 439
           V LEGGYNLDAIA SALSVAKVLIGEPPDELPD   DPK E IEMID VI  QSKYW CF
Sbjct: 372 VVLEGGYNLDAIARSALSVAKVLIGEPPDELPDSLSDPKPEVIEMIDKVIRLQSKYWNCF 431

Query: 440 QRKFGNAGCNFSEPVTETVISKSFPLQTAIRQEQFRQLSKEYGFVTLPISKLEIPDDSVL 499
           +R+  N+GCNF+EP+ +++ISK+FPLQ AIRQ+Q + LS E+ FVTLP+  + +PD++ L
Sbjct: 432 RRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQLQYLSNEFSFVTLPLINMGLPDNTAL 491

Query: 500 CSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVDSPLDFTKWCMNRKYGVIDV 559
           C+P VF+ + ++++VHDT ++WAKR+VI+G ID S+S+I+D+ +DF KW ++RKYG+IDV
Sbjct: 492 CTPNVFESNALLVVVHDTSDVWAKRNVISGTIDLSSSVIIDNCIDFIKWGLDRKYGIIDV 551

Query: 560 NIPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAFVGFGDAYAGIVHLLGHRDT 619
           NIP +LFE DNYS MITSQEVL+Y+WDNYIKYFP++AK+AF+G GD+++GIVHLLGHRDT
Sbjct: 552 NIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPNVAKIAFIGIGDSHSGIVHLLGHRDT 611

Query: 620 RATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDKNHPCWADNESKKPRKKFGR 679
           RA  K V++F+G KQLKPLVPLVDE+LS+WYFKNSLIF++ +H CW +NES+KPRKKFGR
Sbjct: 612 RAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKENESRKPRKKFGR 671

Query: 680 VLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE 714
           VLRCDTDGL++ +EERFEEATDFILD FEEWSD E
Sbjct: 672 VLRCDTDGLSNTIEERFEEATDFILDSFEEWSDDE 706

>NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON} 
          Length = 726

 Score = 1149 bits (2971), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/702 (76%), Positives = 617/702 (87%), Gaps = 6/702 (0%)

Query: 13  ENDTTLQVKRKMEEQNDGLDPKKSQLARTQNGAAGKRVIVPACAPNLHYTPLKTALCYDV 72
           ++DTT   KR M    +  + KK ++       + + VIVP     L YTPLKT LCYDV
Sbjct: 31  QSDTTQ--KRNMTAVKEEPELKKQKIT----DVSERPVIVPPRDAELSYTPLKTGLCYDV 84

Query: 73  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVR 132
           RMRYHAKIFTSYFEYIDPHPEDPRRIYR+YKILAENGLI DPTLSGI++IGDLMLKIPVR
Sbjct: 85  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVR 144

Query: 133 EATDEEILEVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYVSAKLSCGGVIDA 192
           +AT+EEILEVHSKE+ +F+E++S M REELLK TEKGDSVYFNNDS+ SAKL  GG I+A
Sbjct: 145 DATEEEILEVHSKEHYDFIEKTSTMNREELLKATEKGDSVYFNNDSFASAKLPVGGSIEA 204

Query: 193 CKAVVEGRVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDW 252
           CKAVVEGRVKN+LAVVRPPGHHAEP+A GGFCLFSNVA+AA+NILK YPESVRRI+ILDW
Sbjct: 205 CKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDW 264

Query: 253 DIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVG 312
           DIHHGNGTQKAFY+D RVLYISLHRFE+GKYYPGTING+YDQTGEGKGEGFNCNITWPVG
Sbjct: 265 DIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNITWPVG 324

Query: 313 GVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHMLKS 372
           GVGDAEY+ AFEQ+VMPMAREFQPDLVIISSGFDAADGD+IGQCHVTPSCYG MTHMLKS
Sbjct: 325 GVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTHMLKS 384

Query: 373 LARGNLCVALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDPKLEAIEMIDTVIHTQ 432
           LA+GNLCV LEGGYNLDAIA SALSVAK+LIGEPPDELPDP +DPK EAIE+ID VI  Q
Sbjct: 385 LAKGNLCVVLEGGYNLDAIARSALSVAKILIGEPPDELPDPLRDPKPEAIEIIDKVIRLQ 444

Query: 433 SKYWKCFQRKFGNAGCNFSEPVTETVISKSFPLQTAIRQEQFRQLSKEYGFVTLPISKLE 492
           SKYWKCF+R++GNAGCNF + + E++ISK+FPLQ AIR++Q   LS+++ F TLP+ K E
Sbjct: 445 SKYWKCFKRRYGNAGCNFKDEINESLISKNFPLQQAIREQQLNTLSQDFKFATLPLLKPE 504

Query: 493 IPDDSVLCSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVDSPLDFTKWCMNR 552
           +P D+VLCSP V+Q  T++I  HDTPEIWAKRDVI G IDPS+SIIVDS LDF KW   +
Sbjct: 505 LPKDTVLCSPNVYQSKTVIICAHDTPEIWAKRDVIQGTIDPSSSIIVDSTLDFIKWANEK 564

Query: 553 KYGVIDVNIPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAFVGFGDAYAGIVH 612
           KYGVID+NIPQ+LFEQ+NYSA++TSQEVL YIWDNY+KYFP++ KVAF+G GDAY+GIVH
Sbjct: 565 KYGVIDINIPQNLFEQENYSAIVTSQEVLTYIWDNYLKYFPNVEKVAFIGIGDAYSGIVH 624

Query: 613 LLGHRDTRATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDKNHPCWADNESKK 672
           LLGHRDTR+ VK+V++FI +KQL+ LVPLVDESLSDWYFKNSL+F+DK+H  W D E+KK
Sbjct: 625 LLGHRDTRSVVKSVINFIAQKQLRALVPLVDESLSDWYFKNSLVFSDKSHTYWGDKENKK 684

Query: 673 PRKKFGRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE 714
           PRKK+GR+LRC+TDG+N+ +EERFEEATDFILD FEEWSDSE
Sbjct: 685 PRKKYGRLLRCETDGINNIVEERFEEATDFILDSFEEWSDSE 726

>NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {ON}
           Anc_2.285 YNL021W
          Length = 689

 Score = 1142 bits (2955), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/667 (78%), Positives = 599/667 (89%)

Query: 48  KRVIVPACAPNLHYTPLKTALCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAE 107
           +++IVP     +HYTPLKT LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR+YKILAE
Sbjct: 23  RQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE 82

Query: 108 NGLINDPTLSGIDEIGDLMLKIPVREATDEEILEVHSKENLEFVERSSRMKREELLKETE 167
           NGLI DPTLSGID+IGDLMLKIPVREAT EEILEVHSKE+L+F+E +S+M RE+LLK TE
Sbjct: 83  NGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIESTSKMNREQLLKATE 142

Query: 168 KGDSVYFNNDSYVSAKLSCGGVIDACKAVVEGRVKNALAVVRPPGHHAEPEAPGGFCLFS 227
            GDSVYFN+DSY SAKL  GG I+ACKAVVEGRVKNALAVVRPPGHHAEPEA GGFCLFS
Sbjct: 143 SGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEAAGGFCLFS 202

Query: 228 NVAVAAQNILKQYPESVRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGT 287
           NVA+AA+NILK YPESVR+ILILDWDIHHGNGTQKAFY+D R+LY+SLHRF+MGKYYPGT
Sbjct: 203 NVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGT 262

Query: 288 INGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDA 347
           I+GRYDQTGEGKGEGFNCNITWPVGGVGDAEYM AFEQIVMPM REFQPDLVIIS+GFDA
Sbjct: 263 IHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDA 322

Query: 348 ADGDTIGQCHVTPSCYGQMTHMLKSLARGNLCVALEGGYNLDAIAISALSVAKVLIGEPP 407
           ADGDTIGQCHVTPSCYG MTHMLKSLARGN+ V LEGGYNLD+IAISALSVAK+LIGEPP
Sbjct: 323 ADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAISALSVAKILIGEPP 382

Query: 408 DELPDPTKDPKLEAIEMIDTVIHTQSKYWKCFQRKFGNAGCNFSEPVTETVISKSFPLQT 467
           DELPD T+DPK E IEMID V+  QSKYWKCF+ KFGNAGC+F E +  ++ +K+FPLQ+
Sbjct: 383 DELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGNAGCDFQEQINNSIATKNFPLQS 442

Query: 468 AIRQEQFRQLSKEYGFVTLPISKLEIPDDSVLCSPEVFQQSTIVIIVHDTPEIWAKRDVI 527
           AIRQ+Q R LSKE+ F  LPI K E+P+D++LCS  +++ +TI+I VHDTPEIWAKRD I
Sbjct: 443 AIRQQQVRNLSKEFNFSELPIYKSELPEDTILCSSNIYESNTIIICVHDTPEIWAKRDAI 502

Query: 528 TGVIDPSTSIIVDSPLDFTKWCMNRKYGVIDVNIPQSLFEQDNYSAMITSQEVLLYIWDN 587
            G IDPS+SIIVDS LD  KW + RKYGVID+NIPQ+L EQ+NY ++IT+QEVL+ +WDN
Sbjct: 503 QGTIDPSSSIIVDSSLDMIKWAIERKYGVIDINIPQNLLEQENYYSIITAQEVLINLWDN 562

Query: 588 YIKYFPSLAKVAFVGFGDAYAGIVHLLGHRDTRATVKAVVSFIGRKQLKPLVPLVDESLS 647
           Y+KYFP++ K+AFVG GDAY+GIVHLLGHRDTR+ VKAV++F+G+KQLKPLVPLVDESL 
Sbjct: 563 YLKYFPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVVKAVINFVGQKQLKPLVPLVDESLG 622

Query: 648 DWYFKNSLIFTDKNHPCWADNESKKPRKKFGRVLRCDTDGLNSNMEERFEEATDFILDLF 707
           +WYFKNSL+F++KNH  W D E+KKPRKK+GRVLRCDTDG+++ MEERFEEATDFILD F
Sbjct: 623 EWYFKNSLVFSNKNHIYWGDKENKKPRKKYGRVLRCDTDGISNIMEERFEEATDFILDSF 682

Query: 708 EEWSDSE 714
           EEWSDSE
Sbjct: 683 EEWSDSE 689

>SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 712

 Score = 1139 bits (2947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/704 (75%), Positives = 607/704 (86%), Gaps = 5/704 (0%)

Query: 14  NDTTLQVKRKMEEQ-NDGLDPKKSQLARTQNGAAGKRVIVPACAPNLHYTPLKTALCYDV 72
           ND+ ++VK  ME+     +D  + ++   +       VIVP   P +HYT LKT LCYDV
Sbjct: 11  NDSAVEVK--MEDSLKRKVDTMEDEVESRKRSTGTLPVIVPEVPPRIHYTQLKTGLCYDV 68

Query: 73  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVR 132
           RMRYHAKI+TSYFEYIDPHPEDPRRIYR+YKILAENGLI DPTLSG+DEIG+LMLKIPVR
Sbjct: 69  RMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVR 128

Query: 133 EATDEEILEVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYVSAKLSCGGVIDA 192
           EAT EEIL+VH+KE+L F+E++ +M RE+LLKETE GDSVYFNNDS +SAKLSCGG I+A
Sbjct: 129 EATAEEILQVHTKEHLAFLEKTPKMTREQLLKETETGDSVYFNNDSLLSAKLSCGGAIEA 188

Query: 193 CKAVVEGRVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDW 252
           CKAVVEGRVKNALAV+RPPGHHAEPE  GGFCLFSNVAVAAQNILK YPESVRRI+ILDW
Sbjct: 189 CKAVVEGRVKNALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDW 248

Query: 253 DIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVG 312
           DIHHGNGTQKAFY+D RVLY+SLHR+E+GKYYPGT++G Y+QTGEGKGEGFNCNI WP G
Sbjct: 249 DIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPWPYG 308

Query: 313 GVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHMLKS 372
           G+GDAEYM AF+Q+VMPM REFQPDLVIISSGFDAADGDTIGQCHV+PSCYG MTHMLKS
Sbjct: 309 GLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKS 368

Query: 373 LARGNLCVALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDPKLEAIEMIDTVIHTQ 432
           LARGNLCV LEGGYNLD+IA SAL VAK+LIGEPPDELP PT+ PK EAIE I+TVI TQ
Sbjct: 369 LARGNLCVVLEGGYNLDSIAKSALGVAKILIGEPPDELPHPTQQPKPEAIETIETVIRTQ 428

Query: 433 SKYWKCFQRKFGNAGCNFSEPVTETVISKSFPLQTAIRQEQFRQLSKEYGFVTLPISKLE 492
           SKYW CF+    N GCNF E VTE+ ISK+FPLQ AIRQEQ +QLS+++GFVTLP+  +E
Sbjct: 429 SKYWNCFKSTHSNDGCNFKEEVTESTISKNFPLQQAIRQEQLQQLSEKFGFVTLPLLNME 488

Query: 493 IPDDSVLCSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVDSPLDFTKWCMNR 552
           +P D+V+CSP ++   T+V+ VHDTPEIWA+R+ ITG IDPSTSIIVD+ LD  KW + R
Sbjct: 489 VPQDTVICSPNIYDAETVVVCVHDTPEIWAQRNPITGTIDPSTSIIVDTTLDIIKWSLQR 548

Query: 553 KYGVIDVNIPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAFVGFGDAYAGIVH 612
           KY VIDVNIPQSLFEQDNYSAMITSQEVL+YIWDNY+KYFPSLAKVAF+G GDAY+GIVH
Sbjct: 549 KYSVIDVNIPQSLFEQDNYSAMITSQEVLVYIWDNYLKYFPSLAKVAFIGVGDAYSGIVH 608

Query: 613 LLGHRDTRATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDKNHPCWAD--NES 670
           LLGHRDTR+ VKA VSF+  K LK LVPLVDESL +WYFKNSL+FT KNH CW    NE+
Sbjct: 609 LLGHRDTRSVVKAAVSFVDTKPLKSLVPLVDESLGNWYFKNSLVFTSKNHSCWGTDGNEN 668

Query: 671 KKPRKKFGRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE 714
           KKPRK+FGRVL+CDT G+N+ +EERF+EATDFILD FEEWSDSE
Sbjct: 669 KKPRKRFGRVLKCDTTGMNNIVEERFQEATDFILDSFEEWSDSE 712

>KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.285
           YNL021W
          Length = 693

 Score = 1121 bits (2899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/681 (75%), Positives = 597/681 (87%), Gaps = 2/681 (0%)

Query: 36  SQLARTQNGAAGKRVIVPACAPNLHYTPLKTALCYDVRMRYHAKIFTSYFEYIDPHPEDP 95
           SQ     +  + +++IV  CAP L YTPLKT LCYDVRMRYHAKIFTSYFEYIDPHPEDP
Sbjct: 13  SQKPAESSTHSKRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDP 72

Query: 96  RRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVREATDEEILEVHSKENLEFVERSS 155
           RRIYR+YKILAENGLI DP LSGID+IGDLMLKIPVREAT +E+LEVHSKE+LEF+E  +
Sbjct: 73  RRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVHSKEHLEFIESVT 132

Query: 156 RMKREELLKETEKGDSVYFNNDSYVSAKLSCGGVIDACKAVVEGRVKNALAVVRPPGHHA 215
           +M  +ELLK TE GDSVYFNNDS  SAKLSCGG I+ACKAVVEGRVKNA AVVRPPGHH+
Sbjct: 133 KMSHDELLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPGHHS 192

Query: 216 EPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGTQKAFYNDPRVLYISL 275
           EPE+ GGFCLFSNVAVA++NIL+ YPESVRRI+ILDWDIHHGNGTQKAFY+D RVLYISL
Sbjct: 193 EPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISL 252

Query: 276 HRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMLAFEQIVMPMAREFQ 335
           HRFE+GKYYPGT  G YD+TGEGKGEGFNCNITWPVGGVGDAEYM AFEQ+VMPM+REF+
Sbjct: 253 HRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFR 312

Query: 336 PDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHMLKSLARGNLCVALEGGYNLDAIAISA 395
           PDLVIIS+GFDAADGDTIGQCHV+PSCYG MTHMLKSLA GNLCV LEGGYNLDAIA SA
Sbjct: 313 PDLVIISAGFDAADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIARSA 372

Query: 396 LSVAKVLIGEPPDELPDPTKDPKLEAIEMIDTVIHTQSKYWKCFQRKFGNAGCNFSEPVT 455
           LSVAKVLIGEPP+EL DP KDPK EAIE+I+ VI  QSKYWKCFQR+ GN+GC F + +T
Sbjct: 373 LSVAKVLIGEPPEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRRHGNSGCTFEKHMT 432

Query: 456 ETVISKSFPLQTAIRQEQFRQLSKEYGFVTLPISKLEIPDDSVLCSPEVFQQSTIVIIVH 515
           E++ + +FPLQ+AIRQ+QF  LSKE+GFV  P+ ++++ DD+V+CSPEV+ + TI+I+V 
Sbjct: 433 ESISTDNFPLQSAIRQQQFSALSKEFGFVKFPLFEMKLSDDTVICSPEVYNKDTIIILVR 492

Query: 516 DTPEIWAKRDVITGVIDPSTSIIVDSPLDFTKWCMNRKYGVIDVNIPQSLFEQDNYSAMI 575
           DTPEIWAKRDVI G IDPS SII D+ L F KW M R YGVIDVNIPQSLFEQDNYSAMI
Sbjct: 493 DTPEIWAKRDVIQGTIDPSASIITDAALAFIKWAMERNYGVIDVNIPQSLFEQDNYSAMI 552

Query: 576 TSQEVLLYIWDNYIKYFPSLAKVAFVGFGDAYAGIVHLLGHRDTRATVKAVVSFIGRKQL 635
           T+QEV+ ++WDNYI++F S +K+AFVG GDA +GIVHLLGHRDTR+ VK+V++FI +K L
Sbjct: 553 TAQEVMSFMWDNYIRFFGSASKIAFVGVGDACSGIVHLLGHRDTRSKVKSVINFIAQKTL 612

Query: 636 KPLVPLVDESLSDWYFKNSLIFTDKNHPCWAD--NESKKPRKKFGRVLRCDTDGLNSNME 693
           KPL+PLVDE+L DWYFKNSL+F+DKNH CW D  NE+KKPRKKFGRVLRC++DGL + +E
Sbjct: 613 KPLIPLVDETLGDWYFKNSLVFSDKNHACWGDNENENKKPRKKFGRVLRCNSDGLTNIIE 672

Query: 694 ERFEEATDFILDLFEEWSDSE 714
           ERFEEATDF+LD FEEWS+S+
Sbjct: 673 ERFEEATDFMLDSFEEWSESD 693

>KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.285
           YNL021W
          Length = 702

 Score = 1111 bits (2874), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/699 (73%), Positives = 593/699 (84%), Gaps = 14/699 (2%)

Query: 20  VKRKMEEQNDGLDPKKSQLARTQNGAAGKRVIVPACAPNLHYTPLKTALCYDVRMRYHAK 79
            KRK EE+N            + N    ++VIVP   P +HY PLKT LCYDVRMRYHAK
Sbjct: 14  TKRKQEEEN----------LESLNVVPKRQVIVPTKKPQVHYIPLKTGLCYDVRMRYHAK 63

Query: 80  IFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVREATDEEI 139
           IFTSYFEYIDPHPEDPRRIYR+YKILAENGLIND  LSG+D+IGD+MLKIPVREAT +EI
Sbjct: 64  IFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVREATADEI 123

Query: 140 LEVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYVSAKLSCGGVIDACKAVVEG 199
           LEVHS+E+LEF+E ++ M RE LLKETEKGDSVYFNNDSY+SAKLSCGG I+ACKAVVEG
Sbjct: 124 LEVHSREHLEFLESTTTMNREVLLKETEKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEG 183

Query: 200 RVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNG 259
           +VKNALAVVRPPGHH+EPE+ GGFCLFSNVAVAA+NILK YPESVR+I+ILDWDIHHGNG
Sbjct: 184 KVKNALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNG 243

Query: 260 TQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVGGVGDAEY 319
           TQKAFY D RVLY+SLHRFE GKYYPGT+ G+YDQ GEGKGEGFNCNITWP GGVGDAEY
Sbjct: 244 TQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEY 303

Query: 320 MLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHMLKSLARGNLC 379
           M AFEQIVMPM REFQPDLVIISSGFDAADGD IGQCHVTPSCYG MTHMLKSLARGNL 
Sbjct: 304 MWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLARGNLV 363

Query: 380 VALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDPKLEAIEMIDTVIHTQSKYWKCF 439
           V LEGGYNLD+IAISALSVAK LIGEPPDELPDP KDPK EA+EMI  VI  QSKYWKCF
Sbjct: 364 VVLEGGYNLDSIAISALSVAKTLIGEPPDELPDPLKDPKPEALEMIYKVIKIQSKYWKCF 423

Query: 440 QRKFGNAGCNFSEPVTETVISKSFPLQTAIRQEQFRQLSKEYGFVTLPISKLEIPDDSVL 499
           +R+ GN   NFSE  ++T+ +K+FPLQTAIRQ+Q+  L KEY FV  P + L++PDD +L
Sbjct: 424 KRRHGNYNINFSEVASDTLATKTFPLQTAIRQQQYYNLFKEYDFVKFPTANLKLPDDLIL 483

Query: 500 CSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVDSPLDFTKWCMNRKYGVIDV 559
           CSP +    T++IIVHDTP+IW ++D+I+  +DP +SII+DS LDF KW  NRKYG+IDV
Sbjct: 484 CSPNIHTAETVIIIVHDTPQIWLEKDIISNTVDPCSSIIIDSTLDFLKWAHNRKYGIIDV 543

Query: 560 NIPQSLF----EQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAFVGFGDAYAGIVHLLG 615
           NIPQSL       DNYS++I +QE+LL++WDN+IK+   + K+AF+G GD+ +G+VHLLG
Sbjct: 544 NIPQSLIYGDENPDNYSSLINAQEILLFLWDNHIKFLNEVNKIAFIGVGDSVSGVVHLLG 603

Query: 616 HRDTRATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDKNHPCWADNESKKPRK 675
           HRDT+  VKAV++F+  KQLKPLVPLVDESLSDWYFKNSL+F+++ HPCW D E+KKPRK
Sbjct: 604 HRDTKERVKAVINFMADKQLKPLVPLVDESLSDWYFKNSLVFSNRTHPCWGDKENKKPRK 663

Query: 676 KFGRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE 714
           K+GRVLRCDTDGLNS +EERF+EATDFILD FEEWSDSE
Sbjct: 664 KYGRVLRCDTDGLNSTIEERFDEATDFILDSFEEWSDSE 702

>KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 708

 Score = 1110 bits (2870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/698 (73%), Positives = 598/698 (85%), Gaps = 12/698 (1%)

Query: 26  EQNDGLDPKKSQLARTQNGAAGKR-------VIVPACAPNLHYTPLKTALCYDVRMRYHA 78
           EQ +GL  K+   + T N   G +        IVPAC P LHYTPLKT LCYDVRMRYHA
Sbjct: 14  EQINGL--KRDHESATLNDGTGNQASVAKRPTIVPACRPKLHYTPLKTGLCYDVRMRYHA 71

Query: 79  KIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVREATDEE 138
           KIFTSYFEYIDPHPEDPRRIYR+YKILAENGLI+DPTLSG+D IGDLMLKIPVREATDEE
Sbjct: 72  KIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKIPVREATDEE 131

Query: 139 ILEVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYVSAKLSCGGVIDACKAVVE 198
           IL+VH+KE+LEF+ +++ M R++LLKETEKGDSVYFNNDSY+SAKLSCGG I+ACKAVVE
Sbjct: 132 ILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKLSCGGAIEACKAVVE 191

Query: 199 GRVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGN 258
           GRVKNALAVVRPPGHHAEPE  GGFCLFSNVAVAAQNILK YPESVR+I++LDWD+HHGN
Sbjct: 192 GRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDVHHGN 251

Query: 259 GTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVGGVGDAE 318
           GTQKAFY+D RVLYISLHR E+GKYYPGTI+G  D+ GEGKGEGFNCNI WP  GVGD+E
Sbjct: 252 GTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPWPWKGVGDSE 311

Query: 319 YMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHMLKSLARGNL 378
           Y+ AFEQ++MPM REF+PDLVIISSGFDAADGDT+GQCHVTPSCYG MTHMLKSLARGNL
Sbjct: 312 YLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNL 371

Query: 379 CVALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDPKLEAIEMIDTVIHTQSKYWKC 438
           C  LEGGY+LD+IA SAL+VAKVLIGEPPDELP   K PKLEA+E+ID+VI TQSKYWKC
Sbjct: 372 CAVLEGGYSLDSIAKSALAVAKVLIGEPPDELP-VVKQPKLEAVEVIDSVIKTQSKYWKC 430

Query: 439 FQRKFGNAGCNFSEPVTETVISKSFPLQTAIRQEQFRQLSKEYGFVTLPISKLEIPDDSV 498
           F+   GN GC+F E  T+T I+K+FPLQ AIRQ+Q R L+ E+ FVTLP+ K E+PDD+ 
Sbjct: 431 FKSTHGNDGCSFKEQATDTAINKNFPLQNAIRQQQMRLLANEFRFVTLPLFKKELPDDTA 490

Query: 499 LCSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVDSPLDFTKWCMNRKYGVID 558
           +CSP ++  S I++ VHDTP IWA+R   TG IDPSTSIIVD+ LD  KW  +R YGVID
Sbjct: 491 ICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSIIVDTTLDVIKWASSRNYGVID 550

Query: 559 VNIPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAFVGFGDAYAGIVHLLGHRD 618
           +NIPQSL EQDNYSA+IT+QEVL++IWDNY+KYFPSL +VAFV  GDA++G+VHLLGHRD
Sbjct: 551 INIPQSLHEQDNYSAVITAQEVLVHIWDNYLKYFPSLNRVAFVAIGDAHSGVVHLLGHRD 610

Query: 619 TRATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDKNHPCWAD--NESKKPRKK 676
           TR+ VK+ VSF+ ++ L+PL+PLVDE+L+DWYFKNSL+F    H CW +  NE+KKPRKK
Sbjct: 611 TRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFASAEHTCWGNDGNENKKPRKK 670

Query: 677 FGRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE 714
           FGRVL+CD+DG+N+ +EERFEEATDFILD FEEWSDSE
Sbjct: 671 FGRVLKCDSDGINNILEERFEEATDFILDTFEEWSDSE 708

>Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021W
           (HDA1) - histone deacetylase, shares sequence similarity
           with Rpd3p, Hos1p, Hos2p, and Hos3p [contig 27] FULL
          Length = 708

 Score = 1099 bits (2842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/697 (73%), Positives = 595/697 (85%), Gaps = 7/697 (1%)

Query: 24  MEEQNDGLDPKKSQLARTQNGAAGKRV----IVPACAPNLHYTPLKTALCYDVRMRYHAK 79
           ++++N      ++ L   +NG +  +V    IVPAC   LHYTPLKT LCYDVRMRYHAK
Sbjct: 13  LKQENGFKRDAENALLEEENGGSETKVKRPVIVPACRAKLHYTPLKTGLCYDVRMRYHAK 72

Query: 80  IFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVREATDEEI 139
           IFTSYFEYIDPHPEDPRRIYR+YKILAENGLI DPTLSG+D+IGDLMLKIP REATDEEI
Sbjct: 73  IFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPAREATDEEI 132

Query: 140 LEVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYVSAKLSCGGVIDACKAVVEG 199
           L+VH+ E+LEF+ +++ M RE+LLKETEKGDSVYFNNDSY+SAKLSCGG I+AC+AVVEG
Sbjct: 133 LQVHTPEHLEFLSKTTSMTREQLLKETEKGDSVYFNNDSYLSAKLSCGGAIEACRAVVEG 192

Query: 200 RVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNG 259
           RVKNALAVVRPPGHHAEP+  GGFCLFSNVAVAAQNILK YPESV++I+ILDWD+HHGNG
Sbjct: 193 RVKNALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNG 252

Query: 260 TQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVGGVGDAEY 319
           TQKAFYND RVLY+SLHR E+GKYYPGTI+G  D+ GEGKGEGFNCNI WP  GVGDAEY
Sbjct: 253 TQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEY 312

Query: 320 MLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHMLKSLARGNLC 379
           + AFEQ+V+PM REFQPDLVIISSGFDAADGDT+GQCHVTPSCYG MTHMLKSLARGN+C
Sbjct: 313 IWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNIC 372

Query: 380 VALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDPKLEAIEMIDTVIHTQSKYWKCF 439
             LEGGY+LD+IA SAL VAKVLIGEPPDELP   K PK EA+E+ID VI  QS+YW+CF
Sbjct: 373 AVLEGGYSLDSIAKSALGVAKVLIGEPPDELP-VVKQPKPEAVEVIDAVIKMQSRYWQCF 431

Query: 440 QRKFGNAGCNFSEPVTETVISKSFPLQTAIRQEQFRQLSKEYGFVTLPISKLEIPDDSVL 499
           +    N GC+F EPVTET+++++FPLQTAIRQ+Q R L+ EY FVTLP+ K E+PDD+ L
Sbjct: 432 KSTHANDGCSFKEPVTETLLNRNFPLQTAIRQQQVRLLTTEYNFVTLPLIKKELPDDTAL 491

Query: 500 CSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVDSPLDFTKWCMNRKYGVIDV 559
           CSP ++   +I++ VHDTPEIWA+R   TG IDPSTSIIVD+ LD  KW   R YGVID+
Sbjct: 492 CSPNIYDSQSIIVCVHDTPEIWAQRSRATGTIDPSTSIIVDTTLDVIKWASKRNYGVIDI 551

Query: 560 NIPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAFVGFGDAYAGIVHLLGHRDT 619
           NIPQSL EQDNYSA++T+QEVL+YIWD+Y+KYF SL+KVAFV  GDAY+G+VHLLGHRDT
Sbjct: 552 NIPQSLHEQDNYSAVLTAQEVLVYIWDSYLKYFTSLSKVAFVSIGDAYSGVVHLLGHRDT 611

Query: 620 RATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDKNHPCWADN--ESKKPRKKF 677
           R  VKA +SFI ++ L+PLVPLVDESL+DWYFKNSL+F    H CW ++  E+KKPRKKF
Sbjct: 612 RNVVKAAISFIDQRPLRPLVPLVDESLADWYFKNSLVFASAGHTCWGNDGAENKKPRKKF 671

Query: 678 GRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE 714
           GRVL+C++DGLN+ +EERFEEATDFILD FEEWSDSE
Sbjct: 672 GRVLKCNSDGLNNILEERFEEATDFILDTFEEWSDSE 708

>Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}
           similar to Ashbya gossypii ADL216C
          Length = 706

 Score = 1095 bits (2832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/699 (72%), Positives = 597/699 (85%), Gaps = 5/699 (0%)

Query: 21  KRKME-EQND--GLDPKKSQLARTQNGAAGKRVIVPACAPNLHYTPLKTALCYDVRMRYH 77
           KRK+E + ND  G++  K+ +++       + +IVP   P +HY PLKT LCYDVRMRYH
Sbjct: 8   KRKLEIDGNDTIGVENMKTAVSKLTVAQQKRPIIVPVVKPKIHYVPLKTGLCYDVRMRYH 67

Query: 78  AKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVREATDE 137
           AKIFTSYFEYIDPHPEDPRRIYR+YKILAENGLI DPTLSG+D+IG+LMLKIP+REAT++
Sbjct: 68  AKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIREATED 127

Query: 138 EILEVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYVSAKLSCGGVIDACKAVV 197
           EIL VHSKE++EF++ ++ M RE+LLKETE GDSVY+NNDS VSAKLSCGG I+ACKAVV
Sbjct: 128 EILLVHSKEHVEFLKTTNTMSREQLLKETEAGDSVYYNNDSLVSAKLSCGGAIEACKAVV 187

Query: 198 EGRVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHG 257
           EGRVKNALAVVRPPGHHAEPE  GGFCLFSNVAVAA+NILK YPESVR+++ILDWDIHHG
Sbjct: 188 EGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHG 247

Query: 258 NGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVGGVGDA 317
           NGTQ+AFYND RVLY+SLHR+E+G+YYPGT  G Y+Q+GEGKGEGFNCNI W  GGVGDA
Sbjct: 248 NGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGGVGDA 307

Query: 318 EYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHMLKSLARGN 377
           EYM AFEQIV+PM REFQPDLVIISSGFDAADGDTIGQCHV+P+CYG MTHMLKSLA+GN
Sbjct: 308 EYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTHMLKSLAKGN 367

Query: 378 LCVALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDPKLEAIEMIDTVIHTQSKYWK 437
           +CV LEGGYNLD+IA SAL V KVLIGEPPDELPDP K PK EAI  I+TVI  Q+KYW 
Sbjct: 368 MCVVLEGGYNLDSIAKSALGVVKVLIGEPPDELPDPFKQPKPEAIATIETVIREQAKYWD 427

Query: 438 CFQRKFGNAGCNFSEPVTETVISKSFPLQTAIRQEQFRQLSKEYGFVTLPISKLEIPDDS 497
           CF+ K GN G N+ EPV E++  K+FPLQ+A+RQEQFR+LSKEY FVTLP+  +E+  D+
Sbjct: 428 CFKSKHGNCGVNWKEPVDESLTFKNFPLQSAVRQEQFRRLSKEYKFVTLPLLDMELSGDT 487

Query: 498 VLCSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVDSPLDFTKWCMNRKYGVI 557
           ++CSP + +  T++I VHDTPE+WAKR+ +TG IDPSTSIIVD+ L  T W + R YG+I
Sbjct: 488 IICSPNIHETDTLIICVHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITNWALGRSYGII 547

Query: 558 DVNIPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAFVGFGDAYAGIVHLLGHR 617
           D+NIPQSLFE DNYSA++TSQEVL Y+WD+Y+K+F  L +VAFVG GDAY+G VHLLGHR
Sbjct: 548 DINIPQSLFELDNYSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDAYSGFVHLLGHR 607

Query: 618 DTRATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDKNHPCWA--DNESKKPRK 675
           DTR+ VK  +SF  +KQL+PLVPLVDES+SDWYFKNSLIFT K H CW    N+SKKPRK
Sbjct: 608 DTRSIVKCAISFTDKKQLRPLVPLVDESISDWYFKNSLIFTSKYHSCWGTEGNDSKKPRK 667

Query: 676 KFGRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE 714
           KFGRVL+C++DG+N+ +EERFEEATDFILD FEEWSDSE
Sbjct: 668 KFGRVLKCNSDGMNNILEERFEEATDFILDSFEEWSDSE 706

>ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL021W
           (HDA1)
          Length = 705

 Score = 1046 bits (2704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/702 (70%), Positives = 576/702 (82%), Gaps = 8/702 (1%)

Query: 19  QVKRKMEEQNDGLDPKKSQLARTQNGAAGKR-VIVPACAPNLHYTPLKTALCYDVRMRYH 77
           Q KRK+EE +   +    Q +R       KR VIVP   P + Y PLKT LCYDVRMRYH
Sbjct: 6   QQKRKLEEGSPDGEANGGQASR--KAIVQKRPVIVPPVRPKISYVPLKTGLCYDVRMRYH 63

Query: 78  AKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVREATDE 137
           AKIFTSYFEYIDPHPEDPRRIYR+YKILAENGLI DPTLSGIDEIG+LM KIPVREAT+E
Sbjct: 64  AKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVREATEE 123

Query: 138 EILEVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYVSAKLSCGGVIDACKAVV 197
           EIL VHSKE++EF++ ++ M RE+LLKETE GDSVY+NNDS +SA+LSCGG I+ACKAVV
Sbjct: 124 EILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDSLISARLSCGGAIEACKAVV 183

Query: 198 EGRVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHG 257
           EGRVKNA+AVVRPPGHHAEP   GGFCLFSNVAVAAQNILK YPESVRR++ILDWDIHHG
Sbjct: 184 EGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHG 243

Query: 258 NGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVGGVGDA 317
           NGTQKAFY D RVLY+SLHR+E+GKYYPGT  G YDQ G+GKGEGFNCNI W   GVGDA
Sbjct: 244 NGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIPWSCSGVGDA 303

Query: 318 EYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHMLKSLARGN 377
           EYM AFEQ+V+PM REFQPDLVIISSGFDAADGDTIGQCHV+P+CYG +THMLKSLARGN
Sbjct: 304 EYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTHMLKSLARGN 363

Query: 378 LCVALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDPKLEAIEMIDT-VIHTQSKYW 436
           +CV LEGGYNLD+IA SAL VAKVLIGEPPDELP P K PK EAI  ID  ++  QSKYW
Sbjct: 364 MCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPEAIVTIDMGLVKEQSKYW 423

Query: 437 KCFQRKFGNAGCNFSE-PVTETVISKSFPLQTAIR-QEQFRQLSKEYGFVTLPISKLEIP 494
            CF+ + GN G N+ E  V +++ SK+FPLQ       QFR+L+KEY FVTLP+  +E+P
Sbjct: 424 NCFKGRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFRRLAKEYKFVTLPLLNMELP 483

Query: 495 DDSVLCSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVDSPLDFTKWCMNRKY 554
            D+++CSP +     I+I VHDTPEIWA+RD +TG IDPSTSIIVD+ +    W + R Y
Sbjct: 484 SDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSIIVDTTVSVINWALGRNY 543

Query: 555 GVIDVNIPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAFVGFGDAYAGIVHLL 614
           GVID+NIPQSLFEQDNYSA+++SQEV+ Y+WD+Y+K FP LA+VAFVG GDAY+G VHLL
Sbjct: 544 GVIDINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLARVAFVGIGDAYSGFVHLL 603

Query: 615 GHRDTRATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDKNHPCWA--DNESKK 672
           GHRDTR+ VK  ++F  +KQL+PLVPLVDESL DWYFKNSL+FT   HPCW    N+SKK
Sbjct: 604 GHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVFTSTYHPCWGTDGNDSKK 663

Query: 673 PRKKFGRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE 714
           PRKKFGRVLR   DG+N+ +EER EEATDFILD FEEWS+SE
Sbjct: 664 PRKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE 705

>KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 704

 Score = 1039 bits (2686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/667 (70%), Positives = 564/667 (84%), Gaps = 2/667 (0%)

Query: 50  VIVPACAPNLHYTPLKTALCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENG 109
           VIVP   P + Y+ LKT +CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENG
Sbjct: 38  VIVPPTKPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENG 97

Query: 110 LINDPTLSGIDEIGDLMLKIPVREATDEEILEVHSKENLEFVERSSRMKREELLKETEKG 169
           LI DPTLSG D IGDLM+K+PVREA +EEIL+VHS+++L+F+ ++ +++RE LLKETE G
Sbjct: 98  LIQDPTLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQTEQLERESLLKETEGG 157

Query: 170 DSVYFNNDSYVSAKLSCGGVIDACKAVVEGRVKNALAVVRPPGHHAEPEAPGGFCLFSNV 229
           DSVYFNNDSY+SAKLSCGG I+ACKAVVEGRVKN++AVVRPPGHHAEPE  GGFCLFSNV
Sbjct: 158 DSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPGHHAEPEIAGGFCLFSNV 217

Query: 230 AVAAQNILKQYPESVRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTIN 289
           AVAA N+LK YPESVR+I+I+DWDIHHGNGTQKAFY+D RVLY+SLHR+++GKYYPGTI+
Sbjct: 218 AVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIH 277

Query: 290 GRYDQTGEGKGEGFNCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAAD 349
           G YDQTGEGKGEGFNCNITWP GGVGDAEYM AFEQ++MPM REF+PDLV+ISSGFDAAD
Sbjct: 278 GNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAAD 337

Query: 350 GDTIGQCHVTPSCYGQMTHMLKSLARGNLCVALEGGYNLDAIAISALSVAKVLIGEPPDE 409
           GDTIGQCHVTP+CYG MTHML SLA+GNLCV LEGGYNLD+IA SAL V KVL+GEPPDE
Sbjct: 338 GDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAKSALGVCKVLVGEPPDE 397

Query: 410 LPDPTKDPKLEAIEMIDTVIHTQSKYWKCFQRKFGNAGCNFSEPVTETVISKSFPLQTAI 469
           LP P K P  EA +MI+TVI TQSKYW CF+ + GN G NF + +T T+ +++FPLQ AI
Sbjct: 398 LPAPKKQPTPEAKKMIETVIRTQSKYWSCFKNRHGNDGINFKDAITSTLDTRNFPLQNAI 457

Query: 470 RQEQFRQLSKEYGFVTLPISKLEIPDDSVLCSPEVFQQSTIVIIVHDTPEIWAKRDVITG 529
           R+ Q  QLS ++ FV LPI  L +P +++LC+  +    T+V+IVHDTPEIW++RD  TG
Sbjct: 458 REYQVSQLSSQFNFVQLPILDLNLPANTMLCTSGIQDSETLVVIVHDTPEIWSERDTQTG 517

Query: 530 VIDPSTSIIVDSPLDFTKWCMNRKYGVIDVNIPQSLFEQDNYSAMITSQEVLLYIWDNYI 589
           +IDPS+SIIVD+ L    W M+R+YG+ID+NIPQ+LFE  NY  + +SQE+L+Y+WDNY+
Sbjct: 518 IIDPSSSIIVDNALKMINWAMDRRYGIIDINIPQTLFEHANYPGVASSQEILIYLWDNYL 577

Query: 590 KYFPSLAKVAFVGFGDAYAGIVHLLGHRDTRATVKAVVSFIGRKQLKPLVPLVDESLSDW 649
           K+F +L KVAF+G GDAY GIVHLLGHRDTR+ VK  +SF+ +K LK +VPL+DE+L DW
Sbjct: 578 KFFQNLQKVAFIGIGDAYGGIVHLLGHRDTRSVVKCAISFLDKKPLKVMVPLIDETLGDW 637

Query: 650 YFKNSLIFTDKNHPCWAD--NESKKPRKKFGRVLRCDTDGLNSNMEERFEEATDFILDLF 707
           YFKNSL+FT   H CW    NE+KK RKK+GRVL+ D DG+ +  +ERFEEATDFILD F
Sbjct: 638 YFKNSLVFTSSTHSCWGSTANENKKLRKKYGRVLKADCDGMTNIFDERFEEATDFILDSF 697

Query: 708 EEWSDSE 714
           EEWS+SE
Sbjct: 698 EEWSESE 704

>Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON}
           (99859..101838) [1980 nt, 660 aa]
          Length = 659

 Score = 1036 bits (2680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/655 (70%), Positives = 563/655 (85%)

Query: 58  NLHYTPLKTALCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLS 117
           +L YTPLKT LCYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYR+YKILAENGLI DP LS
Sbjct: 4   SLSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALS 63

Query: 118 GIDEIGDLMLKIPVREATDEEILEVHSKENLEFVERSSRMKREELLKETEKGDSVYFNND 177
           GID+IGDLM KIPVREAT EEILEVH KE LE++E++  + R+ELL +TE GDSVYFNND
Sbjct: 64  GIDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNND 123

Query: 178 SYVSAKLSCGGVIDACKAVVEGRVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNIL 237
           SY SAKLSCGG I+ACKA+V+G+VKN+LA+VRPPGHH+EPE  GGFCLFSNVAVA +NIL
Sbjct: 124 SYFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNIL 183

Query: 238 KQYPESVRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGE 297
           K YP+ V++++I+DWDIHHGNGTQKAFYND RVLY+SLHRFE+GKYYPGTI+G+YDQ GE
Sbjct: 184 KNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGE 243

Query: 298 GKGEGFNCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCH 357
           GKGEGFNCNI W VGG+GDAEY+ AFEQIVMPM REF+PDLVI+SSGFDAADGDTIG+CH
Sbjct: 244 GKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCH 303

Query: 358 VTPSCYGQMTHMLKSLARGNLCVALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDP 417
           VTPSCYG MTHMLKSLA G LCV LEGGYNLDAIA SAL+VAKVLIGEPPDELP P KDP
Sbjct: 304 VTPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKDP 363

Query: 418 KLEAIEMIDTVIHTQSKYWKCFQRKFGNAGCNFSEPVTETVISKSFPLQTAIRQEQFRQL 477
           K EAIEMID VI  +SKYWKCF+R+  N+ C +  P++E+  +K FP+Q AIR +Q + L
Sbjct: 364 KPEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQYL 423

Query: 478 SKEYGFVTLPISKLEIPDDSVLCSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSI 537
           + +Y  V LP+    +P+D+V+CS ++ Q +  +I VHDTPEIW+KRD I GVID S S+
Sbjct: 424 TNDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSASL 483

Query: 538 IVDSPLDFTKWCMNRKYGVIDVNIPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAK 597
            +D+ L F  W ++R YG+IDVNIPQ+L+EQDNYSA +T+QEVL+ +WDN +KYFP++ K
Sbjct: 484 YMDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVNK 543

Query: 598 VAFVGFGDAYAGIVHLLGHRDTRATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIF 657
           +A++G G+AY+G+VHLLGHRDTR+ VK+V+ F+G+K LK LVPLV+ESL+DWYFK SL+F
Sbjct: 544 IAYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLLF 603

Query: 658 TDKNHPCWADNESKKPRKKFGRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSD 712
            DKNH CW +N+SKKPRK++GRVLRCD+DG+ S +EERFEEATDFI+D  +EW++
Sbjct: 604 ADKNHSCWGENDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTE 658

>TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {ON}
           Anc_2.285 YNL021W
          Length = 701

 Score = 1013 bits (2620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/694 (66%), Positives = 569/694 (81%), Gaps = 2/694 (0%)

Query: 21  KRKMEEQNDGLDPKKSQLARTQNGAAGKRVIVPACAPNLHYTPLKTALCYDVRMRYHAKI 80
           KRK++++++          +       + VIVP   PNLHYTPLKT +CYDVRMRYHAKI
Sbjct: 8   KRKLKDESEFPSVSIGDEGKVIQVLPKRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKI 67

Query: 81  FTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVREATDEEIL 140
           FTSYFEYIDPHPEDPRRIYR+YKILAENGLINDP+L+G+ +IGDLMLKIPVREAT EEIL
Sbjct: 68  FTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVREATKEEIL 127

Query: 141 EVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYVSAKLSCGGVIDACKAVVEGR 200
           +VH++E+++F+E + +M REELL +TEKGDSVY NNDSY+SA+LSCGG I+ACKAVVEGR
Sbjct: 128 DVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEGR 187

Query: 201 VKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGT 260
           VKNALA+VRPPGHHAEP+A GGFCLFSNV+VAA++ILK YPESVR+ILI+DWDIHHGNGT
Sbjct: 188 VKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGT 247

Query: 261 QKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVGGVGDAEYM 320
           QKAFY D  VLYISLHRFE+GK+YPG   G YD+ G+GKG+GFNCNITWPV GVGD EY+
Sbjct: 248 QKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYI 307

Query: 321 LAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHMLKSLARGNLCV 380
            AFEQIV+PMAREF+PDLVI+SSGFDAA GDTIGQCHVTP+CYG MTHMLKSLARGNLCV
Sbjct: 308 WAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCV 367

Query: 381 ALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDPKLEAIEMIDTVIHTQSKYWKCFQ 440
            LEGGYNLD+I+ SAL+VAK+LIGEPPDE+P+  +DPK   +EMI+ VI  QSKYWKCF+
Sbjct: 368 VLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFR 427

Query: 441 RKFGNAGCNFSEPVTETVISKSFPLQTAIRQEQFRQLSKEYGFVTLPISKLEIPDDSVLC 500
           RKFGN G  + E   E+ I K FPLQ AIR  Q      ++G ++L +  L +P +S++C
Sbjct: 428 RKFGNFGGEY-ENAIESQIPKMFPLQDAIRNAQLSHYYDDFGMISLSLPNLNLPKNSIIC 486

Query: 501 SPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVDSPLDFTKWCMNRKYGVIDVN 560
           S   F+  ++ +++HDTPE+W  RD+ITG+IDPSTSII DS L F  W + R+  VID+N
Sbjct: 487 SSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAIERETAVIDIN 546

Query: 561 IPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAFVGFGDAYAGIVHLLGHRDTR 620
           IP+S FE DNYS+ + SQ+V++ +WDN+ KY  SL K+ F+G G+A +GIVHLLG RDTR
Sbjct: 547 IPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEATSGIVHLLGKRDTR 606

Query: 621 ATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDKNHPCWADNESKKPRKKFGRV 680
              KA ++F+G   LKP+VP +DESL DWYFKNSL+FTD  H CW++N+ KKPRKK+GRV
Sbjct: 607 TVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCWSEND-KKPRKKYGRV 665

Query: 681 LRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE 714
           LRCDTDG+++ +EERFEEATDFILD F+EWSD+E
Sbjct: 666 LRCDTDGIHNIIEERFEEATDFILDAFDEWSDTE 699

>TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa]
           {ON} Anc_2.285 YNL021W
          Length = 795

 Score =  779 bits (2012), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/479 (75%), Positives = 408/479 (85%), Gaps = 1/479 (0%)

Query: 15  DTTLQVKRKMEEQNDGLDPKKSQLARTQNGAA-GKRVIVPACAPNLHYTPLKTALCYDVR 73
           D +  +KR  EE   G     +     +N     K++IVP  AP +HY PLKT LCYDVR
Sbjct: 7   DNSGGLKRNHEELETGTKNVSTNNILNKNPPNYKKQIIVPVQAPKIHYVPLKTGLCYDVR 66

Query: 74  MRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVRE 133
           MRYHAKIFTSYFEYIDPHPEDPRRIYR+YKILAENGLINDPTLSG+D IGDLMLK+P+RE
Sbjct: 67  MRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIRE 126

Query: 134 ATDEEILEVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYVSAKLSCGGVIDAC 193
           AT  EILEVHS E+ +++E++S   RE+LLKETE GDSVYFNNDS+ SAKLSCGG I+AC
Sbjct: 127 ATMNEILEVHSIEHFKYLEKTSNDNREQLLKETENGDSVYFNNDSFQSAKLSCGGAIEAC 186

Query: 194 KAVVEGRVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWD 253
           KAVVEGRVKNA+AVVRPPGHH+EPE+ GGFCLFSNVAVA +NILK YPESVR++LILDWD
Sbjct: 187 KAVVEGRVKNAMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWD 246

Query: 254 IHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVGG 313
           IHHGNGTQKAFYND  VLYISLHRFE+GKYYPGTI G+YDQTGEGKGEGFNCNITWP+G 
Sbjct: 247 IHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNITWPIGA 306

Query: 314 VGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHMLKSL 373
           VGDAEYM AFEQ+VMPM+REFQPDLVIISSGFDAADGDTIGQCHV+PSCYG MTHMLKSL
Sbjct: 307 VGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSL 366

Query: 374 ARGNLCVALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDPKLEAIEMIDTVIHTQS 433
           ARGNLCV LEGGYNLDAIA SALSV+K+LIGEPPDELPDP KDPK E IEMID +I  QS
Sbjct: 367 ARGNLCVVLEGGYNLDAIARSALSVSKILIGEPPDELPDPLKDPKPEVIEMIDKIIRLQS 426

Query: 434 KYWKCFQRKFGNAGCNFSEPVTETVISKSFPLQTAIRQEQFRQLSKEYGFVTLPISKLE 492
           KYWKCF+R+ GN GCNF E + +++ISK+FPLQTAIR  Q ++L  E  F+TLPI   +
Sbjct: 427 KYWKCFRRRHGNLGCNFKESINDSLISKNFPLQTAIRNFQSKKLFDELNFLTLPIKNFQ 485

 Score =  345 bits (885), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 191/220 (86%)

Query: 495 DDSVLCSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVDSPLDFTKWCMNRKY 554
           ++++LCSP + +  T+V++VHD+P++W KRDV TGV+D S++II+DS LDF KW ++R Y
Sbjct: 576 ENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDRNY 635

Query: 555 GVIDVNIPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAFVGFGDAYAGIVHLL 614
           GVID+NIPQ+LFEQDNYS+++ +QE LL  WDNY+KYFP + K+ F+GFGDA+AGIVHLL
Sbjct: 636 GVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVHLL 695

Query: 615 GHRDTRATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDKNHPCWADNESKKPR 674
           GHRDTR+ VK+V++F+G+K LK LVPLVDE+LSDWYFKNSL+FTDKNHP WADNE+KKPR
Sbjct: 696 GHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWADNENKKPR 755

Query: 675 KKFGRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE 714
           KKFGRVLR   DG+ + +EERF+EATDFILD FEEWSD E
Sbjct: 756 KKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795

>Kpol_1003.37 s1003
           complement(91621..92301,92861..92869,92912..93958) [1737
           bp, 578 aa] {ON}
           complement(91621..92301,92861..92869,92912..93958) [1737
           nt, 579 aa]
          Length = 578

 Score =  514 bits (1323), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 233/297 (78%), Positives = 265/297 (89%)

Query: 48  KRVIVPACAPNLHYTPLKTALCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAE 107
           ++VIVP   P LHYTPLKT LCYDVRMRYHAKIFTS FEYIDPHPEDPRR+YR+YKILAE
Sbjct: 53  RQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAE 112

Query: 108 NGLINDPTLSGIDEIGDLMLKIPVREATDEEILEVHSKENLEFVERSSRMKREELLKETE 167
           NGLI D  LSG+D+IGD+MLKIPVR AT+EEIL VH++E+L+F+E      REEL+K TE
Sbjct: 113 NGLIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLTE 172

Query: 168 KGDSVYFNNDSYVSAKLSCGGVIDACKAVVEGRVKNALAVVRPPGHHAEPEAPGGFCLFS 227
           K DSVY+NNDSY SAKLSCGGVI+AC+AVVEGRVKN+LA+VRPPGHHAEP+A GGFCLFS
Sbjct: 173 KADSVYYNNDSYYSAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAGGFCLFS 232

Query: 228 NVAVAAQNILKQYPESVRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGT 287
           NV+VAA++IL+ YPESVR+ILILDWDIHHGNGTQKAFY D  VLYISLHR+E   +YPGT
Sbjct: 233 NVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGT 292

Query: 288 INGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSG 344
           I+GRYDQ GEGKGEGFNCNITWPVGGVGDAEYM AFE +VMP+ REF+PDLVI+SSG
Sbjct: 293 IHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349

 Score =  274 bits (700), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 115/217 (52%), Positives = 166/217 (76%)

Query: 498 VLCSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVDSPLDFTKWCMNRKYGVI 557
           VL S ++F+  T+VI+VHDTPE+W  RD+ITGV+DPSTS+++D+ + F KW  +R Y ++
Sbjct: 360 VLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAADRNYSIL 419

Query: 558 DVNIPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAFVGFGDAYAGIVHLLGHR 617
           D+NIP+S  E++ +S+   + E++L +WDN+++Y  +L K+ F+G G++Y GIVHL+G R
Sbjct: 420 DINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGIVHLIGER 479

Query: 618 DTRATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDKNHPCWADNESKKPRKKF 677
           D R   KAV++F+G   LK L    DE++ DWYFKNSL+FT+ +H CW ++E K+PRKKF
Sbjct: 480 DLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWKESEEKRPRKKF 539

Query: 678 GRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE 714
           GRVL+ D+DG+ S + ERF+EATDFILD FEEWSD E
Sbjct: 540 GRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEE 576

>NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153
          Length = 453

 Score =  142 bits (359), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 100/323 (30%), Positives = 163/323 (50%), Gaps = 30/323 (9%)

Query: 70  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKI 129
           Y  R+ YH     S + Y   HP  P R+     +++  GL          +I DL    
Sbjct: 28  YTPRVSYHFNPKVSNYHYGVKHPMKPFRLMLTDHLVSSYGL---------HKIMDLY--- 75

Query: 130 PVREATDEEILEVHSKENLEFV-----ERSSRMKREELLKETEKGDSVYFNNDSYVSAKL 184
             R AT+EE+++ HS++ L+F+     E  S+M R  L K     D   F N  Y  + L
Sbjct: 76  ETRPATNEEMVQFHSEDYLDFLSKVTPENLSKMPRGTLEKFNIGDDCPIFQN-LYDYSTL 134

Query: 185 SCGGVIDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPES 243
             G  +DA + ++    ++ +A+    G HHA+   P GFC  +++ ++  N+L+ +P  
Sbjct: 135 YTGASLDATRKLIND--QSDIAINWSGGLHHAKKNNPSGFCYINDIVLSIVNLLRYHP-- 190

Query: 244 VRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGF 303
             R+L +D D+HHG+G Q+AFY   RV  IS H+F  G+++PGT  G YD+TG  KG+ F
Sbjct: 191 --RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFN-GEFFPGT--GDYDETGCAKGKHF 245

Query: 304 NCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCY 363
             N+     G+ D  Y+  F+ I+ P+   ++P +++   G D+   D +G  ++    +
Sbjct: 246 AMNVPLE-DGIDDDSYINLFKSIMDPLITSYKPTVIVQQCGADSLGHDRLGCFNLNIKGH 304

Query: 364 GQMTHMLKSLARGNLCVALEGGY 386
           G+    +KS     L V   GGY
Sbjct: 305 GECVKFIKSFGIPMLVVG-GGGY 326

>NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa]
           {ON} Anc_8.153
          Length = 451

 Score =  141 bits (356), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 107/353 (30%), Positives = 173/353 (49%), Gaps = 35/353 (9%)

Query: 70  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKI 129
           Y  R+ YH     S + Y   HP  P R+     +++  GL          +I DL    
Sbjct: 26  YTPRVSYHFNPKVSNYHYGVRHPMKPFRLMLTDHLVSSYGL---------HKIMDLY--- 73

Query: 130 PVREATDEEILEVHSKENLEFV-----ERSSRMKREELLKETEKGDSVYFNNDSYVSAKL 184
             REAT EE+ + HS++ +EF+     E  S+M R  L K     D   F N  Y  + L
Sbjct: 74  ETREATREEMSQFHSQDYIEFLSKVTPENLSKMPRGTLEKFNIGDDCPIFQN-IYDYSTL 132

Query: 185 SCGGVIDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPES 243
             G  +DA + ++    ++ +A+    G HHA+   P GFC  +++ ++  N+L+ +P  
Sbjct: 133 YTGASLDASRKLIND--QSDIAINWSGGLHHAKKNNPSGFCYVNDIVLSILNLLRYHP-- 188

Query: 244 VRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGF 303
             R+L +D D+HHG+G Q+AFY   RV  IS H+F  G+++PGT  G +D+ G  KG+ F
Sbjct: 189 --RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFN-GEFFPGT--GDFDEIGCAKGKHF 243

Query: 304 NCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCY 363
             N+     G+ D  Y+  F+ I+ P+   ++P ++I   G D+   D +G  ++    +
Sbjct: 244 AMNVPLE-DGIDDDSYINLFKSIIDPLITAYKPTVIIQQCGADSLGHDRLGCFNLNIKAH 302

Query: 364 GQMTHMLKSLARGNLCVALEGGY---NLDAIAISALSVAK--VLIGEPPDELP 411
           G+    +KS     L V   GGY   N+  +      V    +L  E P+E+P
Sbjct: 303 GECVKFVKSFGIPMLVVG-GGGYTPRNVSRLWTYETGVLNNVLLPSEIPEEIP 354

>KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {ON}
           Anc_8.153 YGL194C
          Length = 453

 Score =  141 bits (355), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 107/354 (30%), Positives = 174/354 (49%), Gaps = 37/354 (10%)

Query: 70  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKI 129
           Y  R+ YH     S + Y   HP  P R+     +++  GL          +I DL    
Sbjct: 26  YTPRVSYHFNPKVSNYHYGVNHPMKPFRLMLTDHLVSSYGL---------HKIMDLY--- 73

Query: 130 PVREATDEEILEVHSKENLEFVERSS-----RMKREELLKETEKGDSVYFNNDSYVSAKL 184
             REAT EE+ + HS + L+F+E+ S     ++ R  L K     D   F N  Y  + L
Sbjct: 74  ETREATKEEMSQFHSSDYLDFLEKISPDTLNKIPRGTLEKFNIGSDCPIFEN-IYDYSTL 132

Query: 185 SCGGVIDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPES 243
             G  +DA + ++ G  ++ +A+    G HHA+   P GFC  +++ ++  N+L+ +P  
Sbjct: 133 YTGASLDASRKLING--QSEIAINWSGGLHHAKKNNPSGFCYINDIVLSILNLLRYHP-- 188

Query: 244 VRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGF 303
             R+L +D D+HHG+G Q+AFY   RV  IS H++  G+++PGT  G YD+ G   G+ F
Sbjct: 189 --RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPGT--GNYDEIGCSGGKHF 243

Query: 304 NCNITWPVG-GVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSC 362
             N+  P+  G+ D  Y+  F+ I+ P+   +QP ++I   G D+   D +G  ++    
Sbjct: 244 AMNV--PLNDGIDDDSYIKLFKSIIDPLITSYQPTVIIQQCGADSLGHDRLGCFNLNIKA 301

Query: 363 YGQMTHMLKSLARGNLCVALEGGY---NLDAIAISALSVAK--VLIGEPPDELP 411
           +G+    + S     L V   GGY   N+  +      +    +L  E P+ELP
Sbjct: 302 HGECVKFVSSFGIPMLVVG-GGGYTPRNVSRLWAYETGILNNVLLPKELPEELP 354

>TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}
           Anc_8.153 YGL194C
          Length = 450

 Score =  141 bits (355), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 97/324 (29%), Positives = 160/324 (49%), Gaps = 32/324 (9%)

Query: 70  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKI 129
           Y  R+ YH     S + Y   HP  P R      +++  GL N            +M   
Sbjct: 25  YSPRVSYHYNPKVSNYHYGVKHPMKPFRFMLTDHLVSSYGLHN------------IMDLY 72

Query: 130 PVREATDEEILEVHSKENLEFVERSS-----RMKREELLKETEKGDSVYFNNDSYVSAKL 184
             REAT EE+L+ HS++ +EF+ + S     +M R    K     D   F N  Y   KL
Sbjct: 73  ETREATKEELLQFHSEDYVEFLSKVSPDNISKMPRGTFDKYNIGDDCPIFQN-IYEYCKL 131

Query: 185 SCGGVIDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPES 243
             G  +DA + ++    ++ +A+    G HHA+   P GFC  +++ +A  N+L+ +P  
Sbjct: 132 YAGASLDASRKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLLRYHP-- 187

Query: 244 VRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGF 303
             R+L +D D+HHG+G Q+AFY   RV  +S H++  G+++PGT  G YD+ G  +G+ F
Sbjct: 188 --RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNYDEIGCAEGKHF 242

Query: 304 NCNITWPVG-GVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSC 362
             N+  P+  G+ D  Y+  F+ ++ P+   F+P  +I   G D+   D +G  ++    
Sbjct: 243 AMNV--PLNDGIDDDSYINLFKSVMEPIITSFKPTAIIQQCGADSLGHDRLGCFNLNIKA 300

Query: 363 YGQMTHMLKSLARGNLCVALEGGY 386
           +G+    ++S     + V   GGY
Sbjct: 301 HGECVKFIRSFGIPMVVVG-GGGY 323

>SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  139 bits (351), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 98/332 (29%), Positives = 163/332 (49%), Gaps = 30/332 (9%)

Query: 61  YTPLKTALCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGID 120
           Y P +    Y   + YH     S + Y   HP  P R+     +++  GL          
Sbjct: 14  YLPYEFGSTYSPHVSYHFNSDVSQYHYGVRHPMKPFRLMLTDHLVSSYGL---------H 64

Query: 121 EIGDLMLKIPVREATDEEILEVHSKENLEFVERSS-----RMKREELLKETEKGDSVYFN 175
           +I DL      REAT +E+LE HS + +EF+ + S     +M R  L K     D   F 
Sbjct: 65  KIMDLY---ETREATRDELLEFHSADYIEFLSKVSPDTLSKMPRGSLEKFNIGDDCPIFQ 121

Query: 176 NDSYVSAKLSCGGVIDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQ 234
              +  + L  G  +DA + ++ G  ++ +A+    G HHA+   P GFC  +++ +A  
Sbjct: 122 G-IFEYSSLYAGASLDASRKLIAG--QSEIAINWSGGLHHAKKAKPSGFCYVNDIVLAIL 178

Query: 235 NILKQYPESVRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQ 294
           N+L+ +P    R+L +D D+HHG+G Q+AFY   RV  +S H++  G+++PGT  G +D+
Sbjct: 179 NLLRFHP----RVLYVDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDFDE 231

Query: 295 TGEGKGEGFNCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIG 354
            G  +G+ F  N+     G+ D  Y+  F+ I+ P+   ++P ++I   G D+   D +G
Sbjct: 232 IGCSRGKHFALNVPLD-DGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLGHDRLG 290

Query: 355 QCHVTPSCYGQMTHMLKSLARGNLCVALEGGY 386
             ++    +G+    +KS     L V   GGY
Sbjct: 291 CFNLNIRAHGECVKFVKSFGIPMLVVG-GGGY 321

>TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {ON}
           Anc_8.153 YGL194C
          Length = 456

 Score =  139 bits (349), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 96/325 (29%), Positives = 166/325 (51%), Gaps = 34/325 (10%)

Query: 70  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSG--IDEIGDLML 127
           Y  R+ YH     S + +   HP  P R+           ++ D  +SG  + +I DL  
Sbjct: 26  YAPRVSYHFNPKVSSYHFGVRHPMKPFRL-----------MLTDHLVSGYGLHKIMDLY- 73

Query: 128 KIPVREATDEEILEVHSKENLEFVERSS-----RMKREELLKETEKGDSVYFNNDSYVSA 182
               R+A+D+E+LE H+ + + F+++ +     +M R  L K     D   F+N  Y  +
Sbjct: 74  --ETRKASDDELLEFHTDDYINFLKKVNPDNVNKMPRGTLDKFNIGDDCPIFHN-LYEYS 130

Query: 183 KLSCGGVIDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYP 241
            L  G  +DA + ++ G  ++ +A+    G HHA+  +P GFC  +++ ++  N+L+ +P
Sbjct: 131 SLYTGASLDASRKLLNG--QSDIAINWSGGLHHAKKTSPSGFCYINDIVLSILNLLRFHP 188

Query: 242 ESVRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGE 301
               R+L +D D+HHG+G Q+AFY   RV  +S H++  G+++PGT  G YD+TG   G+
Sbjct: 189 ----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNYDETGCSNGK 241

Query: 302 GFNCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPS 361
            F  N+     G+ D  Y+  F+ I+ P+   + P ++I   G D+   D +G  ++   
Sbjct: 242 HFALNVPLK-DGIDDDSYINLFKSIIDPLITSYNPTVIIQQCGADSLGHDRLGCFNLNIK 300

Query: 362 CYGQMTHMLKSLARGNLCVALEGGY 386
            +G+    +KS     L V   GGY
Sbjct: 301 AHGECVKFVKSFGIPMLVVG-GGGY 324

>KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {ON}
           highly similar to uniprot|P53096 Saccharomyces
           cerevisiae YGL194C HOS2 Histone deacetylase required for
           gene activation via specific deacetylation of lysines in
           H3 and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 449

 Score =  138 bits (347), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 94/322 (29%), Positives = 160/322 (49%), Gaps = 28/322 (8%)

Query: 70  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKI 129
           Y+  + YH     S F Y   HP  P R+     +++  GL          +I DL    
Sbjct: 24  YEPNVSYHFNSDVSQFHYGVRHPMKPFRLMLTDHLVSSYGL---------HKIMDLY--- 71

Query: 130 PVREATDEEILEVHSKENLEFVERSSRMKREEL----LKETEKGDSVYFNNDSYVSAKLS 185
             R AT EE+ E H+ + +EF+ + S     +L    L++   GD        Y  + L 
Sbjct: 72  ETRPATREELCEFHADDYVEFLAKVSPDNLSKLPRGTLEKFNIGDDCPIFQGLYQYSTLY 131

Query: 186 CGGVIDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPESV 244
            G  +DA + ++ G  ++ +A+    G HHA+  +P GFC  +++ ++  N+L+ +P   
Sbjct: 132 AGASLDATRKLING--QSEIAINWSGGLHHAKKSSPSGFCYVNDIVLSVLNLLRYHP--- 186

Query: 245 RRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFN 304
            R+L +D D+HHG+G Q+AFY   RV  +S H++  G+++PGT  G  D+TG  +G+ F 
Sbjct: 187 -RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNLDETGCSRGKHFA 242

Query: 305 CNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYG 364
            N+     G+ D  Y+  F+ I+ P+   F+P ++I   G D+   D +G  ++    +G
Sbjct: 243 LNVPLE-DGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFNLNVKAHG 301

Query: 365 QMTHMLKSLARGNLCVALEGGY 386
           +    +KS     L +   GGY
Sbjct: 302 ECVRFVKSFGIPMLVLG-GGGY 322

>TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {ON}
           Anc_8.153 YGL194C
          Length = 446

 Score =  137 bits (344), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 107/356 (30%), Positives = 174/356 (48%), Gaps = 39/356 (10%)

Query: 69  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLS--GIDEIGDLM 126
            Y  R+ YH     S + Y   HP  P R+           L+ D  +S  G+ +I DL 
Sbjct: 23  AYCPRVSYHFNPKVSNYHYGVRHPMKPFRL-----------LLTDHLVSSYGLHKIMDLY 71

Query: 127 LKIPVREATDEEILEVHSKENLEFV-----ERSSRMKREELLKETEKGDSVYFNNDSYVS 181
                R AT EEI E H+++ ++F+     E  S+M R  L K     D   F N  +  
Sbjct: 72  ---ETRVATSEEIAEFHTQDYIDFLHKVTPENLSKMPRGTLEKFNIGDDCPIFQN-LFNY 127

Query: 182 AKLSCGGVIDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQY 240
            KL  G  +DA + ++    ++ +A+    G HHA+   P GFC  +++ +A  N+L+ +
Sbjct: 128 CKLYAGASLDAARKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNLLRYH 185

Query: 241 PESVRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKG 300
           P    R+L +D D+HHG+G Q+AFY   RV  +S H++  G+++PGT  G +D+ G   G
Sbjct: 186 P----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNHDEVGCANG 238

Query: 301 EGFNCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTP 360
           + F  N+     G+ D  Y+  F+ I+ P+   ++P ++I   G D+   D IG  ++T 
Sbjct: 239 KHFAMNVPLE-DGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLGHDRIGCFNLTI 297

Query: 361 SCYGQMTHMLKSLARGNLCVALEGGY---NLDAIAISALSVAK--VLIGEPPDELP 411
             +G+    ++S     L V   GGY   N+  +      V    +L  E P+E+P
Sbjct: 298 KGHGECVKFIRSFGIPMLVVG-GGGYTPRNVSRLWAYETGVLNNVLLSKELPEEIP 352

>Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON}
           (11759..13120) [1362 nt, 454 aa]
          Length = 453

 Score =  137 bits (344), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 97/324 (29%), Positives = 159/324 (49%), Gaps = 30/324 (9%)

Query: 69  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLK 128
            Y  R+ YH     S + Y   HP  P R+     +++  GL          +I DL   
Sbjct: 27  AYCPRVSYHFNPKVSNYHYGVKHPMKPFRLMLTDHLVSSYGL---------HKIMDLY-- 75

Query: 129 IPVREATDEEILEVHSKENLEFV-----ERSSRMKREELLKETEKGDSVYFNNDSYVSAK 183
              R AT +E+L+ HS + + F+     E  S+M R  L K     D   F N  Y  + 
Sbjct: 76  -ETRSATKDELLDFHSDDYVSFLQKVTPENLSKMPRGTLEKYNIGDDCPIFQN-LYDYSA 133

Query: 184 LSCGGVIDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPE 242
           L  G  +DA + ++    ++ +A+    G HHA+   P GFC  +++ +A  N+L+ +P 
Sbjct: 134 LYAGASLDASRKLINN--QSDIAINWSGGLHHAKKTNPSGFCYVNDIVLAILNLLRYHP- 190

Query: 243 SVRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEG 302
              R+L +D D+HHG+G Q+AFY   RV  IS H++  G+++PGT  G YD+ G  +G+ 
Sbjct: 191 ---RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPGT--GNYDEIGCAQGKH 244

Query: 303 FNCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSC 362
           F  N+     G+ D  Y+  F+ I+ P+   ++P ++I   G D+   D +G  ++    
Sbjct: 245 FAMNVPLE-DGIDDDSYINLFKSIIDPLITSYKPTVIIQQCGADSLGHDRLGCFNLNIKA 303

Query: 363 YGQMTHMLKSLARGNLCVALEGGY 386
           +G+    ++S     L V   GGY
Sbjct: 304 HGECVKFIRSFGIPMLVVG-GGGY 326

>Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  137 bits (344), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 95/323 (29%), Positives = 158/323 (48%), Gaps = 28/323 (8%)

Query: 69  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLK 128
            Y  R+ YH     S++ Y   HP  P R+     +++  GL          +I DL   
Sbjct: 23  AYSPRVSYHFNPKVSHYHYGVKHPMKPFRLMLTDHLVSSYGL---------HKIMDLY-- 71

Query: 129 IPVREATDEEILEVHSKENLEFVERSSRMKREEL----LKETEKGDSVYFNNDSYVSAKL 184
              R AT +E+LE HS++ + F+ + S     +L    L+    GD      + Y    L
Sbjct: 72  -ETRSATRDELLEFHSEDYINFLSKVSPDNSNKLPRGTLENFNIGDDCPIFQNLYDYTTL 130

Query: 185 SCGGVIDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPES 243
             G  +DA + ++    ++ +A+    G HHA+  +P GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 244 VRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGF 303
             RIL +D D+HHG+G Q+AFY   RV  +S H++  G+++PGT  G   + G  KG+ F
Sbjct: 187 --RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 304 NCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCY 363
             N+     G+ D  Y+  F+ IV P+   F+P L++   G D+   D +G  ++    +
Sbjct: 242 ALNVPLE-DGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 364 GQMTHMLKSLARGNLCVALEGGY 386
           G+    +KS     L V   GGY
Sbjct: 301 GECVKFVKSFGLPMLVVG-GGGY 322

>Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}
           similar to Ashbya gossypii AFR172C
          Length = 485

 Score =  137 bits (345), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 95/331 (28%), Positives = 164/331 (49%), Gaps = 32/331 (9%)

Query: 63  PLKTALCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLS--GID 120
           P +    Y  ++ YH     S + Y   HP  P R+           ++ D  +S  G+ 
Sbjct: 53  PFEFGSSYSPQVSYHFNPKVSQYHYGVRHPMKPFRL-----------MLTDHLVSCYGLH 101

Query: 121 EIGDLMLKIPVREATDEEILEVHSKENLEFVERSSRMKREEL----LKETEKGDSVYFNN 176
           +I DL      REAT EE+LE H+ + +EF+   +     +L    L++   GD      
Sbjct: 102 KIMDLY---ETREATKEELLEFHAPDYIEFLSHVTPENLNKLPRGSLEKFNIGDDCPIFQ 158

Query: 177 DSYVSAKLSCGGVIDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQN 235
             +  + L  G  +DA + ++    ++ +A+    G HHA+   P GFC  +++ +A  +
Sbjct: 159 GMFDYSILYAGASLDAARKLINN--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLAIIS 216

Query: 236 ILKQYPESVRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQT 295
           +L+ +P    R+L +D D+HHG+G Q+AFY   RV  +S H++  G+++PGT  G  D+ 
Sbjct: 217 LLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEI 269

Query: 296 GEGKGEGFNCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQ 355
           G  KG+ F+ N+     G+ D  Y+  F+ I+ P+   ++P ++I   G D+   D +G 
Sbjct: 270 GCSKGKKFSLNVPLQ-DGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLGC 328

Query: 356 CHVTPSCYGQMTHMLKSLARGNLCVALEGGY 386
            ++    +G+    +KS     LCV   GGY
Sbjct: 329 FNLNIKAHGECVKFVKSFGIPILCVG-GGGY 358

>Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {ON}
           YGL194C (HOS2) - (putative) histone deacetylase [contig
           139] FULL
          Length = 449

 Score =  136 bits (342), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 95/318 (29%), Positives = 157/318 (49%), Gaps = 28/318 (8%)

Query: 74  MRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVRE 133
           + YH     S F Y   HP  P R+     +++  GL          +I DL      R 
Sbjct: 28  VSYHFNDDVSQFHYGVKHPMKPFRLMLTDHLVSSYGL---------HKIMDLY---ETRP 75

Query: 134 ATDEEILEVHSKENLEFVERSSRMKREEL----LKETEKGDSVYFNNDSYVSAKLSCGGV 189
           AT EE+ E HS++ +EF+ R S     +L    L++   GD        Y  + L  G  
Sbjct: 76  ATREELCEFHSEDYVEFLARVSPDNLAKLPRGSLEKFNIGDDCPIFQGLYQYSTLYAGAS 135

Query: 190 IDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRIL 248
           +DA + ++ G  ++ +A+    G HHA+   P GFC  +++ ++  N+L+ +P    R+L
Sbjct: 136 LDATRKLING--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLSVLNLLRYHP----RVL 189

Query: 249 ILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNIT 308
            +D D+HHG+G Q+AFY   RV  +S H++  G+++PGT  G  D+ G  +G+ F  N+ 
Sbjct: 190 YIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNLDEIGCSRGKHFALNVP 246

Query: 309 WPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTH 368
               G+ D  Y+  F+ I+ P+   F+P ++I   G D+   D +G  ++    +G+   
Sbjct: 247 LD-DGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFNLNVKAHGECVK 305

Query: 369 MLKSLARGNLCVALEGGY 386
            +KS     L V   GGY
Sbjct: 306 YVKSFGLPMLVVG-GGGY 322

>AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL194C
           (HOS2)
          Length = 449

 Score =  136 bits (342), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 92/323 (28%), Positives = 162/323 (50%), Gaps = 30/323 (9%)

Query: 70  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKI 129
           Y  R+ YH     S + Y   HP  P R+     +++  GL          ++ DL    
Sbjct: 24  YTPRVSYHYNSRVSQYHYGVRHPMKPFRLMLTDHLVSRYGL---------HKVMDLY--- 71

Query: 130 PVREATDEEILEVHSKENLEFVERSSRMKREEL----LKETEKGDSVYFNNDSYVSAKLS 185
             R AT EE+L  H+++ ++F+   +     +L    L++   GD        +  + L 
Sbjct: 72  ETRAATKEEVLAFHAQDYVDFLSHVAPENLNKLPRGSLEKFNIGDDCPIFQGLFEYSMLY 131

Query: 186 CGGVIDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPESV 244
            G  +DA + ++ G  ++ +A+    G HHA+   P GFC  +++ +A  N+L+ +P   
Sbjct: 132 AGASLDASRKLING--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNLLRYHP--- 186

Query: 245 RRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFN 304
            R+L +D D+HHG+G Q+AFY   RV  +S H++  G+++PGT  G  D+ G  +G+ F+
Sbjct: 187 -RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCSRGKHFS 242

Query: 305 CNITWPVG-GVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCY 363
            N+  P+  G+ D  Y+  F+ I+ P+   ++P ++I   G D+   D +G  ++    +
Sbjct: 243 LNV--PLNDGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLGCFNLNIRAH 300

Query: 364 GQMTHMLKSLARGNLCVALEGGY 386
           G+    +KS     LCV   GGY
Sbjct: 301 GECVKFVKSFGIPMLCVG-GGGY 322

>YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}
           HOS2Histone deacetylase required for gene activation via
           specific deacetylation of lysines in H3 and H4 histone
           tails; subunit of the Set3 complex, a meiotic-specific
           repressor of sporulation specific genes that contains
           deacetylase activity
          Length = 452

 Score =  135 bits (341), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 94/323 (29%), Positives = 158/323 (48%), Gaps = 28/323 (8%)

Query: 69  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLK 128
            Y  R+ YH     S++ Y   HP  P R+     +++  GL          +I DL   
Sbjct: 23  AYSPRVSYHFNSKVSHYHYGVKHPMKPFRLMLTDHLVSSYGL---------HKIMDLY-- 71

Query: 129 IPVREATDEEILEVHSKENLEFVERSSRMKREEL----LKETEKGDSVYFNNDSYVSAKL 184
              R AT +E+L+ HS++ + F+ + S     +L    L+    GD      + Y    L
Sbjct: 72  -ETRSATRDELLQFHSEDYVNFLSKVSPENANKLPRGTLENFNIGDDCPIFQNLYDYTTL 130

Query: 185 SCGGVIDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPES 243
             G  +DA + ++    ++ +A+    G HHA+  +P GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 244 VRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGF 303
             RIL +D D+HHG+G Q+AFY   RV  +S H++  G+++PGT  G   + G  KG+ F
Sbjct: 187 --RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 304 NCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCY 363
             N+     G+ D  Y+  F+ IV P+   F+P L++   G D+   D +G  ++    +
Sbjct: 242 ALNVPLE-DGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 364 GQMTHMLKSLARGNLCVALEGGY 386
           G+    +KS     L V   GGY
Sbjct: 301 GECVKFVKSFGLPMLVVG-GGGY 322

>CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194c HOS2 or uniprot|P32561 Saccharomyces cerevisiae
           YNL330c RPD3
          Length = 450

 Score =  135 bits (341), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 105/355 (29%), Positives = 177/355 (49%), Gaps = 41/355 (11%)

Query: 70  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSG--IDEIGDLML 127
           Y  R+ YH     S++ Y   HP  P R+           ++ D  +SG  + +I DL  
Sbjct: 24  YAPRVSYHINPEVSHYHYGVRHPMKPFRL-----------MLTDHLVSGYGLHKIMDLY- 71

Query: 128 KIPVREATDEEILEVHSKENLEFV-----ERSSRMKREELLKETEKGDSVYFNNDSYVSA 182
               R+AT EE+ E HS++ + F+     E  S++ R  L K     D   F N  +  +
Sbjct: 72  --KTRKATAEEMEEFHSEDYVNFLSKVTPENLSKLPRGTLEKFNIGDDCPIFPN-IFQYS 128

Query: 183 KLSCGGVIDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYP 241
            L  G  +DA + ++    ++ +A+    G HHA+  +P GFC  +++ +A  N+L+ +P
Sbjct: 129 SLYTGASLDASRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYINDIVLAILNLLRYHP 186

Query: 242 ESVRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGE 301
               R+L +D D+HHG+G Q+AFY   RV  IS H++  G+++PGT  G+ D+TG   G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GEFFPGT--GKNDETGCADGK 239

Query: 302 GFNCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPS 361
            F  N+     G+ D  Y+  F+ I+ P+   F+P +++   G D+   D +G  ++   
Sbjct: 240 HFAMNVPLE-DGIDDDSYINLFKSIIDPLITTFKPTVILQQCGADSLGHDRLGCFNLNIK 298

Query: 362 CYGQMTHMLKSLARGNLCVALEGGY---NLDAIAISALSVA-KVLIGEPPDELPD 412
            +G+    ++S     L V   GGY   N+  +      +   VL+   P+ELPD
Sbjct: 299 AHGECVKFVRSFGIPMLVVG-GGGYTPRNVSRLWTYETGILNNVLL---PEELPD 349

>KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.153
           YGL194C
          Length = 451

 Score =  135 bits (340), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 94/321 (29%), Positives = 161/321 (50%), Gaps = 30/321 (9%)

Query: 72  VRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPV 131
           +R+ YH     S++ Y   HP  P R+           ++ D  +SG   +  +M     
Sbjct: 27  LRVSYHFNPKVSHYHYGVKHPMKPFRL-----------MLTDHLVSGYG-MHKVMDLYET 74

Query: 132 REATDEEILEVHSKENLEFVERSS-----RMKREELLKETEKGDSVYFNNDSYVSAKLSC 186
           R AT++E+ E H+++ + F+++ S     ++ R  L K     D   F N  Y  A L  
Sbjct: 75  RAATNDELTEFHTEDYVHFLQKVSPDNLGKLPRGTLEKFNIGDDCPIFQN-LYDYATLYT 133

Query: 187 GGVIDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVR 245
           G  +DA + ++ G  ++ +A+    G HHA+  +P GFC  +++ ++  N+L+ +P    
Sbjct: 134 GASLDATRKLING--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSIVNLLRYHP---- 187

Query: 246 RILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNC 305
           R+L +D D+HHG+G Q+AFY   RV  IS H++  G ++PGT  G  D+TG   GE F  
Sbjct: 188 RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GDFFPGT--GDIDETGCDAGERFAL 244

Query: 306 NITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQ 365
           N+     G+ D  Y+  F+ ++ P+   + P ++I   G D+   D +G  ++    +G+
Sbjct: 245 NVPLE-DGIDDDSYINLFKSVIGPLITAYNPTVIIQQCGADSLGHDRLGCFNLNIKAHGE 303

Query: 366 MTHMLKSLARGNLCVALEGGY 386
               +KS     L V   GGY
Sbjct: 304 CVKFVKSFGIPMLVVG-GGGY 323

>Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  135 bits (339), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 94/323 (29%), Positives = 158/323 (48%), Gaps = 28/323 (8%)

Query: 69  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLK 128
            Y  R+ YH     S++ Y   HP  P R+     +++  GL          +I DL   
Sbjct: 23  AYSPRVSYHFNSKVSHYHYGVKHPMKPFRLMLTDHLVSSYGL---------HKIMDLY-- 71

Query: 129 IPVREATDEEILEVHSKENLEFVERSSRMKREEL----LKETEKGDSVYFNNDSYVSAKL 184
              R AT +E+L+ HS++ + F+ + S     +L    L+    GD      + Y    L
Sbjct: 72  -ETRSATRDELLQFHSEDYVNFLSKVSPDNANKLPRGTLENFNIGDDCPIFQNLYDYTTL 130

Query: 185 SCGGVIDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPES 243
             G  +DA + ++    ++ +A+    G HHA+  +P GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 244 VRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGF 303
             RIL +D D+HHG+G Q+AFY   RV  +S H++  G+++PGT  G   + G  KG+ F
Sbjct: 187 --RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 304 NCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCY 363
             N+     G+ D  Y+  F+ IV P+   F+P L++   G D+   D +G  ++    +
Sbjct: 242 ALNVPLE-DGIDDDSYINLFKSIVDPLIITFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 364 GQMTHMLKSLARGNLCVALEGGY 386
           G+    +KS     L V   GGY
Sbjct: 301 GECVKFVKSFGLPMLVVG-GGGY 322

>Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  133 bits (335), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 91/322 (28%), Positives = 157/322 (48%), Gaps = 28/322 (8%)

Query: 70  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKI 129
           Y  R+ YH     S++ Y   HP  P R+     +++  GL          +I DL    
Sbjct: 24  YSPRVSYHFNPKASHYHYGVKHPMKPIRLMLTDHLVSSYGL---------HKIMDLY--- 71

Query: 130 PVREATDEEILEVHSKENLEFVERSSRMKREEL----LKETEKGDSVYFNNDSYVSAKLS 185
             R AT +E+ E H+++ + F+ + S     +L    L+    GD      + Y    L 
Sbjct: 72  ETRSATKDELFEFHTEDYVNFLSKVSPENVNKLPRGTLENFNIGDDCPIFQNLYDYTTLY 131

Query: 186 CGGVIDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPESV 244
            G  +DA + ++    ++ +A+    G HHA+  +P GFC  +++ ++  N+L+ +P   
Sbjct: 132 TGATLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP--- 186

Query: 245 RRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFN 304
            R+L +D D+HHG+G Q+AFY   RV  +S H++  G+++PGT  G   + G  KG+ F 
Sbjct: 187 -RVLYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHFA 242

Query: 305 CNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYG 364
            N+     G+ D  Y+  F+ IV P+   F+P +++   G D+   D +G  ++    +G
Sbjct: 243 LNVPLE-DGIDDDSYINLFKSIVDPLITTFKPTVIVQQCGADSLGHDRLGCFNLNIKAHG 301

Query: 365 QMTHMLKSLARGNLCVALEGGY 386
           +    +KS     L V   GGY
Sbjct: 302 ECVKFVKSFGLPMLVVG-GGGY 322

>ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  131 bits (330), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 90/319 (28%), Positives = 160/319 (50%), Gaps = 28/319 (8%)

Query: 73  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVR 132
           R+ YH     S + Y   HP  P R+     +++  GL          +I DL      R
Sbjct: 26  RVSYHFNPKVSNYHYGTKHPMKPFRLMLTDHLVSSYGL---------HKIMDLY---ETR 73

Query: 133 EATDEEILEVHSKENLEFVERSSRMKREEL----LKETEKGDSVYFNNDSYVSAKLSCGG 188
            AT EE+   HS+E ++F++R +     +L    L++   GD      + Y  + L  G 
Sbjct: 74  VATWEEMTAFHSEEYVDFMKRVTPENLNKLPRGTLEKFNIGDDCPIFPNLYDYSSLYAGA 133

Query: 189 VIDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRI 247
            +DA + ++    ++ +A+    G HHA+   P GFC  +++ +A  N+L+ +P    R+
Sbjct: 134 SLDASRKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLLRYHP----RV 187

Query: 248 LILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNI 307
           L +D D+HHG+G Q+AFY   RV  +S H++  G+++PGT  G +D+ G  +G+ F  N+
Sbjct: 188 LYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNHDEVGCARGKHFALNV 244

Query: 308 TWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMT 367
                G+ D  Y+  F+ I+ P+   ++P +++   G D+   D +G  ++    +G+  
Sbjct: 245 PLQ-DGIDDDSYINLFKSIIDPLITSYKPTVIVQQCGADSLGHDRLGCFNLNVKAHGECV 303

Query: 368 HMLKSLARGNLCVALEGGY 386
           + ++S     L V   GGY
Sbjct: 304 NFVRSFGLPMLVVG-GGGY 321

>KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 452

 Score =  131 bits (329), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 92/324 (28%), Positives = 160/324 (49%), Gaps = 32/324 (9%)

Query: 70  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLS--GIDEIGDLML 127
           Y  R+ YH     S + Y   HP  P R+           ++ D  +S  G+ ++ DL  
Sbjct: 27  YSPRVSYHFNSKVSQYHYGVKHPMKPFRL-----------MLTDHLVSAYGLHKVMDLY- 74

Query: 128 KIPVREATDEEILEVHSKENLEFVERSSRMKREEL----LKETEKGDSVYFNNDSYVSAK 183
               R AT +E+ + HS++ + F+ + +     +L    L++   GD        +  A 
Sbjct: 75  --ETRSATKDELTKFHSEDYVNFLAKVTPDTLNKLPRGSLEKFNIGDDCPIFQGMFDYAA 132

Query: 184 LSCGGVIDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPE 242
           L  G  +DA + ++ G  ++ +A+    G HHA+   P GFC  +++ +A  N+L+ +P 
Sbjct: 133 LYAGASLDASRKLLNG--QSEIAINWSGGLHHAKKNNPSGFCYVNDIVLAIVNLLRYHP- 189

Query: 243 SVRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEG 302
              R+L +D D+HHG+G Q+AFY   RV  +S H++  G+++PGT  G  D+ G  +G+ 
Sbjct: 190 ---RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCSRGKH 243

Query: 303 FNCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSC 362
           F  N+     G+ D  Y+  F+ I+ P+   F+P ++I   G D+   D +G  ++    
Sbjct: 244 FALNVPLQ-DGIEDDSYINLFKSIIDPVITSFRPSVIIQQCGADSLGHDRLGCFNLNIKA 302

Query: 363 YGQMTHMLKSLARGNLCVALEGGY 386
           +G+    +KS     L V   GGY
Sbjct: 303 HGECVRFVKSFGVPMLVVG-GGGY 325

>KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 432

 Score =  123 bits (308), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 91/338 (26%), Positives = 155/338 (45%), Gaps = 28/338 (8%)

Query: 59  LHYTPLKTALCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSG 118
           L +  LK       R+ Y      S + Y   HP  P RI   + ++   GL        
Sbjct: 6   LPFDDLKVKSTNKERVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK----- 60

Query: 119 IDEIGDLMLKIPVREATDEEILEVHSKENLEFVERSSRMKREELLKETEK---GDSVYFN 175
                  M     + AT +E+ + HS E ++F+ R +    E   KE+ K   GD     
Sbjct: 61  -------MEIYRAKPATKQEMCQFHSDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPVF 113

Query: 176 NDSYVSAKLSCGGVIDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQ 234
           +  Y    +S GG ++    +  G+    +A+    G HHA+     GFC  +++ +   
Sbjct: 114 DGLYEYCSISGGGSMEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGII 171

Query: 235 NILKQYPESVRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQ 294
            +L+ +P    R+L +D D+HHG+G ++AFY   RV+  S H++  G+++PGT  G    
Sbjct: 172 ELLRYHP----RVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRD 223

Query: 295 TGEGKGEGFNCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIG 354
           TG GKG+ ++ N+     G+ D  Y   FE ++  +   +QP  V++  G D+  GD +G
Sbjct: 224 TGVGKGKYYSVNVPLR-DGIDDTTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLG 282

Query: 355 QCHVTPSCYGQMTHMLKSLARGNLCVALEGGYNLDAIA 392
             +++   +    + +KS     L V   GGY +  +A
Sbjct: 283 CFNLSMRGHANCVNYVKSFGIPMLVVG-GGGYTMRNVA 319

>Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {ON}
           complement(25267..26568) [1302 nt, 434 aa]
          Length = 433

 Score =  122 bits (306), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 86/324 (26%), Positives = 150/324 (46%), Gaps = 28/324 (8%)

Query: 73  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVR 132
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 67

Query: 133 EATDEEILEVHSKENLEFVERSSRMKREELLKETEK---GDSVYFNNDSYVSAKLSCGGV 189
            AT +E+ + H+ E ++F+ R +    +   KE+ K   GD     +  Y    +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 190 IDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRIL 248
           ++    +  G+    +A+    G HHA+     GFC  +++ +    +L+ +P    R+L
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 249 ILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNIT 308
            +D D+HHG+G ++AFY   RV+  S H++  G+++PGT  G    TG GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKNYAVNVP 237

Query: 309 WPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTH 368
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   +    +
Sbjct: 238 LR-DGIDDATYRAVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 369 MLKSLARGNLCVALEGGYNLDAIA 392
            +KS     L V   GGY +  +A
Sbjct: 297 FVKSFGI-PLMVVGGGGYTMRNVA 319

>Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL330C
           (RPD3) - histone deacetylase [contig 124] FULL
          Length = 432

 Score =  122 bits (305), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 90/338 (26%), Positives = 155/338 (45%), Gaps = 28/338 (8%)

Query: 59  LHYTPLKTALCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSG 118
           L +  LK       R+ Y      S + Y   HP  P RI   + ++   GL        
Sbjct: 6   LPFDELKVKSTNKERVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK----- 60

Query: 119 IDEIGDLMLKIPVREATDEEILEVHSKENLEFVERSSRMKREELLKETEK---GDSVYFN 175
                  M     + AT +E+ + H+ E ++F+ R +    E   KE+ K   GD     
Sbjct: 61  -------MEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPVF 113

Query: 176 NDSYVSAKLSCGGVIDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQ 234
           +  Y    +S GG ++    +  G+    +A+    G HHA+     GFC  +++ +   
Sbjct: 114 DGLYEYCSISGGGSMEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGII 171

Query: 235 NILKQYPESVRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQ 294
            +L+ +P    R+L +D D+HHG+G ++AFY   RV+  S H++  G+++PGT  G    
Sbjct: 172 ELLRYHP----RVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRD 223

Query: 295 TGEGKGEGFNCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIG 354
           TG GKG+ +  N+     G+ D+ Y   FE ++  +   +QP  V++  G D+  GD +G
Sbjct: 224 TGVGKGKYYAVNVPLR-DGIDDSTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLG 282

Query: 355 QCHVTPSCYGQMTHMLKSLARGNLCVALEGGYNLDAIA 392
             +++   +    + +KS     L V   GGY +  +A
Sbjct: 283 CFNLSMRGHANCVNYVKSFGIPMLVVG-GGGYTMRNVA 319

>TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  121 bits (303), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 84/324 (25%), Positives = 150/324 (46%), Gaps = 28/324 (8%)

Query: 73  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVR 132
           R+ Y        + Y   HP  P RI   + ++   GL  +            M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKN------------MEIYRAK 67

Query: 133 EATDEEILEVHSKENLEFVERSSRMKREELLKETEK---GDSVYFNNDSYVSAKLSCGGV 189
            AT +E+ + H+ E ++F+ R +    +   KE+ K   GD     +  Y    +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 190 IDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRIL 248
           ++    +  G+    +A+    G HHA+     GFC  +++ +    +L+ +P    R+L
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCFLNDIVLGIIELLRYHP----RVL 181

Query: 249 ILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNIT 308
            +D D+HHG+G ++AFY   RV+  S H++  G+++PGT  G    TG G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGNGKNYAVNVP 237

Query: 309 WPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTH 368
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   +    +
Sbjct: 238 LR-DGIDDATYRSVFEPVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 369 MLKSLARGNLCVALEGGYNLDAIA 392
            +KS     + V   GGY +  +A
Sbjct: 297 FVKSFNIPMMVVG-GGGYTMRNVA 319

>Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  121 bits (303), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 86/324 (26%), Positives = 151/324 (46%), Gaps = 28/324 (8%)

Query: 73  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVR 132
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 133 EATDEEILEVHSKENLEFVERSSRMKREELLKETEK---GDSVYFNNDSYVSAKLSCGGV 189
            AT +E+ + H+ E ++F+ R +    E   +E+ K   GD     +  Y    +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 190 IDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRIL 248
           ++    +  G+    +AV    G HHA+     GFC  +++ +    +L+ +P    R+L
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 249 ILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNIT 308
            +D D+HHG+G ++AFY   RV+  S H++  G+++PGT  G     G GKG+ ++ N+ 
Sbjct: 182 YVDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKNYSVNVP 237

Query: 309 WPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTH 368
               G+ DA Y   FE +V  +   +QP  V++ +G D+  GD +G  +++   +    +
Sbjct: 238 LR-DGIDDATYRAVFEPVVKRIMDWYQPSAVVLQTGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 369 MLKSLARGNLCVALEGGYNLDAIA 392
            +KS     + V   GGY +  +A
Sbjct: 297 YVKSFGIPMMVVG-GGGYTMRNVA 319

>NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8
          Length = 434

 Score =  120 bits (302), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 86/324 (26%), Positives = 150/324 (46%), Gaps = 28/324 (8%)

Query: 73  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVR 132
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 21  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 68

Query: 133 EATDEEILEVHSKENLEFVERSSRMKREELLKETEK---GDSVYFNNDSYVSAKLSCGGV 189
            AT +E+ + H+ E ++F+ R +    E   KE+ K   GD     +  Y    +S GG 
Sbjct: 69  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 128

Query: 190 IDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRIL 248
           ++    +  G+    +A+    G HHA+     GFC  +++ +    +L+ +P    R+L
Sbjct: 129 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRFHP----RVL 182

Query: 249 ILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNIT 308
            +D D+HHG+G ++AFY   RV+  S H++  G+++PGT  G    TG GKG+ +  N+ 
Sbjct: 183 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 238

Query: 309 WPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTH 368
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   +    +
Sbjct: 239 LR-DGIDDATYRNVFEPVIKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 297

Query: 369 MLKSLARGNLCVALEGGYNLDAIA 392
            +KS     + V   GGY +  +A
Sbjct: 298 YVKSFGIPMMVVG-GGGYTMRNVA 320

>Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON}
           similar to Ashbya gossypii AGR395W
          Length = 433

 Score =  120 bits (301), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 84/323 (26%), Positives = 149/323 (46%), Gaps = 26/323 (8%)

Query: 73  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVR 132
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 133 EATDEEILEVHSKENLEFVERSSRMKREELLKETEK---GDSVYFNNDSYVSAKLSCGGV 189
            AT +E+ + H+ E ++F+ R +    +   KE+ K   GD     +  Y    +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 190 IDACKAVVEGRVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILI 249
           ++    +  G+   A+       HHA+     GFC  +++ +    +L+ +P    R+L 
Sbjct: 128 MEGAARLNRGKCDVAINYAGGL-HHAKKSEASGFCYLNDIVLGIIELLRYHP----RVLY 182

Query: 250 LDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITW 309
           +D D+HHG+G ++AFY   RV+  S H++  G+++PGT  G    TG GKG+ ++ N+  
Sbjct: 183 IDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVPL 238

Query: 310 PVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHM 369
              G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   +    + 
Sbjct: 239 R-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVNY 297

Query: 370 LKSLARGNLCVALEGGYNLDAIA 392
           +KS     + V   GGY +  +A
Sbjct: 298 VKSFGIPMMVVG-GGGYTMRNVA 319

>ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  120 bits (301), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 86/324 (26%), Positives = 150/324 (46%), Gaps = 28/324 (8%)

Query: 73  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVR 132
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYNYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 133 EATDEEILEVHSKENLEFVERSSRMKREELLKETEK---GDSVYFNNDSYVSAKLSCGGV 189
            AT +E+ + H+ E ++F+ R +    +   KE+ K   GD     +  Y    +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 190 IDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRIL 248
           ++    +  G+    +A+    G HHA+     GFC  +++ +    +L+ +P    R+L
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKTEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 249 ILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNIT 308
            +D D+HHG+G ++AFY   RV+  S H++  G+++PGT  G    TG GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 309 WPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTH 368
               G+ DA Y   FE +V  +   +QP  V++  G D+  GD +G  +++   +    +
Sbjct: 238 LR-DGIDDATYKSVFEPVVSRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSIRGHANCVN 296

Query: 369 MLKSLARGNLCVALEGGYNLDAIA 392
            +KS     + V   GGY +  +A
Sbjct: 297 FVKSFGLPMMIVG-GGGYTMRNVA 319

>AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL330C (RPD3)
          Length = 433

 Score =  120 bits (300), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 84/323 (26%), Positives = 149/323 (46%), Gaps = 26/323 (8%)

Query: 73  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVR 132
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 133 EATDEEILEVHSKENLEFVERSSRMKREELLKETEK---GDSVYFNNDSYVSAKLSCGGV 189
            AT +E+ + H+ E ++F+ R +    +   KE+ K   GD     +  Y    +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 190 IDACKAVVEGRVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILI 249
           ++    +  G+   A+       HHA+     GFC  +++ +    +L+ +P    R+L 
Sbjct: 128 MEGAARLNRGKCDVAINYAGGL-HHAKKSEASGFCYLNDIVLGIIELLRYHP----RVLY 182

Query: 250 LDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITW 309
           +D D+HHG+G ++AFY   RV+  S H++  G+++PGT  G    TG GKG+ ++ N+  
Sbjct: 183 IDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVPL 238

Query: 310 PVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHM 369
              G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   +    + 
Sbjct: 239 R-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVNY 297

Query: 370 LKSLARGNLCVALEGGYNLDAIA 392
           +KS     + V   GGY +  +A
Sbjct: 298 VKSFGIPMMVVG-GGGYTMRNVA 319

>KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  120 bits (300), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 86/324 (26%), Positives = 150/324 (46%), Gaps = 28/324 (8%)

Query: 73  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVR 132
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 133 EATDEEILEVHSKENLEFVERSSRMKREELLKETEK---GDSVYFNNDSYVSAKLSCGGV 189
            AT +E+ + H+ E ++F+ R +    E   KE+ K   GD     +  Y    +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 190 IDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRIL 248
           +++   +  G+    +A+    G HHA+     GFC  +++ +    +L+ +P    R+L
Sbjct: 128 MESAARLNRGKCD--IAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 249 ILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNIT 308
            +D D+HHG+G ++AFY   RV+  S H++  G+++PGT  G     G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGQNYAVNVP 237

Query: 309 WPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTH 368
               G+ DA Y   FE +V  +   +QP  V++  G D+  GD +G  +++   +    +
Sbjct: 238 LR-DGIDDATYRSVFEPVVGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHASCVN 296

Query: 369 MLKSLARGNLCVALEGGYNLDAIA 392
            +KS     + V   GGY +  +A
Sbjct: 297 YVKSFNIPMMVVG-GGGYTMRNVA 319

>SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  120 bits (300), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 84/323 (26%), Positives = 148/323 (45%), Gaps = 26/323 (8%)

Query: 73  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVR 132
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 133 EATDEEILEVHSKENLEFVERSSRMKREELLKETEK---GDSVYFNNDSYVSAKLSCGGV 189
            AT +E+ + H+ E ++F+ R +        KE+ K   GD     +  Y    +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLNMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 190 IDACKAVVEGRVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILI 249
           ++    +  G+   A+       HHA+     GFC  +++ +    +L+ +P    R+L 
Sbjct: 128 MEGAARLNRGKCDVAINYAGGL-HHAKKSEASGFCYLNDIVLGIIELLRYHP----RVLY 182

Query: 250 LDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITW 309
           +D D+HHG+G ++AFY   RV+  S H++  G+++PGT  G    TG GKG+ ++ N+  
Sbjct: 183 IDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVPL 238

Query: 310 PVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHM 369
              G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   +    + 
Sbjct: 239 R-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANCVNY 297

Query: 370 LKSLARGNLCVALEGGYNLDAIA 392
           +KS     + V   GGY +  +A
Sbjct: 298 VKSFGIPMMVVG-GGGYTMRNVA 319

>KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330C RPD3 Histone deacetylase regulates
           transcription and silencing
          Length = 432

 Score =  120 bits (300), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 85/324 (26%), Positives = 150/324 (46%), Gaps = 28/324 (8%)

Query: 73  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVR 132
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 133 EATDEEILEVHSKENLEFVERSSRMKREELLKETEK---GDSVYFNNDSYVSAKLSCGGV 189
            AT +E+ + H+ E ++F+ R +    +   KE+ K   GD     +  Y    +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 190 IDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRIL 248
           ++    +  G+    +A+    G HHA+     GFC  +++ +    +L+ +P    R+L
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 249 ILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNIT 308
            +D D+HHG+G ++AFY   RV+  S H++  G+++PGT  G    TG GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 309 WPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTH 368
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   +    +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANCVN 296

Query: 369 MLKSLARGNLCVALEGGYNLDAIA 392
            +KS     L +   GGY +  +A
Sbjct: 297 YMKSFGV-PLMIVGGGGYTMRNVA 319

>Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  120 bits (300), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 85/324 (26%), Positives = 150/324 (46%), Gaps = 28/324 (8%)

Query: 73  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVR 132
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 133 EATDEEILEVHSKENLEFVERSSRMKREELLKETEK---GDSVYFNNDSYVSAKLSCGGV 189
            AT +E+ + H+ E ++F+ R +    E   +E+ K   GD     +  Y    +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 190 IDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRIL 248
           ++    +  G+    +AV    G HHA+     GFC  +++ +    +L+ +P    R+L
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 249 ILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNIT 308
            +D D+HHG+G ++AFY+  RV+  S H++  G+++PGT  G     G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVNVP 237

Query: 309 WPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTH 368
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   +G   +
Sbjct: 238 LR-DGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHGNCVN 296

Query: 369 MLKSLARGNLCVALEGGYNLDAIA 392
            +KS     + V   GGY +  +A
Sbjct: 297 YVKSFGIPMMVVG-GGGYTMRNVA 319

>NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {ON}
           Anc_3.8
          Length = 433

 Score =  119 bits (299), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 86/324 (26%), Positives = 150/324 (46%), Gaps = 28/324 (8%)

Query: 73  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVR 132
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 133 EATDEEILEVHSKENLEFVERSSRMKREELLKETEK---GDSVYFNNDSYVSAKLSCGGV 189
            AT +E+ + H+ E ++F+ R +    E   KE+ K   GD     +  Y    +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 190 IDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRIL 248
           ++    +  G+    +A+    G HHA+     GFC  +++ +    +L+ +P    R+L
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 249 ILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNIT 308
            +D D+HHG+G ++AFY+  RV+  S H++  G+++PGT  G     G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKYYAVNVP 237

Query: 309 WPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTH 368
               G+ DA Y   FE +V  +   +QP  V++  G D+  GD +G  +++   +    +
Sbjct: 238 LR-DGIDDATYRNVFEPVVKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 369 MLKSLARGNLCVALEGGYNLDAIA 392
            +KS     + V   GGY +  +A
Sbjct: 297 YVKSFGIPMMVVG-GGGYTMRNVA 319

>CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330c RPD3 histone deacetylase B or
           uniprot|P53096 Saccharomyces cerevisiae YGL194c HOS2
          Length = 433

 Score =  119 bits (297), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 85/324 (26%), Positives = 149/324 (45%), Gaps = 28/324 (8%)

Query: 73  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVR 132
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 133 EATDEEILEVHSKENLEFVERSSRMKREELLKETEK---GDSVYFNNDSYVSAKLSCGGV 189
            AT +E+ + H+ E ++F+ R +    E   KE+ K   GD     +  Y    +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 190 IDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRIL 248
           ++    +  G+    +A+    G HHA+     GFC  +++ +    +L+ +P    R+L
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 249 ILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNIT 308
            +D D+HHG+G ++AFY   RV+  S H++  G+++PGT  G     G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKYYAVNVP 237

Query: 309 WPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTH 368
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   +    +
Sbjct: 238 LR-DGIDDATYRSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 369 MLKSLARGNLCVALEGGYNLDAIA 392
            +KS     + V   GGY +  +A
Sbjct: 297 YVKSFGIPMMVVG-GGGYTMRNVA 319

>KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  118 bits (296), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 84/324 (25%), Positives = 149/324 (45%), Gaps = 28/324 (8%)

Query: 73  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVR 132
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 133 EATDEEILEVHSKENLEFVERSSRMKREELLKETEK---GDSVYFNNDSYVSAKLSCGGV 189
            AT +E+ + H+ E ++F+ R +    +   KE+ K   GD     +  Y    +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 190 IDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRIL 248
           ++    +  G+    +A+    G HHA+     GFC  +++ +    +L+ +P    R+L
Sbjct: 128 MEGAARLNRGKCD--IAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 249 ILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNIT 308
            +D D+HHG+G ++AFY   RV+  S H++  G+++PGT  G     G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKNYAVNVP 237

Query: 309 WPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTH 368
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   +    +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 369 MLKSLARGNLCVALEGGYNLDAIA 392
            +KS     + V   GGY +  +A
Sbjct: 297 YVKSFNIPMMVVG-GGGYTMRNVA 319

>Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  117 bits (294), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 84/324 (25%), Positives = 148/324 (45%), Gaps = 28/324 (8%)

Query: 73  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVR 132
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 133 EATDEEILEVHSKENLEFVERSSRMKREELLKETEK---GDSVYFNNDSYVSAKLSCGGV 189
            AT +E+ + H+ E ++F+ R +    E   +E+ K   GD     +  Y    +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 190 IDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRIL 248
           ++    +  G+    +AV    G HHA+     GFC  +++ +    +L+ +P    R+L
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 249 ILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNIT 308
            +D D+HHG+G ++AFY   RV+  S H++  G+++PGT  G     G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVNVP 237

Query: 309 WPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTH 368
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   +    +
Sbjct: 238 LR-DGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 369 MLKSLARGNLCVALEGGYNLDAIA 392
            +KS     + V   GGY +  +A
Sbjct: 297 YVKSFGIPMMVVG-GGGYTMRNVA 319

>YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}
           RPD3Histone deacetylase; regulates transcription,
           silencing, and other processes by influencing chromatin
           remodeling; forms at least two different complexes which
           have distinct functions and members
          Length = 433

 Score =  117 bits (293), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 84/324 (25%), Positives = 148/324 (45%), Gaps = 28/324 (8%)

Query: 73  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVR 132
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 133 EATDEEILEVHSKENLEFVERSSRMKREELLKETEK---GDSVYFNNDSYVSAKLSCGGV 189
            AT +E+ + H+ E ++F+ R +    E   +E+ K   GD     +  Y    +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 190 IDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRIL 248
           ++    +  G+    +AV    G HHA+     GFC  +++ +    +L+ +P    R+L
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 249 ILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNIT 308
            +D D+HHG+G ++AFY   RV+  S H++  G+++PGT  G     G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGAGKNYAVNVP 237

Query: 309 WPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTH 368
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   +    +
Sbjct: 238 LR-DGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 369 MLKSLARGNLCVALEGGYNLDAIA 392
            +KS     + V   GGY +  +A
Sbjct: 297 YVKSFGIPMMVVG-GGGYTMRNVA 319

>TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  116 bits (291), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 83/324 (25%), Positives = 149/324 (45%), Gaps = 28/324 (8%)

Query: 73  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVR 132
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 67

Query: 133 EATDEEILEVHSKENLEFVERSSRMKREELLKETEK---GDSVYFNNDSYVSAKLSCGGV 189
            AT +E+ + H+ E ++F+ R +    +   KE+ K   GD     +  +    +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLFEYCSISGGGS 127

Query: 190 IDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRIL 248
           ++    +  G+    +A+    G HHA+     GFC  +++ +    +L+ +P    R+L
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 249 ILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNIT 308
            +D D+HHG+G ++AFY   RV+  S H++  G+++PGT  G     G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGIGKGKNYAVNVP 237

Query: 309 WPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTH 368
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   +    +
Sbjct: 238 LR-DGMDDATYRSVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 369 MLKSLARGNLCVALEGGYNLDAIA 392
            +KS     + V   GGY +  +A
Sbjct: 297 FVKSFNIPMMVVG-GGGYTMRNVA 319

>TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  116 bits (290), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 85/324 (26%), Positives = 148/324 (45%), Gaps = 28/324 (8%)

Query: 73  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVR 132
           R+ Y        F Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNFSYGQYHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 133 EATDEEILEVHSKENLEFVERSSRMKREELLKETEK---GDSVYFNNDSYVSAKLSCGGV 189
            AT +E+ + H+ E ++F+ R +    E   KE+ K   GD     +  Y    +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 190 IDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRIL 248
           ++    +  G+    +A+    G HHA+     GFC  +++ +    +L+ +P    R+L
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKAEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 249 ILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNIT 308
            +D D+HHG+G ++AFY   RV+  S H++  G+++PGT  G     G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGSGKYYAVNVP 237

Query: 309 WPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTH 368
               G+ DA +   FE +V  +   +QP  V++  G D+  GD +G  +++   +    +
Sbjct: 238 LR-DGIDDATFRNVFEPVVGKIMEWYQPAAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 369 MLKSLARGNLCVALEGGYNLDAIA 392
            +KS     + V   GGY +  +A
Sbjct: 297 YVKSFGIPMMVVG-GGGYTMRNVA 319

>Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {ON}
           YPR068C (REAL)
          Length = 477

 Score = 80.5 bits (197), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 91/177 (51%), Gaps = 13/177 (7%)

Query: 213 HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGTQKAFYNDPRVLY 272
           HHA  +   GFC  ++V +  Q + K     + ++  LD+D+HHG+G +KAF    ++  
Sbjct: 212 HHAFKQKANGFCYINDVVLLIQRLRKL---KLSKVTYLDFDLHHGDGVEKAFQYSRQIQT 268

Query: 273 ISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVGGVGDAEYM-LAFEQIVMPMA 331
           IS+H +E G ++PGT  G  + +  GK       +  P+    D  Y+ L   +I+ P+ 
Sbjct: 269 ISVHLYEPG-FFPGT--GSLNDSQNGKNI-----VNIPLKHGCDDNYLNLVASKIIHPLI 320

Query: 332 REFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQ-MTHMLKSLARGNLCVALEGGYN 387
           +   P+++I+  G D   GD   +  +T     + + +++KS  + ++ +   GGYN
Sbjct: 321 KRHDPEVIIMECGGDGLQGDRFNEWQLTIRGLSRTIVNIMKSYPQAHIFLLGGGGYN 377

>Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {ON}
           YPR068C (REAL)
          Length = 471

 Score = 79.3 bits (194), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 90/177 (50%), Gaps = 13/177 (7%)

Query: 213 HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGTQKAFYNDPRVLY 272
           HHA  +   GFC  ++V +  Q + K     + +I  +D+D+HHG+G ++AF    ++  
Sbjct: 212 HHAFKQKANGFCYINDVVLLIQRLRKM---KLNKITYVDFDLHHGDGVERAFQYSKQIQT 268

Query: 273 ISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVGGVGDAEYM-LAFEQIVMPMA 331
           IS+H +E G ++PGT  G  +   +GK       +  P+    D  Y+ L   +I+ P+ 
Sbjct: 269 ISIHLYEPG-FFPGT--GSLNDARKGKSV-----VNIPLKHGCDDSYLDLVASKIISPLI 320

Query: 332 REFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQ-MTHMLKSLARGNLCVALEGGYN 387
           +   PD++II  G D   GD   +  +T     + + +++K   R ++ +   GGYN
Sbjct: 321 KRHDPDVLIIECGGDGLLGDRFNEWQLTIRGLSRTIVNVMKLYPRAHIFLLGGGGYN 377

>Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}
           similar to Ashbya gossypii ADL265W
          Length = 709

 Score = 80.1 bits (196), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 81/302 (26%), Positives = 126/302 (41%), Gaps = 69/302 (22%)

Query: 158 KREELLKETEKGDSVYFNNDSYVSAKLSCGGVIDACKAVVEGRVKN-----ALAVVRPPG 212
           K+ E+  E   GD +Y   ++  + + S G V     ++ +G V       A   +RPPG
Sbjct: 134 KQVEVPDEWNVGD-IYLCEETVYALRGSIGAVEYGVDSIFKGEVNKDTANRAFVAIRPPG 192

Query: 213 HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGTQ----------- 261
           HH+    P GFCL +N  +A +     Y   V   +ILD+D+HHG+GTQ           
Sbjct: 193 HHSHAATPSGFCLLNNAHIAVEYAADTY--GVTHAVILDFDLHHGDGTQDICWKRAGFKA 250

Query: 262 ------KAFYND--------PRVLYISLHRFEMGKYYPGTIN-GRYDQTGEGKG---EGF 303
                 K  YN+        P+V Y S+H       +P  +N    D+  +      +  
Sbjct: 251 DDIQDAKGEYNEFDKKFAEFPKVGYFSMHDINS---FPTELNYASKDKVKDASTCIMDAH 307

Query: 304 NCNITWPV-----------GGVGDAEYMLAFEQ-------IVMPMAREFQP--DLVIISS 343
           + NI W +             +    Y   F +         + MA++ +P   LV++S+
Sbjct: 308 DVNI-WNIHLLPYETEEEFNKLYQTRYRTLFAKADEFFKAAKLSMAKDGKPFKGLVVMSA 366

Query: 344 GFDAADGDTIG-QCH---VTPSCYGQMTHMLKSLAR----GNLCVALEGGYNLDAIAISA 395
           GFDA++ + +  Q H   V  S Y   T     LA+    G +   LEGGY+  AIA   
Sbjct: 367 GFDASEYEQVSMQRHGVNVPTSFYSTFTKDALKLAQMHTNGKIISLLEGGYSDAAIASGV 426

Query: 396 LS 397
            S
Sbjct: 427 FS 428

>TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {ON}
           Anc_3.362 YPR068C
          Length = 454

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 89/181 (49%), Gaps = 11/181 (6%)

Query: 213 HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGTQKAFYNDPRVLY 272
           HHA  +   GFC  +++ +  Q + ++     ++I  +D+D+HHG+G +KAF     V  
Sbjct: 206 HHAFKQKASGFCYVNDIVLLIQKLRRK---GFQKISYIDFDLHHGDGVEKAFQFSSNVQT 262

Query: 273 ISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMLAFEQIVMPMAR 332
           ISLH FE+G ++PGT N       E        NI   + G+ D       EQIV P+  
Sbjct: 263 ISLHLFEVG-FFPGTGN-----LSESDKRRNVVNIPL-LHGLDDTSLEQLIEQIVKPVIE 315

Query: 333 EFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQ-MTHMLKSLARGNLCVALEGGYNLDAI 391
             +PD+++I  G D   GD   +  ++     + +T ++ +     + +   GGYN+  +
Sbjct: 316 RHEPDVLVIQCGGDGLMGDGFNEWQLSIRGLAKCITELINNTKDCPVILLGGGGYNVTLM 375

Query: 392 A 392
           +
Sbjct: 376 S 376

>KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C
          Length = 474

 Score = 77.0 bits (188), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 59/222 (26%), Positives = 107/222 (48%), Gaps = 19/222 (8%)

Query: 174 FNNDSYVSAKLS--CGGVIDACKAVVEG---RVKNALAVVRPPG-HHAEPEAPGGFCLFS 227
            ++D Y+ A L   C  +  A  ++V     R + A+++    G HHA      GFC  +
Sbjct: 176 LSHDCYLFAYLPLYCQVIAGATLSLVRAACLRHERAISINWDGGRHHASRSRASGFCYIN 235

Query: 228 NVAVAAQNILKQYPESVRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGT 287
           ++A+  Q + ++    +RRI  +D+D+HH +G ++AF +   V  IS+H  E G ++PGT
Sbjct: 236 DIALLIQKLRRR---GIRRISYIDFDLHHCDGVERAFQHSQSVQTISVHLHEPG-FFPGT 291

Query: 288 INGRYDQTGEGKGEGFNCNITWPV-GGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFD 346
             G   +   GK       +  PV  G+ D       ++++MP  R   P++++I  G D
Sbjct: 292 --GSLKEASVGKNV-----VNIPVQHGMDDTFLNQIVQRVIMPCIRSHNPEVLVIQCGGD 344

Query: 347 AADGDTIGQCHVT-PSCYGQMTHMLKSLARGNLCVALEGGYN 387
              GD   +  +T       + ++++     N+ +   GGYN
Sbjct: 345 GLMGDKYKEWQLTIKGLVNNIMYIVRGFPATNVVMLGGGGYN 386

>Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {ON}
           YPR068C (REAL)
          Length = 470

 Score = 76.6 bits (187), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 90/177 (50%), Gaps = 13/177 (7%)

Query: 213 HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGTQKAFYNDPRVLY 272
           HHA  +   GFC  ++V +  Q + K     + +I  LD+D+HHG+G +KAF    ++  
Sbjct: 210 HHAFKQRASGFCYINDVVLLIQRLRKI---KLNKITYLDFDLHHGDGVEKAFQYSKQIQT 266

Query: 273 ISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVG-GVGDAEYMLAFEQIVMPMA 331
           IS+H +E G ++PGT  G  D +  GK       +  P+  G  D+   L   +I+ P+ 
Sbjct: 267 ISVHIYEPG-FFPGT--GSLDDSRGGKNV-----VNIPLKHGCDDSYLNLIASKIINPLI 318

Query: 332 REFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQ-MTHMLKSLARGNLCVALEGGYN 387
            +  P+++II  G D   GD   +  +T     + + + +K  ++ ++ +   GGYN
Sbjct: 319 DKHDPEVLIIECGGDGLLGDRFNEWQLTVRGLSETIINFIKRYSQAHIFLLGGGGYN 375

>NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON}
           Anc_3.362 YPR068C
          Length = 508

 Score = 76.6 bits (187), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 74/265 (27%), Positives = 121/265 (45%), Gaps = 21/265 (7%)

Query: 134 ATDEEILEVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSY--VSAKLSCGGVID 191
            T+E + +   KEN    E+   M RE+L     +GD   F   SY  V  ++  G  + 
Sbjct: 156 TTEEPVNKRAEKENSNDNEK--EMIREKLKGYNLEGDCPIF---SYLPVYCQVIVGATLS 210

Query: 192 ACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILIL 250
             K +     +  +AV    G HHA      GFC  +++ +  Q +        +RI  +
Sbjct: 211 LAKHITAVANERTIAVNWDGGRHHALRNKASGFCYINDIVLLIQQLRSN---GYKRITYI 267

Query: 251 DWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWP 310
           D+D+HHG+G Q++F     V  IS H FE G ++P T  G   ++  GK      NI   
Sbjct: 268 DFDLHHGDGVQRSFQYSTSVQTISAHMFEPG-FFPCT--GSLKESKMGKNI---VNIPL- 320

Query: 311 VGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHML 370
           + GV D       E++++P  + + P++++I  G D   GD   +  +T   +G + ++L
Sbjct: 321 LHGVDDMLMNEIVEKVMIPCVKRYDPEILVIQCGGDGLIGDGYAEWQLT--IHGLVNNIL 378

Query: 371 KSLARGNLC-VALEGGYNLDAIAIS 394
           K L     C V L GG   +   +S
Sbjct: 379 KLLRIFPGCPVVLLGGGGYNETVMS 403

>TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {ON}
           Anc_8.607 YPL116W
          Length = 674

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 89/318 (27%), Positives = 131/318 (41%), Gaps = 68/318 (21%)

Query: 139 ILEVHSKENLEFVERSSRMKREELLK-ETEKGDSVYFNNDSYVSAKL------SCGGVID 191
           +L+VH ++    + R  +   E+L K E E  DS + + D Y+S+K       S G +  
Sbjct: 108 VLKVHGRDWPPTLLRLCKHADEKLAKGEIEVPDS-WNSGDIYLSSKTIEALQGSIGALET 166

Query: 192 ACKAVVEG----RVKN-ALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRR 246
              ++ EG     V N A  V+RPPGHH     P GFCL +N  V+ +     Y   +  
Sbjct: 167 GVDSIFEGPSPEHVSNRAFVVIRPPGHHCRAGTPSGFCLLNNAHVSIEYAHDTY--GITH 224

Query: 247 ILILDWDIHHGNGTQ-------------------------KAFYNDPRVLYISLH---RF 278
            ++LD+D+HHG+GTQ                         K F   PRV Y S+H    F
Sbjct: 225 AVVLDFDLHHGDGTQDICWKRAGFRPDEQDENTGGYDEFGKKFAEFPRVGYFSMHDINSF 284

Query: 279 EMGKYYPGTINGRYDQTGEGKGEGFNC-NI---TWPV----GGVGDAEYMLAF------- 323
                Y    N +   T    G   N  N+    W        +  ++Y   F       
Sbjct: 285 PTESGYATKDNIKSASTCIMNGHDLNIWNVHLSAWETEEDFNKLYQSKYRTLFAKADEFF 344

Query: 324 --EQIVMPMAREFQPDLVIISSGFDAADGDTIG-QCH---VTPSCYGQMTHMLKSLAR-- 375
              +I M    +    LV+IS+GFDA++ + +  Q H   V  + Y   T     LA+  
Sbjct: 345 KNAKIEMSAKGKKFKGLVVISAGFDASEFEQVSMQRHGVNVPTNFYTMFTKDALKLAQMH 404

Query: 376 --GNLCVALEGGYNLDAI 391
             G +   LEGGY+  AI
Sbjct: 405 SEGKVLSVLEGGYSDKAI 422

>YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON}
           HOS1Class I histone deacetylase (HDAC) family member
           that deacetylates Smc3p on lysine residues at anaphase
           onset; has sequence similarity to Hda1p, Rpd3p, Hos2p,
           and Hos3p; interacts with the Tup1p-Ssn6p corepressor
           complex
          Length = 470

 Score = 76.3 bits (186), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 89/177 (50%), Gaps = 13/177 (7%)

Query: 213 HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGTQKAFYNDPRVLY 272
           HHA  +   GFC  ++V +  Q + K     + +I  +D+D+HHG+G +KAF    ++  
Sbjct: 210 HHAFKQRASGFCYINDVVLLIQRLRKA---KLNKITYVDFDLHHGDGVEKAFQYSKQIQT 266

Query: 273 ISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVGGVGDAEYM-LAFEQIVMPMA 331
           IS+H +E G ++PGT  G    + + K       +  P+    D  Y+ L   +IV P+ 
Sbjct: 267 ISVHLYEPG-FFPGT--GSLSDSRKDKNV-----VNIPLKHGCDDNYLELIASKIVNPLI 318

Query: 332 REFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQ-MTHMLKSLARGNLCVALEGGYN 387
              +P+ +II  G D   GD   +  +T     + + +++KS  R ++ +   GGYN
Sbjct: 319 ERHEPEALIIECGGDGLLGDRFNEWQLTIRGLSRIIINIMKSYPRAHIFLLGGGGYN 375

>Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C
           (HOS1) - Similar to Hda1p, Rpd3p, Hos2p, and Hos3p
           [contig 254] FULL
          Length = 473

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/231 (25%), Positives = 103/231 (44%), Gaps = 19/231 (8%)

Query: 213 HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGTQKAFYNDPRVLY 272
           HHA      GFC  +++A+  Q + ++    + +I  LD+D+HHG+G ++AF +   V  
Sbjct: 224 HHAFKSKASGFCYVNDIAILIQKLRRR---GIHKISYLDFDLHHGDGVERAFQHSANVQT 280

Query: 273 ISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPV-GGVGDAEYMLAFEQIVMPMA 331
           IS+H +E G ++PGT  G       G+       +  PV  G+ D        ++V+P  
Sbjct: 281 ISIHMYEEG-FFPGT--GTLKDASSGRNI-----VNIPVLHGMDDTFLNEVVNRVVIPCL 332

Query: 332 REFQPDLVIISSGFDAADGDTIGQCHVT-PSCYGQMTHMLKSLARGNLCVALEGGYNLDA 390
               P++VII  G D   GD   +  +T       +  +++     N+ +   GGYN   
Sbjct: 333 HNHNPEVVIIQCGGDGLIGDKYKEWQLTLKGLTDTIMKVVEDFPSSNIVLLGGGGYNEKL 392

Query: 391 IA-----ISALSVAKVLIGEPPDELPDPTKDPKLEAIEMIDTVIHTQSKYW 436
           ++     ++   V+K     P D  P    D  +   E ID+      K+W
Sbjct: 393 MSRFYTYLTWRIVSKYSENAPTDN-PFDRHDDVIPDHEFIDSYKDEFYKFW 442

>ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR068C (HOS1)
          Length = 437

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 71/242 (29%), Positives = 112/242 (46%), Gaps = 23/242 (9%)

Query: 203 NALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGTQ 261
           +ALAV    G HHA      GFC  +++A+  Q + +Q      R+  +D+D+HHG+G +
Sbjct: 182 SALAVNWDGGRHHALKARASGFCYVNDIALLIQTLRRQ---GFLRVSYVDFDLHHGDGVE 238

Query: 262 KAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWP-VGGVGDAEYM 320
            AF     V   SLH FE G ++PG        TG  K    N  +  P + GV D+   
Sbjct: 239 NAFRYSKNVQTCSLHLFEPG-FFPG--------TGACKNCTDNSVLNVPLLHGVDDSTLD 289

Query: 321 LAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHMLKSL-ARGNLC 379
              + IV P  +   P+++II  G D   GD  G+  +  S +G   ++LK + A     
Sbjct: 290 HVVDHIVTPAVQRHDPEVLIIQCGGDGLSGDKYGEWQL--SIHGLTRNILKLVQAHKFKK 347

Query: 380 VAL--EGGYNLDAIAISALSVAKVLIGEP---PDELPDPTKDPKLEAIEMIDTVIHTQSK 434
           +AL   GGYN    +     +  +L+ +    P E+ D  +D  +   E+I+       K
Sbjct: 348 IALLGGGGYNGRLQSRFYAYLTSMLLAQCKGIPTEIGDD-EDELIRDHELIEMYEQEDYK 406

Query: 435 YW 436
           +W
Sbjct: 407 FW 408

>ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL116W (HOS3)
          Length = 694

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 87/326 (26%), Positives = 122/326 (37%), Gaps = 79/326 (24%)

Query: 186 CGGVIDACKAVV---EGRVKN-------------ALAVVRPPGHHAEPEAPGGFCLFSNV 229
           C G IDA +  +   E  V +             A   +RPPGHH+    P GFCL +N 
Sbjct: 150 CRGTIDALQGSIGALESGVDSIFDGPSAASTPNRAFVALRPPGHHSHTSTPSGFCLLNNA 209

Query: 230 AVAAQNILKQYPESVRRILILDWDIHHGNGTQ-------------------------KAF 264
            +A +    +Y   V    ILD+D+HHG+GTQ                         K F
Sbjct: 210 HIAVEYAASRY--GVTHAAILDFDLHHGDGTQDICWKRAGFKPDDEEDNAAEYDDFGKRF 267

Query: 265 YNDPRVLYISLHRF-----EMGKYYPGTING--------------RYDQTGEGKGEGFNC 305
              P+V Y SLH       E G  +  +I                    T     E FN 
Sbjct: 268 AEFPKVGYFSLHDINSFPTEQGYAHKTSIKDASVCIMDSHDVNIWNIHLTAYETEEEFNK 327

Query: 306 NITWPVGGV-GDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQ----CHVTP 360
                   +   A+  L   Q  M    +    L+IIS+GFDA++ + +       HV  
Sbjct: 328 LYQTKYRAIFAKADEFLRVSQKRMASEGKNYKGLIIISAGFDASEHEQLSMQRHGVHVPT 387

Query: 361 SCYGQMTHMLKSLA----RGNLCVALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKD 416
           S Y   T     LA    +G L   LEGGY+ DA  +S   V   LIG     + +    
Sbjct: 388 SFYCAFTKDALKLAQMHTQGKLLSLLEGGYS-DAALVSG--VFSHLIG-----MQNQNWI 439

Query: 417 PKLEAIEMIDTVIHTQSKYWKCFQRK 442
           P+  + ++I  V       WK ++ K
Sbjct: 440 PEWGSAQVIKEVCRGCRPNWKAYKTK 465

>TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.362
           YPR068C
          Length = 579

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 90/176 (51%), Gaps = 11/176 (6%)

Query: 213 HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGTQKAFYNDPRVLY 272
           HH+  +   GFC  +++ +  Q + ++     R+I  LD+D+HHG+G +K+F     +  
Sbjct: 299 HHSRKKKASGFCYVNDIVLCIQKLGEK---GFRKITYLDFDLHHGDGVEKSFQYSKHIQT 355

Query: 273 ISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMLAFEQIVMPMAR 332
           IS+H FE G ++P T  G  ++T      GFN      + G+ D        ++++P+ +
Sbjct: 356 ISVHLFEPG-FFPCT--GSLEET----KHGFNIVNIPTLHGLDDNYLTYLLNRVIIPLIK 408

Query: 333 EFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQ-MTHMLKSLARGNLCVALEGGYN 387
           + +P+ +++  G D   GD   +  +T S   + +  +L++    ++ +   GGYN
Sbjct: 409 KHKPECLVVQCGGDGLIGDRYKEWQMTISGLTKNIMLVLQNFPECSVVLLGGGGYN 464

>SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 489

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 98/230 (42%), Gaps = 18/230 (7%)

Query: 213 HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGTQKAFYNDPRVLY 272
           HH+      GFC  +++ +A Q + + +      I  +D+D+HHG+G ++AF     V  
Sbjct: 242 HHSFKSRASGFCYINDIVLAIQRLRRNFSN----ISYVDFDLHHGDGVERAFQYSKNVQT 297

Query: 273 ISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPV-GGVGDAEYMLAFEQIVMPMA 331
           ISLH  E G ++PGT +    Q G          I  P+  G  D   M   E +V+P  
Sbjct: 298 ISLHNHEPG-FFPGTGSMESSQDGHSI-------INIPLRHGADDDCLMKITESVVIPCI 349

Query: 332 REFQPDLVIISSGFDAADGDTIGQCHVT-PSCYGQMTHMLKSLARGNLCVALEGGYNLDA 390
           ++  P +++I  G D   GD   +  +T       +  +L SL   ++ +   GGYN   
Sbjct: 350 QKHGPQVIVIQCGGDGLIGDKYEEWQLTIRGLTSSILKILSSLPDTHIILLGGGGYNDRV 409

Query: 391 IA----ISALSVAKVLIGEPPDELPDPTKDPKLEAIEMIDTVIHTQSKYW 436
           ++         V       PP++ P    +  +   E +D       K+W
Sbjct: 410 MSRFYTYLTWKVCDQFSKSPPEDPPFIDDEDLIPDHEFLDLYTDEHYKFW 459

>CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068c HOS1
          Length = 445

 Score = 73.9 bits (180), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 69/289 (23%), Positives = 126/289 (43%), Gaps = 25/289 (8%)

Query: 184 LSCGGVIDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPE 242
           +S G  +   + ++EG  +  +A+    G HH+      GFC  +++A+    + +    
Sbjct: 174 VSTGATLSLAQYILEGS-ERTIAINWDGGRHHSMKTKASGFCYINDIALLIMTLRRG--- 229

Query: 243 SVRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEG 302
            V RI  +D+D+HHG+G +KAF    +V  ISLH +E G ++P   +G  +    GK   
Sbjct: 230 GVDRISYVDFDLHHGDGVEKAFKYSKQVQTISLHMYETG-FFP--CSGSLEDNSSGKSI- 285

Query: 303 FNCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSC 362
              NI   + G+ D+      ++I++P   + QP++++I  G D   GD   +  +  S 
Sbjct: 286 --VNIPL-LHGLDDSTLQDIAKRIIVPSISKHQPNVIVIQCGGDGLKGDKYSEWQL--SI 340

Query: 363 YGQMTHMLKSLARGNLCVALEGGYNLDAIAISAL------SVAKVLIGEPPDELPDPTKD 416
            G  + +   + + N  + L GG   + + +S        S+      E    + D  +D
Sbjct: 341 KGLTSTITSLIEQFNCHIVLLGGGGYNNLLMSRFYTYLTWSICHQYASEYSTPIDDLIQD 400

Query: 417 PKLEAIEMIDTVIHTQSKYWKCFQRKFGNAGCNFSEPVTETVISKSFPL 465
                    D     Q K+W   Q   G +  N++       + K+ PL
Sbjct: 401 HCYS-----DLYSPEQFKFWYYDQETSGGSLKNYNTTAYIEDLIKNIPL 444

>KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.362
           YPR068C
          Length = 474

 Score = 73.2 bits (178), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 92/208 (44%), Gaps = 15/208 (7%)

Query: 183 KLSCGGVIDACKAVVEGRVKNALAVVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYP 241
           +++ G  +   K +V       + +    G HHA  +   GFC  +++ +  Q + K   
Sbjct: 188 QVTTGATLSLSKFLVPNSKDRTICINWDGGRHHASKKKASGFCYINDIVLLIQRMRKN-- 245

Query: 242 ESVRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGE 301
              ++I  LD+D+HHG+G +KAF     +  ISLH FE G ++PG        TG    +
Sbjct: 246 -GFKKITYLDFDLHHGDGVEKAFQFSKSIQTISLHLFETG-FFPG--------TGGLSNK 295

Query: 302 GFNCNITWPVG-GVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTP 360
           G    I  P+  G+ D       +QI++P       + +++  G D   GD   +  +T 
Sbjct: 296 GSRDLIDIPLSHGLTDDYLFELVKQIIIPAIDLHAAEAIVLQCGGDGLSGDKFNEWQLTI 355

Query: 361 SCYGQ-MTHMLKSLARGNLCVALEGGYN 387
               Q +  ++   +   + +   GGYN
Sbjct: 356 KGLTQCIIDVIGKFSDCQIVLLGGGGYN 383

>KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 715

 Score = 73.6 bits (179), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 74/267 (27%), Positives = 101/267 (37%), Gaps = 73/267 (27%)

Query: 197 VEGRVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHH 256
           VE     A   +RPPGHH+    P GFCL +N  +A +   ++Y   V   +ILD+D+HH
Sbjct: 176 VEQTANRAFIAIRPPGHHSHASTPSGFCLLNNAHIAIEYAFEKY--DVTHAVILDFDLHH 233

Query: 257 GNGTQ---------------------------------KAFYNDPRVLYISLHRF----- 278
           G+GTQ                                 K+F   P+V Y SLH       
Sbjct: 234 GDGTQDICWKRAGFRPDEFSTDAEHGASEDDNKYDEFGKSFAEFPKVGYFSLHDINSFPT 293

Query: 279 EMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVG--GVGDAEYMLAFEQI----VMPMAR 332
           E+G  Y    N R   T        N    W V      D E  +   Q     +   A 
Sbjct: 294 ELG--YATKENIRNASTCIMDAHDINI---WNVHLQSYKDEEEFVKLYQTKYRSIFAKAD 348

Query: 333 EFQPD--------------LVIISSGFDAADGDTIG----QCHVTPSCYGQMTHMLKSLA 374
           EF  +              LV+IS+GFDA++ +         +V  S Y   T     LA
Sbjct: 349 EFFKNAKLEMKQGGFRFKGLVVISAGFDASEYEQQSMQRHNVNVPTSFYNLFTKDALKLA 408

Query: 375 R----GNLCVALEGGYNLDAIAISALS 397
           +    G +   +EGGY+  AIA    S
Sbjct: 409 QMHSNGKIISVMEGGYSDGAIASGVFS 435

>ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]
           {ON} similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 436

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/228 (27%), Positives = 104/228 (45%), Gaps = 21/228 (9%)

Query: 213 HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGTQKAFYNDPRVLY 272
           HHA  +   GFC  +++ +  Q   K   +  +R+  +D+D+HHG+G ++AF     V  
Sbjct: 195 HHAMKKRASGFCYVNDIVLLIQ---KLRSKGFQRLSYIDFDLHHGDGVERAFQFSSNVQT 251

Query: 273 ISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVG-GVGDAEYMLAFEQIVMPMA 331
           IS+H FE G ++P +  G  +   +GK      NI  P+  G+ D        Q+V+P+ 
Sbjct: 252 ISMHLFECG-FFPTS--GSLEDNKKGKNIA---NI--PLAHGLNDEYLNEIVTQVVIPLT 303

Query: 332 REFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHMLKSLARGNLCVAL---EGGYNL 388
               P ++II  G D   GD   +  +T    G   ++LK + R   C  +    GGYN 
Sbjct: 304 DRHSPQVIIIQCGGDGLMGDEYNEWQLTIK--GLCENILKIVNRYKNCSIVLLGGGGYNP 361

Query: 389 DAIAISALSVAKVLIGEPPDELPDPTKDPKLEAIEMIDTVIHTQSKYW 436
             ++     +   LI   P+ L D  +D  +   + ID       K+W
Sbjct: 362 TVMSRFYTYLTGKLI--DPNFLQD--EDTIIPEHKFIDAYHDEHYKFW 405

>TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa]
           {ON} Anc_8.607 YPL116W
          Length = 694

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 98/242 (40%), Gaps = 55/242 (22%)

Query: 204 ALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGTQ-- 261
           A   +RPPGHH +   P GFCL +N  ++ +     Y   +   +ILD+D+HHG+GTQ  
Sbjct: 187 AFVAIRPPGHHCKVATPSGFCLLNNAHISIEYAADHY--GITHAVILDFDLHHGDGTQDI 244

Query: 262 -----------------------KAFYNDPRVLYISLH---RFEMGKYYPGTINGRYDQT 295
                                  K F   P+V Y S+H    F     Y   +N R   T
Sbjct: 245 CWKRAGFRSEDEPEGSEGYDDFGKKFAEFPKVGYFSMHDINSFPTETGYATKVNIRNAST 304

Query: 296 GEGKGEGFNC--------NITWPVGGVGDAEYMLAFEQ-------IVMPMAREFQP--DL 338
               G   N         N       +  ++Y   F +           MA+E +P   L
Sbjct: 305 CIMDGHDLNIWNIHLSPWNTEEDFQKLYQSKYRTLFAKADDYFRNAKYQMAQEGKPFKGL 364

Query: 339 VIISSGFDAADGD-TIGQCH---VTPSCYGQMTHMLKSLA----RGNLCVALEGGYNLDA 390
           V+IS+GFDA++ + T  Q H   V  + Y   T     LA    +G +   LEGGY+  A
Sbjct: 365 VVISAGFDASEYEQTSMQRHNVNVPTNFYTMFTKDALKLAQIHCQGKVLSLLEGGYSDKA 424

Query: 391 IA 392
           + 
Sbjct: 425 LT 426

>Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}
           complement(25558..27114) [1557 nt, 519 aa]
          Length = 518

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 87/177 (49%), Gaps = 13/177 (7%)

Query: 213 HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGTQKAFYNDPRVLY 272
           HHA      GFC  +++ +  Q + K+    + ++  +D+D+HHG+G +KAF     +  
Sbjct: 223 HHAIKNKASGFCYINDIVILIQKLRKK---GISKVSYIDFDLHHGDGVEKAFRYSSNIQT 279

Query: 273 ISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMLAF-EQIVMPMA 331
           IS+H +E G ++P T  G  + T  GK       +  P+    D  YM     +++ P+ 
Sbjct: 280 ISMHMYEPG-FFPCT--GSLEDTLNGKNI-----VNVPLYHGVDDNYMTEIVNELIKPLI 331

Query: 332 REFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQ-MTHMLKSLARGNLCVALEGGYN 387
               P++++I  G D   GD   +  +T S   + + ++++   + ++ +   GGYN
Sbjct: 332 ERHSPEVLVIQCGGDGLIGDKFEEWQLTISGLTRNIQNLIEWFPKSDIILLGGGGYN 388

>SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} similar
           to uniprot|Q02959 Saccharomyces cerevisiae YPL116W HOS3
           Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC)
          Length = 690

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 83/329 (25%), Positives = 134/329 (40%), Gaps = 79/329 (24%)

Query: 139 ILEVHS----KENLEFVERSSR---MKREELLKETEKGDSVYFNNDSYVSAKLSCGGVID 191
           +L+VH     KE L+  ++SS     K+ E+  +   GD +Y +  +  + + S G +  
Sbjct: 109 VLKVHGTDWPKELLQLCKQSSEKLAHKQVEVPDDWNVGD-IYLSQQTIAALEGSIGALET 167

Query: 192 ACKAVVEGR-----VKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRR 246
              ++ +G         A   VRPPGHH+    P GFCL +N  +A +     +  +V  
Sbjct: 168 GIDSIFQGSSQEDIANRAFVAVRPPGHHSHTATPSGFCLLNNAHIAIEYAADTF--NVTH 225

Query: 247 ILILDWDIHHGNGTQ------------------------KAFYNDPRVLYISLHRF---- 278
            ++LD+D+HHG+GTQ                        K F   P+V Y S+H      
Sbjct: 226 AVVLDFDLHHGDGTQDICWKRAGFNPDEQDDDPAYDEFGKKFAEFPKVGYFSMHDINSFP 285

Query: 279 -EMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVG-----------GVGDAEYMLAFEQI 326
            E+G  Y    N +   T        N    W V             +  ++Y   F + 
Sbjct: 286 TELG--YATKENIKNASTCIMNAHDLNI---WNVHLSHYETEEDFVKLYQSKYRSLFAKA 340

Query: 327 ----------VMPMAREFQPDLVIISSGFDAADGDTIG-QCH--VTPSC-YGQMTHMLKS 372
                     +    ++F+  LV+IS+GFDA++ +    Q H    P+C Y   T     
Sbjct: 341 DEFFKNAKKEMASQGKKFK-GLVVISAGFDASEYEQPSMQRHGVNVPTCFYNMFTKDALK 399

Query: 373 LAR----GNLCVALEGGYNLDAIAISALS 397
           LA+    G +   +EGGY+  AI+    S
Sbjct: 400 LAQMHTSGKVLSVMEGGYSDGAISSGVFS 428

>NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa]
           {ON} Anc_3.362 YPR068C
          Length = 490

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 73/297 (24%), Positives = 129/297 (43%), Gaps = 23/297 (7%)

Query: 149 EFVERSSRMKREELLKETEKGDSVYFNNDSYVS--AKLSCGGVIDACKAVVEGRVKNALA 206
           E +E ++ +K   + +   +GD   F   SY+    ++  G  +   K  ++   + ++A
Sbjct: 152 ETLEGNAEIKATLMKEHNLEGDCPLF---SYIPMYTQVVTGATLSLSK-FLQPNSERSIA 207

Query: 207 VVRPPG-HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGTQKAFY 265
           +    G HHA      GFC  +++ +  Q I K      + I  +D+D+HHG+G QKAF 
Sbjct: 208 INWDGGRHHAFKNKASGFCYVNDIVLLIQKIRKN---GFKNISYVDFDLHHGDGVQKAFQ 264

Query: 266 NDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMLAFEQ 325
               V  +SLH FE G ++P T         E K      NI    G  G     L  + 
Sbjct: 265 FSKNVQTVSLHMFEPG-FFPCT-----GSLQEAKAGSSIVNIPLLHGLDGTFLKQLT-KD 317

Query: 326 IVMPMAREFQPDLVIISSGFDAADGDTIGQCHVT-PSCYGQMTHMLKSLARGNLCVALEG 384
           I++P+  + +P++++I  G D   GD   +  +T     G +  ++ +    ++ +   G
Sbjct: 318 IIIPVVEQHEPEVLVIQCGGDGLIGDQYNEWQLTIHDLSGAIMKLINTFPSCSVVLLGGG 377

Query: 385 GYNLDAIA----ISALSVAKVLIGEPPDELPDPTK-DPKLEAIEMIDTVIHTQSKYW 436
           GYN   ++        ++A      PP  L   ++ +  +   E ID     Q KYW
Sbjct: 378 GYNEKVMSRFYNYLTWNIAFEYSKRPPSGLFLSSELNLLIPDHEFIDVYQDEQYKYW 434

>KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {ON}
           Anc_8.607 YPL116W
          Length = 717

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 74/306 (24%), Positives = 119/306 (38%), Gaps = 70/306 (22%)

Query: 152 ERSSRMKREEL-LKETEKGDSVYFNNDSYVSAKLSCGGVIDACKAVVEGR-----VKNAL 205
           E  S+++  +L + E+     +Y N+D+ ++ K S G +     ++  G         A 
Sbjct: 127 EADSKLREGKLEVPESWNAGDIYLNSDTIMALKGSIGAIETGVDSIFNGPSPEHICNRAF 186

Query: 206 AVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGTQ---- 261
             +RPPGHH     P GFCL +N  +  +     Y   V  +++LD+D+HHG+GTQ    
Sbjct: 187 VAIRPPGHHCHVGMPSGFCLLNNANITIEYAANTY--GVTHVVVLDFDLHHGDGTQDICW 244

Query: 262 ------------------------KAFYNDPRVLYISLH---RFEMGKYYPGTINGRYDQ 294
                                   K   + P+V Y S+H    F     Y    N +   
Sbjct: 245 KRAGFKPDGNYIDEADSTGYDDFEKKMADFPKVGYFSMHDINSFPTESGYATRENIKNAS 304

Query: 295 TGEGKGEGFNCNITWPVG-----------GVGDAEYMLAFEQ-------IVMPMAREFQP 336
           T        N    W V             +  ++Y   F +         + MA   +P
Sbjct: 305 TCIMNSHDLNI---WNVHLSKWSTEEDFLKLYRSKYRTLFAKADEFFKAAKLEMASMGKP 361

Query: 337 --DLVIISSGFDAADGDTIG----QCHVTPSCYGQMTHMLKSLAR----GNLCVALEGGY 386
              LV+ISSGFDA++ + +       +V  + Y   T     LA+    G +   +EGGY
Sbjct: 362 YKGLVLISSGFDASEFEQVSMQRHSVNVPTTFYTMFTKDALKLAQMHCHGKVISIMEGGY 421

Query: 387 NLDAIA 392
           +  AI 
Sbjct: 422 SDKAIT 427

>TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.607
           YPL116W
          Length = 698

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 77/289 (26%), Positives = 117/289 (40%), Gaps = 66/289 (22%)

Query: 172 VYFNNDSYVSAKLSCGGVIDACKAVVEG----RVKN-ALAVVRPPGHHAEPEAPGGFCLF 226
           +Y ++++  + + S G +     ++  G     + N A   +RPPGHH     P GFCL 
Sbjct: 149 IYLSSETIKAIEGSIGALELGLDSIFHGPSAEHISNRAFVAIRPPGHHCHVSTPSGFCLL 208

Query: 227 SNVAVAAQNILKQYPESVRRILILDWDIHHGNGTQ---------------------KAFY 265
           +N  +A +   ++Y   V   +ILD+D+HHG+GTQ                     K  Y
Sbjct: 209 NNAQIAIEYAYEKY--GVSHAVILDFDLHHGDGTQDICWKRAGFKPDDGNVQDDEDKNEY 266

Query: 266 ND--------PRVLYISLH---RFEMGKYYPGTINGRYDQTGEGKGEGFNC-NI---TWP 310
           +D        P+V Y S+H    F     Y    N +   T        N  N+   TW 
Sbjct: 267 DDFGKKMADFPKVGYFSMHDINSFPTESGYATKDNIKNASTCVMDAHDLNIWNVHLQTWA 326

Query: 311 VGGVGDAEYMLAFEQI--------------VMPMAREFQPDLVIISSGFDAADGD-TIGQ 355
                +  Y   +  +              +  M + F+  LV+IS+GFDA++ + T  Q
Sbjct: 327 TEEDFNKLYQTKYRTLFAKADEFFKNAKNQMQEMNKPFK-GLVVISAGFDASEFEQTSMQ 385

Query: 356 CH---VTPSCYGQMTHMLKSLAR----GNLCVALEGGYNLDAIAISALS 397
            H   V  S Y   T     LA+    G +   LEGGY+  AIA    S
Sbjct: 386 RHSVNVPTSFYTTFTKDALKLAQLHCNGKVLSVLEGGYSDKAIASGVFS 434

>YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}
           HOS3Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC) with specificity in vitro for
           histones H3, H4, H2A, and H2B; similar to Hda1p, Rpd3p,
           Hos1p, and Hos2p; deletion results in increased histone
           acetylation at rDNA repeats
          Length = 697

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 86/317 (27%), Positives = 129/317 (40%), Gaps = 67/317 (21%)

Query: 139 ILEVH-SKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYVSAKL--SCGGVIDACKA 195
           +L+VH S    E +E   +M   +LLK   +    + + D Y+S+K   +  G I A + 
Sbjct: 110 VLKVHGSSWPAELIELC-QMADAKLLKGEIEVPDTWNSGDIYLSSKTIKALQGTIGAIET 168

Query: 196 VVEGRVK---------NALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRR 246
            V+   K          A   +RPPGHH     P GFCL +N  VA +     Y  +V  
Sbjct: 169 GVDSIFKGPSAEHISNRAFVAIRPPGHHCHYGTPSGFCLLNNAHVAIEYAYDTY--NVTH 226

Query: 247 ILILDWDIHHGNGTQ------------------------KAFYNDPRVLYISLH---RFE 279
           +++LD+D+HHG+GTQ                        K F   P+V Y S+H    F 
Sbjct: 227 VVVLDFDLHHGDGTQDICWKRAGFKPEEEPEDSSYDDFGKKFAEFPKVGYFSMHDINSFP 286

Query: 280 MGKYYPGTINGRYDQTGEGKGEGFNC-NI---TWPVGGVGDAEYMLAFEQIV-------- 327
               +    N +   T        N  NI    W      +  Y   +  +         
Sbjct: 287 TESGFATKENIKNASTCIMNSHDLNIWNIHLSKWTTEEEFNVLYRTKYRTLFAKADEFFR 346

Query: 328 ---MPMAREFQP--DLVIISSGFDAADGD-TIGQCH---VTPSCYGQMTHMLKSLAR--- 375
              + M ++ +P   LV+IS+GFDA++ + T  Q H   V  S Y   T     LA+   
Sbjct: 347 SAKLEMNQQGRPFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQMHC 406

Query: 376 -GNLCVALEGGYNLDAI 391
            G +   +EGGY+  AI
Sbjct: 407 HGKVLSLMEGGYSDKAI 423

>Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116W
           (REAL)
          Length = 699

 Score = 70.9 bits (172), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 84/317 (26%), Positives = 124/317 (39%), Gaps = 67/317 (21%)

Query: 139 ILEVH-SKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYVSAKL--SCGGVIDACKA 195
           +L+VH S    E +E   +M   +LLK   +    + + D Y+S+K   +  G I A + 
Sbjct: 110 VLKVHGSHWPTELIELC-QMADAKLLKGEIEVPDTWNSGDIYLSSKTIQALQGTIGAIET 168

Query: 196 VVEGRVK---------NALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRR 246
            V+   K          A   +RPPGHH     P GFCL +N  VA +     Y   V  
Sbjct: 169 GVDSIFKGPSPEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAFDTY--DVTH 226

Query: 247 ILILDWDIHHGNGTQ------------------------KAFYNDPRVLYISLH---RFE 279
           +++LD+D+HHG+GTQ                        K F   P+V Y S+H    F 
Sbjct: 227 VVVLDFDLHHGDGTQDICWKRAGFKPEEESENSSYDNFGKKFAEFPKVGYFSMHDINSFP 286

Query: 280 MGKYYPGTINGRYDQTGEGKGEGFNC--------------NITWPVGG---VGDAEYMLA 322
               +    N +   T        N               NI +          A+    
Sbjct: 287 TESGFATKENIKNASTCIMNSHDLNIWNVHLSKWTTEEDFNILYRTKYRTLFAKADEFFK 346

Query: 323 FEQIVMPMAREFQPDLVIISSGFDAADGD-TIGQCH---VTPSCYGQMTHMLKSLAR--- 375
             ++ M    +    LV+IS+GFDA++ + T  Q H   V  S Y   T     LA+   
Sbjct: 347 TAKLEMNQQEKTFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQMHC 406

Query: 376 -GNLCVALEGGYNLDAI 391
            G +   +EGGY+  AI
Sbjct: 407 HGKVLSLMEGGYSDKAI 423

>Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON}
           complement(10892..12958) [2067 nt, 689 aa]
          Length = 688

 Score = 70.9 bits (172), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 76/288 (26%), Positives = 112/288 (38%), Gaps = 63/288 (21%)

Query: 169 GDSVYFNNDSYVSAKLSCGGVIDACKAVVEG----RVKN-ALAVVRPPGHHAEPEAPGGF 223
           GD +Y ++ +  + + S G +     ++  G     + N A   +RPPGHH   + P GF
Sbjct: 146 GD-IYLSSRTIEALQGSIGALETGVDSIFSGPSPDHISNRAFVAIRPPGHHCHVDTPSGF 204

Query: 224 CLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGTQ---------------------- 261
           CL +N  +A +     Y   +   +ILD+D+HHG+GTQ                      
Sbjct: 205 CLLNNAHIAIEYASDTY--GITHAVILDFDLHHGDGTQDICWKRAGFRTEAEPETTEGYD 262

Query: 262 ---KAFYNDPRVLYISLH---RFEMGKYYPGTINGRYDQTGEGKGEGFNC-NIT---WPV 311
              K F   P+V Y S+H    F     Y    N R   T        N  NI    W  
Sbjct: 263 EFGKKFAEFPKVGYFSMHDINSFPTESQYATKENIRNASTCVMNAHDVNIWNIHLSPWET 322

Query: 312 GGVGDAEYMLAFEQIVM--------------PMAREFQPDLVIISSGFDAADGD-TIGQC 356
               D  Y   +  +                 + + FQ  LV+IS+GFDA++ + T  Q 
Sbjct: 323 EQDFDKLYQTKYRTLFAKADEFFRNAKEEMDALGKPFQ-GLVVISAGFDASEFEQTSMQR 381

Query: 357 H---VTPSCYGQMTHMLKSLAR----GNLCVALEGGYNLDAIAISALS 397
           H   V    Y   T     L++    G +   +EGGY+  AIA    S
Sbjct: 382 HSVNVPTHFYTMFTKDALKLSQIHCHGKVLSIMEGGYSDKAIASGVFS 429

>Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON}
           YPL116W (REAL)
          Length = 697

 Score = 70.5 bits (171), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 84/317 (26%), Positives = 129/317 (40%), Gaps = 67/317 (21%)

Query: 139 ILEVH-SKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYVSAKL------SCGGVID 191
           +L+VH S    E +E   +M   +LLK   +    + + D Y+S+K       + G +  
Sbjct: 110 VLKVHGSHWPAELIELC-QMADAKLLKGEIEVPDTWNSGDIYLSSKTIKALQGTIGAIET 168

Query: 192 ACKAVVEG----RVKN-ALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRR 246
              ++ EG     + N A   +RPPGHH     P GFCL +N  VA +     Y  +V  
Sbjct: 169 GVDSIFEGPSAEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAYDTY--NVTH 226

Query: 247 ILILDWDIHHGNGTQ------------------------KAFYNDPRVLYISLH---RFE 279
           +++LD+D+HHG+GTQ                        K F   P+V Y S+H    F 
Sbjct: 227 VVVLDFDLHHGDGTQDICWKRAGFKPEEEPENSSYDEFDKKFAEFPKVGYFSMHDINSFP 286

Query: 280 MGKYYPGTINGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMLAFE---QIVMPMAREF-- 334
               +    N +   T        N           + E+ + +    + +   A EF  
Sbjct: 287 TESGFATKENIKNASTCIMNSHDLNIWNVHLSKWTTEEEFNILYRTKYRTLFAKADEFFR 346

Query: 335 ----------QP--DLVIISSGFDAADGD-TIGQCH---VTPSCYGQMTHMLKSLAR--- 375
                     +P   LV+IS+GFDA++ + T  Q H   V  S Y   T     LA+   
Sbjct: 347 SAKQEMNQNEKPFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQMHC 406

Query: 376 -GNLCVALEGGYNLDAI 391
            G +   +EGGY+  AI
Sbjct: 407 HGKVLSLMEGGYSDKAI 423

>KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 705

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 72/252 (28%), Positives = 99/252 (39%), Gaps = 61/252 (24%)

Query: 197 VEGRVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHH 256
           VE     A   +RPPGHH+    P GFCL +N  +A +     Y   V   ++LD+D+HH
Sbjct: 178 VEQTSNRAFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--GVTHAVVLDFDLHH 235

Query: 257 GNGTQ-------------------------KAFYNDPRVLYISLHRF-----EMGKYYPG 286
           G+GTQ                         K F   P+V Y SLH       E+G  Y  
Sbjct: 236 GDGTQDICWKRAGFKPDGCDDGGSEYNEFGKKFAEFPKVGYFSLHDINSFPTELG--YAT 293

Query: 287 TINGRYDQTGEGKGEGFNC-NITWPVGGVGDA-----------------EYMLAFEQIVM 328
             N R   T        N  N+        +A                 EY    +Q + 
Sbjct: 294 KENVRNAATCIMDAHDVNIWNVHLQSYDSDEAFTKLYQTKYRTLFAKADEYFRTAKQNMR 353

Query: 329 PMAREFQPDLVIISSGFDAADGDTIG-QCH---VTPSCYGQMTHMLKSLAR----GNLCV 380
            + + F+  LV+IS+GFDA++ +    Q H   V    Y   T     LA+    G L  
Sbjct: 354 ALGKPFK-GLVVISAGFDASEYEQPSMQRHAVNVPTFFYNLFTKDALKLAQMHSHGKLLS 412

Query: 381 ALEGGYNLDAIA 392
            LEGGY+  AI+
Sbjct: 413 VLEGGYSDGAIS 424

>KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.362
           YPR068C
          Length = 456

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 89/179 (49%), Gaps = 18/179 (10%)

Query: 213 HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGTQKAFYNDPRVLY 272
           HHA      GFC  +++ +  Q + KQ      ++  LD+D+HHG+G ++AF    +V  
Sbjct: 206 HHASKGKASGFCYVNDIVLLIQKLRKQ---GTGKVTYLDFDLHHGDGVERAFKFTKKVQT 262

Query: 273 ISLHRFEMGKYYP--GTINGRYDQTGEGKGEGFNCNITWPV-GGVGDAEYMLAFEQIVMP 329
           ISLH +E G ++P  G++ G           GF+  +  P+  G+ D+      +Q+V P
Sbjct: 263 ISLHLYEPG-FFPCTGSLEG---------SSGFD-TVNLPLQHGLTDSFLQGLVDQVVNP 311

Query: 330 MAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQ-MTHMLKSLARGNLCVALEGGYN 387
           + +   P++++I  G D   GDT  +  ++     + +  ++    + ++ +   GGYN
Sbjct: 312 LIQRHGPEVIVIQCGGDGLLGDTFHEWQLSIRGLTKCILDVMSHSTQAHVILLGGGGYN 370

>ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 668

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 80/281 (28%), Positives = 117/281 (41%), Gaps = 61/281 (21%)

Query: 169 GDSVYFNNDSYVSAKLSCGGVIDACKAVVEG----RVKN-ALAVVRPPGHHAEPEAPGGF 223
           GD +Y ++ +  + + S G +  A  ++ +G     + N A   +RPPGHH     P GF
Sbjct: 143 GD-IYLSSKTVEALQGSIGALETAVDSIFDGPSPEHISNRAFVAIRPPGHHCHVATPSGF 201

Query: 224 CLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGTQ---------------------- 261
           CL +N  VA +    ++   V    ILD+D+HHG+GTQ                      
Sbjct: 202 CLLNNAHVAIEYAKDRF--GVTHAAILDFDLHHGDGTQDICWKRAGFRPDEEDEDSPGYD 259

Query: 262 ---KAFYNDPRVLYISLH---RFEMGKYYPGTINGRYDQTGEGKGEGFNC-NI---TWPV 311
              K F   PRV Y S+H    F     Y    N +   T        N  NI    W  
Sbjct: 260 SFGKKFAEYPRVGYFSMHDINSFPTESGYATKENVKNASTCIMNAHDVNIWNIHLSPWET 319

Query: 312 ----GGVGDAEYMLA-------FEQIVMPMAREFQP--DLVIISSGFDAADGD-TIGQCH 357
                 +   +Y          F+Q  + MA + +P   LV+ISSGFDA++ + T  Q H
Sbjct: 320 EEDFAKLYHTKYRSLFVKADEFFKQGKIEMAAQNKPFKGLVVISSGFDASEFEQTSMQRH 379

Query: 358 VT--PS-CYGQMTHMLKSLAR----GNLCVALEGGYNLDAI 391
            T  P+  Y   T     L++    G +   +EGGY+  AI
Sbjct: 380 GTNVPTYFYTAFTKDALKLSQMHCHGKVLSIMEGGYSDKAI 420

>KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C HOS1
           Putative class I histone deacetylase (HDAC) with
           sequence similarity to Hda1p, Rpd3p, Hos2p, and Hos3p;
           deletion results in increased histone acetylation at
           rDNA repeats; interacts with the Tup1p-Ssn6p complex
          Length = 441

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 102/233 (43%), Gaps = 23/233 (9%)

Query: 213 HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGTQKAFYNDPRVLY 272
           HHA      GFC  +++ +  Q++ ++     +R+  +D+D+H+G+G  KAF     V  
Sbjct: 193 HHALKHYASGFCYVNDIVLLIQSLRRK---GWKRVTYIDFDLHYGDGVAKAFRFSENVQT 249

Query: 273 ISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMLAF-EQIVMPMA 331
           IS+H +E G ++PGT  G  ++T   K       +  PV    D +Y+L     ++ P+ 
Sbjct: 250 ISVHLYEPG-FFPGT--GSLEETRNSKQM-----VNLPVLHGMDDKYLLELISSVITPLI 301

Query: 332 REFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHMLKSLAR--GNLCVALEGGYNLD 389
             F  + ++I  G D   GD   +  ++      +TH + S+     +  V L GG   +
Sbjct: 302 ETFNAECIVIQCGSDGLSGDKYNEWQLSIRG---LTHAIISIMDMFRDKQVFLLGGGGYN 358

Query: 390 AIAISAL------SVAKVLIGEPPDELPDPTKDPKLEAIEMIDTVIHTQSKYW 436
            + +S         V ++        +P+   +  L   E I+       +YW
Sbjct: 359 ELLVSRFYTYLTSKVLELYGNNISSSIPEDDSEVLLRDHEFIELYKDENYRYW 411

>KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8.607
           YPL116W
          Length = 677

 Score = 67.0 bits (162), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 75/291 (25%), Positives = 115/291 (39%), Gaps = 63/291 (21%)

Query: 161 ELLKETEKGDSVYFNNDSYVSAKLSCGGVIDACKAVVEG----RVKN-ALAVVRPPGHHA 215
           E+ KE   GD +Y ++ +  + + + G +      +  G     + N    VVRPPGHH 
Sbjct: 136 EVPKEWNAGD-IYLSSATLTALRGTIGALETGVDTIFTGASPEHISNRVFVVVRPPGHHC 194

Query: 216 EPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGTQ-------------- 261
               P GFCL +N  ++ +     Y   V    ILD+D+HHG+GTQ              
Sbjct: 195 HVTGPSGFCLLNNAHISIEYAADTY--GVTHAAILDFDLHHGDGTQDICWKRAGFKPDGA 252

Query: 262 -----KAFYND--------PRVLYISLH---RFEMGKYYPGTINGRYDQTGEGKGEGFNC 305
                +  Y+D        P+V Y S+H    F     Y  + N R   T        N 
Sbjct: 253 TREENEEPYDDFGKRTAAFPKVGYFSMHDINSFPTESGYATSENIRNASTCIMDSHDLNI 312

Query: 306 NITWPVGGVGDAEYMLA---------------FEQIVMPMAREFQP--DLVIISSGFDAA 348
                     + ++M                 F+   + M ++  P   LV+IS+GFDA+
Sbjct: 313 WNVHLAPWATEEDFMKLYRSKYRTLFAKADEYFKTARLEMQKQGTPFKGLVVISAGFDAS 372

Query: 349 DGD-TIGQCH---VTPSCYGQMTHMLKSLA----RGNLCVALEGGYNLDAI 391
           + + T  Q H   V    Y   T  +  LA    +G +   +EGGY+  AI
Sbjct: 373 EFEQTSMQRHSVNVPTEFYTLFTKDVLKLAQMHTQGKVLSVMEGGYSDKAI 423

>CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highly
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116w HOS3
          Length = 678

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 81/323 (25%), Positives = 131/323 (40%), Gaps = 67/323 (20%)

Query: 139 ILEVHSKE----NLEFVERS-SRMKREEL-LKETEKGDSVYFNNDSYVSAKLSCGGVIDA 192
           +L+VH  E     L+  ++S S++ R E+ + +      +Y  + +  + + + G V   
Sbjct: 106 VLKVHGSEWPRTLLQLCKQSDSKLARGEVEVPDNWNAGDIYLTSRTIEALQGTIGAVETG 165

Query: 193 CKAVVEG----RVKNALAV-VRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRI 247
             ++  G     + N + V +RPPGHH     P GFCL +N  +  +    +Y   V   
Sbjct: 166 VDSIFSGPSLEHISNRVFVAIRPPGHHCHYATPSGFCLLNNAHIGIEYAADKY--GVTHA 223

Query: 248 LILDWDIHHGNGTQ------------------------KAFYNDPRVLYISLH---RFEM 280
           +ILD+D+HHG+GTQ                        K F   P+V Y S+H    F  
Sbjct: 224 VILDFDLHHGDGTQDLCWKRAGFKPDEHTEEDGYDEFGKKFAEFPKVGYFSMHDINSFPT 283

Query: 281 GKYYPGTINGRYDQTGEGKGEGFNC-NI---TWPV----GGVGDAEYMLAFEQI------ 326
              +    N +   T        N  N+    W        +  ++Y   F +       
Sbjct: 284 ESGFATKENIKNASTCIMNSHDLNIWNVHLSRWSTEEEFAKIYKSKYRTLFAKADEFFKN 343

Query: 327 ----VMPMAREFQPDLVIISSGFDAADGD-TIGQCH---VTPSCYGQMTHMLKSLA---- 374
               +  + + F+  LV+IS+GFDA++ + T  Q H   V  S Y   T     LA    
Sbjct: 344 SKNEMNELGKPFK-GLVVISAGFDASEFEQTSMQRHSVNVPTSFYTMFTKDALKLAQMHC 402

Query: 375 RGNLCVALEGGYNLDAIAISALS 397
           +G +   LEGGY+  AI     S
Sbjct: 403 QGKVLSLLEGGYSDKAITSGVFS 425

>Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL339W
          Length = 445

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 57/234 (24%), Positives = 99/234 (42%), Gaps = 28/234 (11%)

Query: 213 HHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGTQKAFYNDPRVLY 272
           HHA      GFC  +++ +  Q + K       R+  +D+D+HHG+  + AF     V  
Sbjct: 195 HHAFKSRASGFCYINDIVLLIQELRKN---GYSRVSYVDFDLHHGDAVESAFQYSRNVQT 251

Query: 273 ISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVG-----GVGDAEYMLAFEQIV 327
            SLH FE G ++PGT            G   NC  T  V      G+ D       + I+
Sbjct: 252 CSLHLFEAG-FFPGT------------GSFKNCRETNVVNIPLFHGLDDESLDEIVDNIL 298

Query: 328 MPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHMLKSL---ARGNLCVALEG 384
           +P   +  P++++I  G D   GD   +  +T   +G   ++LK +   +   + +   G
Sbjct: 299 IPCVNKHDPEVLVIQCGADGLSGDKYKEWQLT--IHGLTRNILKLVDIHSYKKVVLLGGG 356

Query: 385 GYN--LDAIAISALSVAKVLIGEPPDELPDPTKDPKLEAIEMIDTVIHTQSKYW 436
           GYN  L +   + ++V  +   +    L   ++D  +    +ID       K+W
Sbjct: 357 GYNPTLQSRFYTYVTVCLLKYHKGIPSLISDSEDEHIIEHHLIDFYRKEAYKFW 410

>NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.607
           YPL116W
          Length = 700

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 83/319 (26%), Positives = 123/319 (38%), Gaps = 69/319 (21%)

Query: 139 ILEVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYVSAKL--SCGGVIDACKAV 196
           + +VH KE  + V +  +   E+L K   +    +   D Y+S+K   +  G I A +  
Sbjct: 108 VYKVHGKEWPKEVIQLCKEADEKLAKGEIEVPESWNAGDIYLSSKTIQALQGTIGALETG 167

Query: 197 VEGRVK---------NALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRI 247
           V+   K          A   +RPPGHH     P GFCL +N  VA +     Y   V  +
Sbjct: 168 VDSIFKGPSADHISNRAFVAIRPPGHHCHFATPSGFCLLNNAHVAIEYAADTY--GVTHV 225

Query: 248 LILDWDIHHGNGTQ--------------------------KAFYNDPRVLYISLH---RF 278
            +LD+D+HHG+GTQ                          K F   P+V Y S+H    F
Sbjct: 226 AVLDFDLHHGDGTQDLCWKRAGFKPDEDINPKEGEYDDFGKKFAEFPKVGYFSMHDINSF 285

Query: 279 EMGKYYPGTINGRYDQTGEGKGEGFNC-NI-----------------TWPVGGVGDAEYM 320
                +    N +   T        N  NI                  + V      EY 
Sbjct: 286 PTESGFATKENIKNASTCLMNSHDLNIWNIHMSNWNNEEEFVKLYRSKYRVLFAKADEYF 345

Query: 321 LAFEQIVMPMAREFQPDLVIISSGFDAADGD-TIGQCH---VTPSCYGQMTHMLKSLA-- 374
              +  +  + R F+  +V+IS+GFDA++ + T  Q H   V    Y   T     LA  
Sbjct: 346 KTAKLEMAALGRPFK-GMVLISAGFDASEFEQTTMQRHGSNVPTEFYTMFTKDALKLAQM 404

Query: 375 --RGNLCVALEGGYNLDAI 391
             +G +   +EGGY+  AI
Sbjct: 405 HCQGKVLSLMEGGYSDKAI 423

>Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {ON}
           YPL116W (HOS3) - sequence similar to the histone
           deacetylase Hda1p [contig 61] FULL
          Length = 708

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 79/321 (24%), Positives = 129/321 (40%), Gaps = 71/321 (22%)

Query: 137 EEILEVHS----KENLEFVERSSR-MKREEL-LKETEKGDSVYFNNDSYVSAKLSCGGVI 190
           + +L+VH      E L+  ++S + + R E+ + E+     +Y +  +  + + S G + 
Sbjct: 109 DHVLKVHGADWPHELLKLCQQSQKALDRGEVEVPESWNVGDIYLSQQTIGALEGSIGALE 168

Query: 191 DACKAVVEGRV-----KNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVR 245
               ++  G         A   +RPPGHH+    P GFCL +N  +A +     Y  +V 
Sbjct: 169 TGIDSIFAGPTPEETSNRAFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--NVT 226

Query: 246 RILILDWDIHHGNGTQ------------------------KAFYNDPRVLYISLHRF--- 278
             ++LD+D+HHG+GTQ                        K F   P+V Y S+H     
Sbjct: 227 HAVVLDFDLHHGDGTQDICWKRAGFKPDECADSGEFDEFGKKFAEYPKVGYFSVHDINSF 286

Query: 279 --EMGKYYPGTINGRYDQTGEGKGEGFNC-NITWPVGGVGDA-----------------E 318
             E+G  Y    N R   T        N  N+        +A                 E
Sbjct: 287 PTELG--YATKENIRNAATCIMDAHDVNIWNVHLQPYDSEEAFTKLYQTKYRTLFAKADE 344

Query: 319 YMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIG-QCH---VTPSCYGQMTHMLKSLA 374
           +    +Q +  + + F+  LV+IS+GFDA++ +    Q H   V    Y   T     LA
Sbjct: 345 FFRISKQTMKALGKPFK-GLVVISAGFDASEYEQPSMQRHAVNVPTFFYNTFTKDALKLA 403

Query: 375 R----GNLCVALEGGYNLDAI 391
           +    G +   +EGGY+  AI
Sbjct: 404 QMHSHGKVLSVMEGGYSDGAI 424

>Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116W
           (REAL)
          Length = 697

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 72/295 (24%), Positives = 116/295 (39%), Gaps = 59/295 (20%)

Query: 154 SSRMKREELLKETEKGDSVYFNNDSYVSAKLSCGGVIDACKAVVEG----RVKN-ALAVV 208
           S  +K E  + +T     +Y ++ +  + + + G +     ++ +G     + N A   +
Sbjct: 131 SKLLKGEIEVPDTWNSGDIYLSSKTIKALQGTIGAIETGVDSIFKGPSPEHISNRAFVAI 190

Query: 209 RPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGTQ------- 261
           RPPGHH     P GFCL +N  VA +     Y  +V  +++LD+D+HHG+GTQ       
Sbjct: 191 RPPGHHCHYATPSGFCLLNNAHVAIEYAHDAY--NVTHVVVLDFDLHHGDGTQDICWKRA 248

Query: 262 -----------------KAFYNDPRVLYISLH---RFEMGKYYPGTINGRYDQTGEGKGE 301
                            K F   P+V Y S+H    F     +    N +   T      
Sbjct: 249 GFKPEEEAKDTSYDDFGKKFAEFPKVGYFSMHDINSFPTESGFATKENIKNASTCIMNSH 308

Query: 302 GFNCNITWPVGGVGDAEYMLAFE---QIVMPMAREFQPD--------------LVIISSG 344
             N           + E+ + +    + +   A EF                 LV+IS+G
Sbjct: 309 DLNIWNVHLSKWTTEEEFNILYRTKYRTLFAKADEFFKSAKVEMKQQGKSFEGLVVISAG 368

Query: 345 FDAADGD-TIGQCH---VTPSCYGQMTHMLKSLAR----GNLCVALEGGYNLDAI 391
           FDA++ + T  Q H   V    Y   T     LA+    G +   +EGGY+  AI
Sbjct: 369 FDASEFEQTSMQRHSVNVPTYFYTTFTKDALKLAQMHCHGKVLSLMEGGYSDKAI 423

>NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.607
           YPL116W
          Length = 684

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 72/283 (25%), Positives = 114/283 (40%), Gaps = 63/283 (22%)

Query: 169 GDSVYFNNDSYVSAKLSCGGVIDACKAVVEG----RVKN-ALAVVRPPGHHAEPEAPGGF 223
           GD +Y ++ +  + + S G +  A  ++ +G     + N A   +RPPGHH     P GF
Sbjct: 145 GD-IYLSSKTVQALQGSIGALETAVDSIFKGPSPEHISNRAFVAIRPPGHHCHFATPSGF 203

Query: 224 CLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGTQ---------------------- 261
           C+ +N  VA +     Y   V  + +LD+D+HHG+GTQ                      
Sbjct: 204 CVLNNAHVAIEYAADSY--DVTHVAVLDFDLHHGDGTQDICWKRAGFKPDEETKENEEYD 261

Query: 262 ---KAFYNDPRVLYISLH---RFEMGKYYPGTINGRYDQTGEGKGEGFNC-NI---TWP- 310
              K     PRV Y S+H    F     +    N +   T        N  NI   +W  
Sbjct: 262 GFGKKLAEFPRVGYFSMHDINSFPTESGFATKENIKNASTCIMNSHDLNIWNIHLSSWSN 321

Query: 311 ---VGGVGDAEYMLAFEQI----------VMPMAREFQPDLVIISSGFDAADGD-TIGQC 356
                 +  ++Y L F +           +  M + F+  L+++S+GFDA++ +    Q 
Sbjct: 322 EEEFSKLYRSKYRLLFAKADEFFKTAKSEMADMGKPFK-GLILLSAGFDASEFEQKTMQR 380

Query: 357 H---VTPSCYGQMTHMLKSLA----RGNLCVALEGGYNLDAIA 392
           H   V    Y   T     LA    +G +   +EGGY+  AI 
Sbjct: 381 HSVNVPTEFYTMFTKDALKLAQMHCQGKVLSLMEGGYSDKAIT 423

>TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {ON}
           Anc_3.362 YPR068C
          Length = 494

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 74/272 (27%), Positives = 116/272 (42%), Gaps = 40/272 (14%)

Query: 213 HHAEPEAPGGFCLFSNVAVAAQNILKQYPESV---RRILILDWDIHHGNGTQKAFYNDPR 269
           HHA      GFC  +++ V+  N L++ P      R++  +D D+HHG+G + AF     
Sbjct: 206 HHAMKSRANGFCYINDI-VSLINELRKTPGQQGHKRKLTYIDLDLHHGDGVENAFNYSKD 264

Query: 270 VLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVG-GVGDAEYMLAFEQIVM 328
           +  IS+H FE G +YP T   ++     GK +  N  I  PV  G+ ++        I++
Sbjct: 265 IQIISIHLFEPG-FYPCTGGLKF-----GKPKSNNI-INLPVKHGLSNSNMFELVTNIII 317

Query: 329 PMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHMLKSLAR----------GNL 378
           P+    Q D ++I  G D  + D   +  +T    G    ++K +A            N+
Sbjct: 318 PLIELHQSDDIVILCGGDGLNNDYYNEWQLT--IIGLTRCIIKIIAAFVGPHQPGSCKNV 375

Query: 379 CVALEGGYN-LDAIAISALSVAKV--LIGEPP-------DELPDPTKDPKLEAI-----E 423
            +   GGYN L A         KV  L G  P        E+P  T D K + +     E
Sbjct: 376 VLLGGGGYNELLASRFYTYLTYKVLQLAGRIPPAATTLAAEVPHGTIDDKDKELLIKDHE 435

Query: 424 MIDTVIHTQSKYWKCFQRKFGNAGCNFSEPVT 455
            ID       KYW C++ + G  G +F   + 
Sbjct: 436 HIDEYEKEYYKYW-CYEIENGLDGLSFKRQIN 466

>SAKL0F12232g Chr6 complement(952576..954450) [1875 bp, 624 aa] {ON}
           similar to uniprot|P34225 Saccharomyces cerevisiae
           YBL060W Hypothetical ORF
          Length = 624

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 5/52 (9%)

Query: 662 HPCWADNESKKPRKKFGRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDS 713
           H   + + +K+PRK      R      NS+ +  F E TDF+LD+   W +S
Sbjct: 329 HASHSTSNTKQPRKTLFSWFRK-----NSSKDSLFNERTDFVLDMGSNWFNS 375

>Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {ON}
            YML081W - Hypothetical ORF [contig 376] FULL
          Length = 1178

 Score = 31.6 bits (70), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 66/162 (40%), Gaps = 27/162 (16%)

Query: 578  QEVLLYIWDNYIKYFPSLAKVAFVGFGDAYAGI---VHLLGHRDTRATVKAVVSFIGRKQ 634
            +  L+Y+ + Y ++F    KV+F         I   + + GH     T   ++    R  
Sbjct: 845  KSCLIYLTNGY-QFFYDNKKVSFKTLLSLLISIHEKIFIEGHHLRHETNDHILDVKWRMN 903

Query: 635  LKPLVPLVDESLSDWYFKNS--LIFTDKNHPCWADNESKK---PRKKFGRVLRC------ 683
             +P++  + ++    Y KN   +I  + N      N S +   P   F ++ +C      
Sbjct: 904  SRPIIESLLKNWEALYIKNGGVIIANEGNIAFINSNPSLRLIIPLLNFAKIRKCLMLTEV 963

Query: 684  -------DTDGLNSNME-----ERFEEATDFILDLFEEWSDS 713
                   D +G+N  +E     E   EATD+ L++ + W D+
Sbjct: 964  MKNIWFKDWEGMNECLEKYRDWESLREATDYALNIVKFWLDT 1005

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 79,809,365
Number of extensions: 3634915
Number of successful extensions: 9715
Number of sequences better than 10.0: 108
Number of HSP's gapped: 9779
Number of HSP's successfully gapped: 113
Length of query: 714
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 597
Effective length of database: 40,065,477
Effective search space: 23919089769
Effective search space used: 23919089769
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)