Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0G021502.284ON66166131770.0
SAKL0E07722g2.284ON79148114660.0
ZYRO0A01848g2.284ON70461914480.0
KLTH0G10318g2.284ON79047914440.0
Suva_9.1042.284ON80548214350.0
KAFR0H033302.284ON36934113800.0
Kwal_27.115422.284ON79148214190.0
KLLA0E08405g2.284ON77749714160.0
YIL095W (PRK1)2.284ON81039114080.0
Smik_9.842.284ON80833814050.0
Skud_9.782.284ON80948214040.0
NCAS0G038102.284ON66134313910.0
NCAS0B062602.284ON72331813940.0
KAFR0J013702.284ON78034713900.0
Ecym_33232.284ON74847013780.0
NDAI0G006402.284ON62134713511e-179
NDAI0B035602.284ON75638013591e-178
TPHA0C033802.284ON69732113501e-178
CAGL0G02607g2.284ON68832313421e-177
Kpol_1003.352.284ON71331513391e-176
YNL020C (ARK1)2.284ON63831413131e-173
Skud_14.3092.284ON63934613081e-172
Smik_14.3112.284ON63742212941e-170
TBLA0B059302.284ON71732312971e-170
Suva_14.3272.284ON63233212831e-169
ADL217W2.284ON75047612711e-165
KNAG0H020202.284ON59232312521e-165
Kpol_1039.332.284ON70131612451e-162
KNAG0A054302.284ON78832011791e-151
TBLA0B069402.284ON144333312211e-151
CAGL0J03432g2.284ON62231111601e-150
TPHA0D015402.284ON70733610671e-135
KAFR0A010403.273ON9123238152e-96
KNAG0J008203.273ON10914528092e-94
SAKL0D03234g3.273ON8583157861e-92
Kpol_1052.223.273ON11013917901e-91
CAGL0H10208g3.273ON10273697834e-91
Kpol_251.43.273ON8383357718e-91
TBLA0E025903.273ON10613257802e-90
KNAG0H012203.273ON9133307713e-90
ZYRO0E06864g3.273ON11153277804e-90
NCAS0A105903.273ON10953207723e-89
KLLA0F18612g3.273ON8143227585e-89
KAFR0C004303.273ON9493467646e-89
KLTH0C07260g3.273ON9013167557e-88
NDAI0A057003.273ON11573237657e-88
TPHA0A040303.273ON10543577564e-87
Ecym_26503.273ON8943077477e-87
Smik_2.1913.273ON11083197568e-87
Kwal_27.109453.273ON9353107489e-87
TDEL0D035203.273ON10493167521e-86
Suva_4.2973.273ON11073197532e-86
Skud_2.1793.273ON10903197487e-86
TPHA0M011203.273ON7883387347e-86
YBR059C (AKL1)3.273ON11083197471e-85
CAGL0K11990g3.273ON9913757361e-84
AGR027C3.273ON9613077323e-84
TBLA0I019303.273ON13613167134e-80
Kwal_56.242746.262ON3463422422e-21
YPL236C (ENV7)6.262ON3643182343e-20
SAKL0H06754g8.668ON8842102414e-20
Suva_16.706.262ON3643392334e-20
KNAG0F001701.24ON5432052375e-20
KAFR0A050906.31ON6682462386e-20
Skud_16.426.262ON3643332316e-20
TDEL0A067506.262ON3723012291e-19
Kpol_2002.241.24ON4872662322e-19
NCAS0C016708.668ON8962092324e-19
KNAG0E008506.31ON7112822281e-18
KLTH0H03080g6.262ON3463322201e-18
Smik_13.1596.31ON7052762271e-18
NDAI0C026806.31ON7502762271e-18
KNAG0D048107.86ON14401832272e-18
Kpol_1037.206.31ON7042852252e-18
Suva_16.1608.668ON9182082253e-18
CAGL0M02299g8.668ON8932082253e-18
KLTH0D11044g8.668ON8492092253e-18
KAFR0G012001.24ON5072672223e-18
ACL006W6.31ON7082922234e-18
Kpol_1023.266.31ON7392742234e-18
Skud_13.1546.31ON7052762234e-18
TDEL0G043806.31ON7222852234e-18
Smik_6.4416.262ON3643332174e-18
YMR001C (CDC5)6.31ON7052762225e-18
Ecym_30356.31ON7402922225e-18
CAGL0K08514g2.479ON14891972236e-18
NDAI0F045201.24ON4891962197e-18
ABL034W2.479ON14252192228e-18
Suva_13.1636.31ON7052762209e-18
KLLA0F11319g8.668ON8431962219e-18
NCAS0A002801.24ON5352832181e-17
NCAS0D021006.31ON7262852191e-17
KLLA0E03587g5.591ON6472802191e-17
Kwal_26.87518.668ON8482092191e-17
ACR133C8.668ON8512002182e-17
ZYRO0D05500g7.86ON12622332192e-17
Smik_10.1471.271ON14782952192e-17
Kpol_1072.198.668ON8962032182e-17
KLLA0C06138g6.31ON7082772172e-17
TBLA0A047207.86ON12622342182e-17
TPHA0J004206.31ON7072762172e-17
KAFR0G026906.31ON7132762162e-17
ZYRO0C06776g5.591ON8903482173e-17
Skud_10.1191.271ON14812612164e-17
TDEL0C067801.24ON4682782125e-17
KLTH0G05214g5.591ON6532822135e-17
TDEL0H036407.86ON12371842156e-17
SAKL0A03344g6.262ON3643542086e-17
Kwal_26.73551.271ON14462362146e-17
Suva_6.1691.271ON14842612147e-17
YPL150W8.668ON9012082147e-17
KLTH0F16676g5.406ON8782702137e-17
Kpol_1065.36.222ON3762702088e-17
KLLA0F07623g7.86ON12292362138e-17
CAGL0F00913g7.86ON12061832139e-17
TPHA0F024306.31ON7982732121e-16
Skud_16.1328.668ON9242082121e-16
NCAS0C041008.141ON9053332121e-16
KLTH0C10912g6.31ON6972852111e-16
Kwal_56.224766.31ON6972762111e-16
CAGL0J11638g6.31ON7462762111e-16
KNAG0F002901.52ON11253002111e-16
YJL095W (BCK1)1.271ON14782612112e-16
Skud_15.1127.86ON11012342102e-16
NDAI0H024707.86ON14111832102e-16
KNAG0B053502.496ON8362772092e-16
Smik_6.3478.668ON9172082092e-16
ZYRO0C07480g6.31ON7742852092e-16
ACR281C7.86ON12591832092e-16
KNAG0F029006.31ON6492572082e-16
NDAI0K021002.496ON9092352092e-16
SAKL0E01584g6.31ON6952822083e-16
Ecym_21536.262ON3633002033e-16
TPHA0E038501.24ON4821972063e-16
ZYRO0E07876g6.262ON3692962033e-16
KAFR0C014403.92ON10952432083e-16
Smik_15.1227.86ON11011832083e-16
TBLA0B082503.92ON13472172083e-16
KLLA0F14190g1.271ON13382532083e-16
CAGL0I07513g3.92ON10762482084e-16
TPHA0G032002.479ON15342002084e-16
TPHA0G016308.668ON8712032065e-16
KAFR0D012207.86ON10551982075e-16
ZYRO0F18062g1.24ON4712682035e-16
SAKL0C01716g1.52ON12152322066e-16
KLLA0C12485g3.92ON9252852057e-16
KLLA0C01650g1.52ON11122972057e-16
Kwal_26.77882.479ON12671992057e-16
KLTH0D06006g2.496ON9542942049e-16
ZYRO0F07194g8.668ON9382072049e-16
NCAS0F015807.86ON13822352059e-16
Kwal_26.71547.86ON12131802041e-15
TBLA0E022907.86ON13001832041e-15
KLTH0D05566g2.479ON11281992031e-15
TPHA0H026307.86ON13671832041e-15
CAGL0M11396g8.279ON11922142031e-15
YDR523C (SPS1)1.24ON4902002001e-15
Kpol_431.92.479ON15521992031e-15
AFR092W1.271ON14232602031e-15
CAGL0K02673g2.496ON9152612031e-15
TBLA0B004906.31ON7872762021e-15
Ecym_26407.86ON13251772031e-15
Kpol_463.81.271ON14472372032e-15
CAGL0L03520g1.271ON14472842032e-15
Ecym_73922.479ON14342012032e-15
Kpol_1040.207.86ON12971832022e-15
KAFR0D033902.496ON7982812012e-15
TDEL0A027202.496ON9152372012e-15
Ecym_10301.24ON4402761982e-15
KLLA0C18568g6.371ON7742082012e-15
Kwal_26.78612.496ON9552742012e-15
KLTH0F00946g1.24ON5121951992e-15
KLTH0C09548g3.92ON9931962012e-15
KLTH0D03454g1.271ON14332362012e-15
ZYRO0B06512g3.92ON11112832012e-15
SAKL0B09856g7.86ON12741832012e-15
Kwal_47.183075.591ON6212731993e-15
YOL045W (PSK2)7.86ON11011832003e-15
Skud_4.7971.24ON4851961983e-15
KAFR0K007007.86ON13811972013e-15
TBLA0A071501.52ON13912962013e-15
CAGL0H06259g7.86ON13361972013e-15
KNAG0A065402.479ON14321982013e-15
Skud_3.1656.371ON7161951993e-15
Skud_15.543.92ON10822932003e-15
KLLA0C08525g6.341ON15512982013e-15
Suva_15.653.92ON10802272003e-15
TBLA0I011502.479ON17452002003e-15
ZYRO0B01166g2.496ON9632821993e-15
TBLA0A074601.24ON5161871973e-15
KLTH0D02486g7.86ON12231832003e-15
TDEL0A025502.479ON13691992003e-15
NDAI0E023908.668ON8832081994e-15
CAGL0L11550g5.406ON10722021994e-15
Kwal_33.131121.24ON5052661974e-15
KNAG0J016708.668ON10092001994e-15
NCAS0B044906.222ON3491941934e-15
Suva_2.7031.24ON4851961964e-15
Smik_15.573.92ON10812301994e-15
Kpol_1044.37.86ON9321821985e-15
TBLA0D022308.141ON11543061995e-15
KLLA0F13552g2.479ON12672011995e-15
TDEL0A061408.668ON8612901985e-15
Smik_4.8031.24ON4902001955e-15
SAKL0H07084g8.654ON9192081985e-15
KAFR0D032002.479ON14481971986e-15
KAFR0B028008.279ON10952101986e-15
TPHA0G032902.496ON9732921976e-15
YOL100W (PKH2)3.92ON10812301986e-15
Suva_15.2975.406ON10741941986e-15
KLLA0E21693g5.406ON10162251977e-15
Skud_8.1635.406ON10762291977e-15
AFR335C3.92ON10331911968e-15
Suva_11.1232.479ON15262001978e-15
Ecym_60406.371ON8962091969e-15
NCAS0A094701.271ON15152371979e-15
Kwal_56.226933.92ON9841901969e-15
Smik_1.793.177ON9742681969e-15
NDAI0G054701.271ON15552401961e-14
TBLA0B038608.668ON9882091951e-14
KNAG0D002106.371ON8332121951e-14
NCAS0B086001.52ON11172321951e-14
KAFR0C047806.371ON7862321951e-14
SAKL0H16632g8.279ON10622181951e-14
KAFR0A017602.496ON8852741951e-14
Kwal_55.215455.406ON8652021941e-14
SAKL0A04246g6.222ON4002051911e-14
Ecym_24058.668ON8552011941e-14
YAR019C (CDC15)3.177ON9742681941e-14
KAFR0A014201.271ON13982401951e-14
ZYRO0G03366g2.479ON16161991951e-14
NDAI0D027502.479ON15151971951e-14
Kpol_1031.105.406ON11271971941e-14
Smik_8.1805.406ON10732291941e-14
Skud_11.1262.479ON15181991942e-14
TDEL0D053203.92ON10572281932e-14
NDAI0G042903.92ON11132261942e-14
AFR724C1.24ON4402751902e-14
Kpol_1054.23.92ON10962551932e-14
Ecym_83398.654ON9202081932e-14
KNAG0A030408.654ON6442901922e-14
NCAS0C049403.92ON11162191932e-14
YKL101W (HSL1)2.479ON15182191932e-14
TDEL0C064901.52ON11532321932e-14
Skud_1.723.177ON9742661922e-14
KNAG0B017801.271ON15802611932e-14
SAKL0C00946g1.24ON5642481912e-14
AFR696C1.52ON11422321922e-14
ZYRO0D06776g8.279ON12042141932e-14
TPHA0H016305.406ON10362051923e-14
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0G02150
         (661 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...  1228   0.0  
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...   569   0.0  
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...   562   0.0  
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...   560   0.0  
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...   557   0.0  
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...   536   0.0  
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...   551   0.0  
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...   550   0.0  
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...   546   0.0  
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...   545   0.0  
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...   545   0.0  
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...   540   0.0  
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...   541   0.0  
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...   540   0.0  
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...   535   0.0  
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284    525   e-179
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...   528   e-178
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...   524   e-178
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...   521   e-177
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....   520   e-176
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...   510   e-173
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...   508   e-172
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...   503   e-170
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...   504   e-170
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...   498   e-169
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...   494   e-165
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...   486   e-165
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...   484   e-162
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...   458   e-151
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...   474   e-151
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...   451   e-150
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...   415   e-135
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...   318   2e-96
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...   316   2e-94
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...   307   1e-92
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...   308   1e-91
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...   306   4e-91
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...   301   8e-91
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...   305   2e-90
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...   301   3e-90
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...   305   4e-90
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...   301   3e-89
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...   296   5e-89
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...   298   6e-89
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...   295   7e-88
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...   299   7e-88
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....   295   4e-87
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...   292   7e-87
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...   295   8e-87
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...   292   9e-87
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....   294   1e-86
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...   294   2e-86
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...   292   7e-86
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...   287   7e-86
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...   292   1e-85
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...   288   1e-84
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...   286   3e-84
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...   279   4e-80
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    98   2e-21
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    95   3e-20
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    97   4e-20
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    94   4e-20
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    96   5e-20
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             96   6e-20
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    94   6e-20
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    93   1e-19
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    94   2e-19
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    94   4e-19
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    92   1e-18
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    89   1e-18
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    92   1e-18
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    92   1e-18
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    92   2e-18
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    91   2e-18
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    91   3e-18
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    91   3e-18
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    91   3e-18
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    90   3e-18
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    91   4e-18
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    91   4e-18
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    91   4e-18
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    91   4e-18
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    88   4e-18
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    90   5e-18
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    90   5e-18
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    91   6e-18
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    89   7e-18
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    90   8e-18
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    89   9e-18
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    90   9e-18
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        89   1e-17
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      89   1e-17
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    89   1e-17
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    89   1e-17
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    89   2e-17
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    89   2e-17
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    89   2e-17
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    89   2e-17
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    88   2e-17
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    89   2e-17
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    88   2e-17
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    88   2e-17
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    88   3e-17
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    88   4e-17
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    86   5e-17
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    87   5e-17
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    87   6e-17
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    85   6e-17
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    87   6e-17
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    87   7e-17
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    87   7e-17
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    87   7e-17
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    85   8e-17
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    87   8e-17
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    87   9e-17
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    86   1e-16
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    86   1e-16
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     86   1e-16
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    86   1e-16
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    86   1e-16
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    86   1e-16
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    86   1e-16
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    86   2e-16
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    86   2e-16
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    86   2e-16
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    85   2e-16
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    85   2e-16
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    85   2e-16
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    85   2e-16
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               85   2e-16
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    85   2e-16
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    85   3e-16
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    83   3e-16
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    84   3e-16
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    83   3e-16
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    85   3e-16
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    85   3e-16
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    85   3e-16
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    85   3e-16
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    85   4e-16
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    85   4e-16
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    84   5e-16
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    84   5e-16
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    83   5e-16
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    84   6e-16
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    84   7e-16
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    84   7e-16
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    84   7e-16
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    83   9e-16
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    83   9e-16
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    84   9e-16
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    83   1e-15
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    83   1e-15
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    83   1e-15
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    83   1e-15
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    83   1e-15
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    82   1e-15
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    83   1e-15
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    83   1e-15
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    83   1e-15
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    82   1e-15
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    83   1e-15
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    83   2e-15
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    83   2e-15
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    83   2e-15
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    82   2e-15
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    82   2e-15
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    82   2e-15
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    81   2e-15
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    82   2e-15
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    82   2e-15
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    81   2e-15
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    82   2e-15
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    82   2e-15
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    82   2e-15
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    82   2e-15
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    81   3e-15
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    82   3e-15
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    81   3e-15
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    82   3e-15
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    82   3e-15
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    82   3e-15
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    82   3e-15
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    81   3e-15
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    82   3e-15
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    82   3e-15
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    82   3e-15
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    82   3e-15
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    81   3e-15
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    80   3e-15
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    82   3e-15
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    82   3e-15
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    81   4e-15
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    81   4e-15
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    80   4e-15
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    81   4e-15
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     79   4e-15
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    80   4e-15
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    81   4e-15
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    81   5e-15
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    81   5e-15
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    81   5e-15
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    81   5e-15
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    80   5e-15
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    81   5e-15
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    81   6e-15
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    81   6e-15
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    80   6e-15
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    81   6e-15
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    81   6e-15
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    80   7e-15
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...    80   7e-15
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    80   8e-15
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    80   8e-15
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    80   9e-15
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    80   9e-15
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    80   9e-15
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    80   9e-15
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    80   1e-14
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    80   1e-14
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    80   1e-14
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    80   1e-14
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    80   1e-14
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    80   1e-14
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    80   1e-14
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    79   1e-14
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    78   1e-14
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    79   1e-14
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    79   1e-14
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    80   1e-14
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    80   1e-14
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    80   1e-14
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    79   1e-14
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    79   1e-14
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    79   2e-14
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    79   2e-14
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    79   2e-14
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    78   2e-14
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    79   2e-14
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    79   2e-14
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    79   2e-14
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    79   2e-14
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    79   2e-14
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    79   2e-14
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    79   2e-14
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    79   2e-14
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    78   2e-14
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    79   2e-14
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    79   2e-14
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    79   3e-14
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    79   3e-14
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    78   3e-14
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    79   3e-14
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    78   3e-14
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    78   3e-14
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     78   3e-14
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....    78   3e-14
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     78   4e-14
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    78   4e-14
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    78   4e-14
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    78   4e-14
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    78   4e-14
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    78   4e-14
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    78   4e-14
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    78   4e-14
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    78   4e-14
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    78   4e-14
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    78   4e-14
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    78   4e-14
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    78   4e-14
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    77   5e-14
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    78   5e-14
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    78   5e-14
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    77   5e-14
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    77   6e-14
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    78   6e-14
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    77   6e-14
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    77   6e-14
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    76   6e-14
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    77   6e-14
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    77   7e-14
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    77   7e-14
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    77   8e-14
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    77   8e-14
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              77   8e-14
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    77   8e-14
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    77   9e-14
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    77   9e-14
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    77   1e-13
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    77   1e-13
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    77   1e-13
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    77   1e-13
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       77   1e-13
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    77   1e-13
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    77   1e-13
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    76   1e-13
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    76   1e-13
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    76   1e-13
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    75   1e-13
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    76   1e-13
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    76   1e-13
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    77   1e-13
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    77   1e-13
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    76   1e-13
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    76   1e-13
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    75   1e-13
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    76   1e-13
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    76   1e-13
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    76   1e-13
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    76   1e-13
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    76   2e-13
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    75   2e-13
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    76   2e-13
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    76   2e-13
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    76   2e-13
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    76   2e-13
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    75   2e-13
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    76   2e-13
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    76   2e-13
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    76   2e-13
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    76   2e-13
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    75   2e-13
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    75   2e-13
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    75   2e-13
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              75   2e-13
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    75   3e-13
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    74   3e-13
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    75   3e-13
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    75   3e-13
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    74   3e-13
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    74   3e-13
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    75   3e-13
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    75   3e-13
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    75   3e-13
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    74   3e-13
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    75   3e-13
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    75   3e-13
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    75   3e-13
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...    75   3e-13
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    74   3e-13
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    75   3e-13
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    75   3e-13
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    75   3e-13
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    75   3e-13
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    74   3e-13
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    75   3e-13
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    75   3e-13
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    75   3e-13
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    75   3e-13
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    75   3e-13
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    75   4e-13
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    75   4e-13
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    75   4e-13
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    75   4e-13
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    75   4e-13
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    75   4e-13
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    75   4e-13
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    74   4e-13
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    75   4e-13
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    75   5e-13
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    74   5e-13
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    75   5e-13
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    74   5e-13
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     74   5e-13
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    74   6e-13
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    74   6e-13
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    74   6e-13
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    74   6e-13
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    74   6e-13
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    73   6e-13
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    73   7e-13
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    74   7e-13
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    74   7e-13
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    74   7e-13
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    74   7e-13
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    74   7e-13
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    74   7e-13
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    73   8e-13
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    74   8e-13
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    72   8e-13
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    73   8e-13
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    73   8e-13
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    74   9e-13
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    74   9e-13
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    73   9e-13
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    74   9e-13
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    73   1e-12
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    74   1e-12
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    73   1e-12
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    74   1e-12
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    73   1e-12
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    72   1e-12
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    73   1e-12
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    73   1e-12
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    73   1e-12
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    73   1e-12
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    73   1e-12
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    73   1e-12
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    72   2e-12
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    73   2e-12
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    72   2e-12
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    72   2e-12
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    72   2e-12
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    71   2e-12
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    72   2e-12
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    73   2e-12
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    72   2e-12
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    72   2e-12
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    72   2e-12
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    71   2e-12
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    72   2e-12
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    71   2e-12
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    72   2e-12
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    72   2e-12
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    72   2e-12
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    71   2e-12
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    72   2e-12
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    71   2e-12
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    71   3e-12
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    72   3e-12
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    72   3e-12
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    72   3e-12
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    71   3e-12
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    72   3e-12
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    71   3e-12
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    72   3e-12
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    72   3e-12
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    72   3e-12
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    71   3e-12
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    72   3e-12
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    72   3e-12
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    72   3e-12
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    72   3e-12
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    70   3e-12
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    72   3e-12
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    72   3e-12
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    70   4e-12
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    71   4e-12
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    72   4e-12
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    72   4e-12
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    71   4e-12
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    71   4e-12
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    71   4e-12
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    71   5e-12
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    71   5e-12
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    71   5e-12
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    71   5e-12
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    70   5e-12
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    70   5e-12
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    70   5e-12
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    70   5e-12
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    71   5e-12
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    71   6e-12
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    71   6e-12
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    71   6e-12
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    71   6e-12
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    71   6e-12
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    71   7e-12
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    70   7e-12
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               70   7e-12
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    69   7e-12
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    70   7e-12
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    71   7e-12
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    70   7e-12
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    70   7e-12
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    70   8e-12
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    70   8e-12
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     70   8e-12
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    71   8e-12
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    71   8e-12
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    70   8e-12
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    70   8e-12
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    70   8e-12
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    69   8e-12
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    70   9e-12
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    69   9e-12
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    70   9e-12
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    70   1e-11
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    70   1e-11
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    70   1e-11
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     70   1e-11
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    69   1e-11
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    70   1e-11
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    70   1e-11
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    69   1e-11
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               70   1e-11
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    70   1e-11
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    69   1e-11
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    69   1e-11
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    70   2e-11
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     69   2e-11
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    69   2e-11
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    68   2e-11
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    69   2e-11
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    68   2e-11
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    69   2e-11
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    69   2e-11
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    69   2e-11
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    68   2e-11
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    68   2e-11
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    69   2e-11
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    69   2e-11
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    69   2e-11
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    69   2e-11
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    69   2e-11
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    68   2e-11
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    69   3e-11
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    69   3e-11
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    69   3e-11
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    68   3e-11
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    68   3e-11
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    68   3e-11
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    68   3e-11
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    67   3e-11
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    69   3e-11
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    69   3e-11
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    67   4e-11
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    69   4e-11
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    69   4e-11
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    67   4e-11
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    67   4e-11
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    68   4e-11
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    67   4e-11
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    67   4e-11
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    68   4e-11
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    68   4e-11
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    68   4e-11
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    67   4e-11
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    68   4e-11
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    68   5e-11
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    68   5e-11
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    68   5e-11
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    68   5e-11
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    67   5e-11
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    67   5e-11
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    67   6e-11
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    68   6e-11
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    67   6e-11
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    68   6e-11
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    66   6e-11
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    67   6e-11
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    67   6e-11
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    67   7e-11
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    67   7e-11
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    67   7e-11
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    67   7e-11
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    67   7e-11
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    67   7e-11
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    66   8e-11
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    66   8e-11
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    67   8e-11
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    67   8e-11
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    67   8e-11
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    67   8e-11
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    67   9e-11
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    67   9e-11
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    67   9e-11
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    67   9e-11
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    67   1e-10
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       66   1e-10
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    67   1e-10
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    67   1e-10
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    66   1e-10
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    66   1e-10
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    67   1e-10
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    66   1e-10
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    67   1e-10
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    67   1e-10
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      67   1e-10
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    66   1e-10
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    65   1e-10
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    67   1e-10
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    67   1e-10
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    66   1e-10
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    66   1e-10
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    66   1e-10
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    66   2e-10
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    66   2e-10
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    66   2e-10
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    66   2e-10
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    66   2e-10
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    65   2e-10
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    65   2e-10
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    66   2e-10
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    66   2e-10
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    66   2e-10
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    66   2e-10
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    66   2e-10
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    66   2e-10
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    66   2e-10
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    65   2e-10
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    66   2e-10
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    66   2e-10
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    65   2e-10
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    65   2e-10
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    66   2e-10
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    65   2e-10
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     65   2e-10
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    65   2e-10
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    65   2e-10
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    65   3e-10
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    65   3e-10
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    66   3e-10
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    65   3e-10
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     65   3e-10
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    66   3e-10
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    65   3e-10
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    65   3e-10
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    64   3e-10
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    65   3e-10
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    65   3e-10
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    65   3e-10
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    65   3e-10
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    65   4e-10
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    64   4e-10
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    65   4e-10
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    65   4e-10
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    64   4e-10
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    65   4e-10
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    65   4e-10
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               65   4e-10
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    65   4e-10
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    65   4e-10
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    65   4e-10
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    65   4e-10
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    64   4e-10
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    64   4e-10
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    64   5e-10
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    64   5e-10
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    65   5e-10
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    65   5e-10
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    65   5e-10
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    65   5e-10
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    64   5e-10
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    65   5e-10
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    64   5e-10
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    64   5e-10
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    64   5e-10
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    65   5e-10
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    64   6e-10
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    64   6e-10
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    64   6e-10
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     64   7e-10
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    64   7e-10
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    64   7e-10
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    64   7e-10
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    64   8e-10
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    64   8e-10
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    64   8e-10
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    64   8e-10
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    64   8e-10
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    64   8e-10
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    64   8e-10
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    64   8e-10
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    64   8e-10
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    64   8e-10
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    64   9e-10
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    64   9e-10
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    64   9e-10
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    63   1e-09
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    64   1e-09
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    64   1e-09
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    63   1e-09
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    63   1e-09
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    64   1e-09
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    64   1e-09
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    64   1e-09
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     62   1e-09
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    63   1e-09
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    64   1e-09
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    63   1e-09
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    64   1e-09
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    64   1e-09
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    63   1e-09
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    63   1e-09
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    63   1e-09
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    64   1e-09
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    63   1e-09
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    64   1e-09
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    62   1e-09
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    63   1e-09
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              63   1e-09
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    63   1e-09
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    63   1e-09
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    63   1e-09
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    62   1e-09
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    63   1e-09
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    62   1e-09
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    63   2e-09
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    63   2e-09
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    63   2e-09
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    63   2e-09
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    62   2e-09
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    63   2e-09
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    62   2e-09
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    63   2e-09
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    63   2e-09
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    63   2e-09
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    62   2e-09
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    63   2e-09
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    63   2e-09
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    62   2e-09
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    62   2e-09
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    63   2e-09
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    62   2e-09
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    63   2e-09
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    63   2e-09
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    63   2e-09
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    63   2e-09
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    62   2e-09
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    62   2e-09
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    62   2e-09
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    62   2e-09
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    62   3e-09
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    62   3e-09
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    62   3e-09
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    62   3e-09
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    62   3e-09
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    62   3e-09
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    62   3e-09
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    62   3e-09
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    62   3e-09
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     61   3e-09
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    62   3e-09
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    62   3e-09
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    62   3e-09
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    62   3e-09
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    62   3e-09
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    62   4e-09
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    62   4e-09
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    62   4e-09
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    61   4e-09
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    62   4e-09
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    61   4e-09
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    62   4e-09
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    62   4e-09
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    62   4e-09
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    61   4e-09
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    61   5e-09
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    61   5e-09
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    61   5e-09
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    61   5e-09
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    61   5e-09
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    62   5e-09
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    61   5e-09
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               62   5e-09
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    61   5e-09
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    60   5e-09
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    61   5e-09
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    61   5e-09
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    61   5e-09
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    61   5e-09
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    61   5e-09
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    61   6e-09
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    61   6e-09
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    60   6e-09
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    61   6e-09
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    61   6e-09
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    61   6e-09
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    60   7e-09
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    61   7e-09
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    60   7e-09
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    60   7e-09
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    60   7e-09
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    61   7e-09
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    61   7e-09
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    61   7e-09
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    61   8e-09
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    61   8e-09
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               60   8e-09
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    60   8e-09
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    60   8e-09
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    61   8e-09
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    60   8e-09
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    60   9e-09
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    60   9e-09
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    60   9e-09
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    60   9e-09
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    61   9e-09
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    60   9e-09
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    61   9e-09
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    61   9e-09
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    60   9e-09
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    60   9e-09
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     60   1e-08
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    60   1e-08
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    60   1e-08
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    60   1e-08
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    60   1e-08
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    60   1e-08
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    60   1e-08
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    60   1e-08
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    60   1e-08
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    60   1e-08
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    60   1e-08
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    60   1e-08
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    59   1e-08
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    60   1e-08
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    60   1e-08
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    60   1e-08
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    59   1e-08
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    59   1e-08
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    60   1e-08
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    59   1e-08
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    60   2e-08
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    60   2e-08
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    60   2e-08
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    60   2e-08
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    60   2e-08
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    60   2e-08
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    59   2e-08
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    60   2e-08
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    59   2e-08
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    60   2e-08
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    60   2e-08
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    60   2e-08
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    59   2e-08
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    59   2e-08
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    60   2e-08
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    59   2e-08
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    59   2e-08
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              59   2e-08
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    59   2e-08
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    59   2e-08
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    60   2e-08
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    59   2e-08
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    60   2e-08
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    60   2e-08
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    59   2e-08
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    59   2e-08
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    59   2e-08
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    59   2e-08
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    59   2e-08
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               58   2e-08
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    59   2e-08
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    59   3e-08
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    59   3e-08
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    58   3e-08
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    59   3e-08
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    59   3e-08
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    59   3e-08
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    58   3e-08
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    58   3e-08
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    59   3e-08
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    58   3e-08
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    59   3e-08
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    58   3e-08
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    58   3e-08
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    59   3e-08
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    59   3e-08
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    59   3e-08
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    59   4e-08
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    59   4e-08
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    58   4e-08
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    58   4e-08
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    59   4e-08
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    58   4e-08
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    59   4e-08
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    58   4e-08
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    58   4e-08
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     58   4e-08
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     58   5e-08
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    58   5e-08
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    58   5e-08
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    58   5e-08
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    58   5e-08
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    57   5e-08
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    59   5e-08
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    57   5e-08
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    58   5e-08
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    58   5e-08
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    57   5e-08
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    58   6e-08
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    58   6e-08
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    58   6e-08
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    58   6e-08
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    57   6e-08
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    58   6e-08
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    58   6e-08
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    58   6e-08
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              58   6e-08
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    58   6e-08
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    57   6e-08
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    58   6e-08
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    58   6e-08
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    58   7e-08
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    58   7e-08
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    58   7e-08
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    58   7e-08
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    57   7e-08
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    58   7e-08
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    58   7e-08
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    58   7e-08
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    57   7e-08
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    57   7e-08
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    58   7e-08
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    58   8e-08
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    57   8e-08
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    57   8e-08
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    57   8e-08
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    57   8e-08
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    57   8e-08
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    57   9e-08
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    57   9e-08
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    57   9e-08
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    57   9e-08
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    57   9e-08
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    57   9e-08
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    57   9e-08
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    57   9e-08
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    57   9e-08
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       57   9e-08
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    57   9e-08
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    57   9e-08
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    57   9e-08
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    57   1e-07
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    57   1e-07
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    57   1e-07
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    57   1e-07
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    57   1e-07
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    57   1e-07
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    57   1e-07
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    57   1e-07
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              57   1e-07
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    57   1e-07
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    57   1e-07
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     56   1e-07
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    55   1e-07
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    57   1e-07
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    56   1e-07
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    57   1e-07
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    57   1e-07
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              55   1e-07
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    57   1e-07
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    57   1e-07
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    56   1e-07
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    57   1e-07
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    57   1e-07
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    55   1e-07
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    57   1e-07
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    55   2e-07
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    57   2e-07
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    56   2e-07
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    56   2e-07
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    56   2e-07
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    57   2e-07
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    57   2e-07
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    56   2e-07
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    56   2e-07
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    56   2e-07
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    57   2e-07
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    56   2e-07
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    56   2e-07
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    57   2e-07
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    56   2e-07
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    57   2e-07
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    57   2e-07
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    57   2e-07
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    55   2e-07
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     56   2e-07
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    57   2e-07
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    56   2e-07
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    56   2e-07
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               56   2e-07
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    56   2e-07
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    55   2e-07
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    56   2e-07
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    56   2e-07
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    56   2e-07
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    56   2e-07
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    56   2e-07
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    55   2e-07
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    56   2e-07
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    56   2e-07
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    56   2e-07
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    56   2e-07
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    56   2e-07
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    56   2e-07
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    56   2e-07
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    56   2e-07
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    56   2e-07
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    56   2e-07
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    55   2e-07
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    56   2e-07
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    56   2e-07
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    56   2e-07
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    55   2e-07
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               55   2e-07
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    55   3e-07
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    55   3e-07
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    55   3e-07
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    56   3e-07
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    55   3e-07
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    56   3e-07
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    56   3e-07
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              56   3e-07
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    56   3e-07
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    56   3e-07
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    56   3e-07
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    55   3e-07
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    56   3e-07
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    56   3e-07
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    56   3e-07
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    55   3e-07
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    55   3e-07
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    55   3e-07
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    55   3e-07
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    55   3e-07
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    55   3e-07
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               55   3e-07
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    56   3e-07
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    55   3e-07
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    55   3e-07
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    55   3e-07
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    55   3e-07
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    55   3e-07
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    55   3e-07
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    54   3e-07
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    55   3e-07
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    55   3e-07
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    56   3e-07
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    55   3e-07
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    55   3e-07
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    55   3e-07
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    55   3e-07
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    54   4e-07
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    55   4e-07
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               55   4e-07
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    55   4e-07
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    55   4e-07
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    55   4e-07
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    54   4e-07
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    55   4e-07
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    55   4e-07
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162     55   4e-07
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    55   4e-07
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    55   4e-07
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    55   4e-07
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    55   4e-07
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    55   4e-07
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    54   4e-07
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    55   4e-07
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              55   4e-07
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    55   4e-07
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    55   4e-07
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    55   4e-07
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    55   4e-07
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    55   4e-07
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    55   4e-07
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    54   4e-07
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    55   4e-07
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    55   4e-07
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    55   4e-07
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    55   4e-07
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    55   5e-07
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    55   5e-07
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    55   5e-07
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     55   5e-07
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    55   5e-07
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    55   5e-07
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    55   5e-07
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    55   5e-07
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    55   5e-07
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    54   5e-07
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    55   5e-07
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    54   5e-07
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    55   5e-07
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    55   5e-07
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    55   5e-07
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    55   5e-07
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    55   5e-07
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    55   5e-07
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    54   5e-07
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    55   5e-07
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    54   5e-07
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    55   5e-07
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    54   5e-07
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    55   5e-07
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    54   5e-07
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    55   6e-07
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    54   6e-07
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    55   6e-07
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    54   6e-07
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    55   6e-07
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    55   6e-07
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    54   6e-07
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    55   6e-07
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    55   6e-07
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    55   6e-07
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    55   6e-07
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    55   6e-07
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    55   6e-07
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    54   6e-07
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    55   6e-07
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    55   7e-07
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    55   7e-07
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    54   7e-07
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    54   7e-07
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    54   7e-07
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    54   7e-07
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     54   7e-07
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    54   7e-07
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              55   7e-07
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    54   7e-07
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    54   7e-07
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    54   7e-07
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     54   7e-07
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    55   7e-07
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    54   7e-07
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    54   8e-07
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    54   8e-07
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    54   8e-07
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    54   8e-07
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    54   8e-07
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    54   8e-07
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    54   8e-07
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    54   8e-07
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    54   8e-07
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    54   9e-07
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    54   9e-07
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    54   9e-07
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    54   9e-07
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    54   9e-07
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    54   9e-07
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    54   9e-07
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    52   1e-06
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    54   1e-06
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    54   1e-06
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    54   1e-06
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    54   1e-06
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    54   1e-06
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    54   1e-06
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    54   1e-06
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    53   1e-06
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    54   1e-06
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    54   1e-06
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    54   1e-06
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...    54   1e-06
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    54   1e-06
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    54   1e-06
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    54   1e-06
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    53   1e-06
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    54   1e-06
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    54   1e-06
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    54   1e-06
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    54   1e-06
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    54   1e-06
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    54   1e-06
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    53   1e-06
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    54   1e-06
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    54   1e-06
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    53   1e-06
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    54   1e-06
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    52   1e-06
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    52   1e-06
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    54   1e-06
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    53   1e-06
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    53   1e-06
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    53   1e-06
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    53   1e-06
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    54   1e-06
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    53   1e-06
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    54   1e-06
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    53   2e-06
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    53   2e-06
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    53   2e-06
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    52   2e-06
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    53   2e-06
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    53   2e-06
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    53   2e-06
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    53   2e-06
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    53   2e-06
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    53   2e-06
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    53   2e-06
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    53   2e-06
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    52   2e-06
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    53   2e-06
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    52   2e-06
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    53   2e-06
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    53   2e-06
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    53   2e-06
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    53   2e-06
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    53   2e-06
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    53   2e-06
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    53   2e-06
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    53   2e-06
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    53   2e-06
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    53   2e-06
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    52   2e-06
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    53   2e-06
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    53   2e-06
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    52   2e-06
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    53   2e-06
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    52   2e-06
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    53   2e-06
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    53   2e-06
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    52   2e-06
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    52   2e-06
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    52   3e-06
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    52   3e-06
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    52   3e-06
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    52   3e-06
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    53   3e-06
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    52   3e-06
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    52   3e-06
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    52   3e-06
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    53   3e-06
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    52   3e-06
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    52   3e-06
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    52   3e-06
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    53   3e-06
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    52   3e-06
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    52   3e-06
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    52   3e-06
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    51   3e-06
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    52   3e-06
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    52   3e-06
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    52   3e-06
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    52   4e-06
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    52   4e-06
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    51   4e-06
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    52   4e-06
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    51   4e-06
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    52   4e-06
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    51   4e-06
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    51   4e-06
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    52   4e-06
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    52   4e-06
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    52   4e-06
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      52   4e-06
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    52   4e-06
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    52   4e-06
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    52   4e-06
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    51   4e-06
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    52   4e-06
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    52   5e-06
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    51   5e-06
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    52   5e-06
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    51   5e-06
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    52   5e-06
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    51   5e-06
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    52   5e-06
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    51   5e-06
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...    52   5e-06
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    51   5e-06
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    52   5e-06
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    52   5e-06
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    52   5e-06
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    51   5e-06
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    52   5e-06
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    52   5e-06
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    51   5e-06
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     52   5e-06
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    52   5e-06
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     52   6e-06
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    52   6e-06
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    52   6e-06
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    51   6e-06
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    50   6e-06
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    52   6e-06
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    52   6e-06
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    51   6e-06
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    51   6e-06
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    51   6e-06
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    51   6e-06
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    51   6e-06
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    51   6e-06
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    51   6e-06
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    51   6e-06
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    51   7e-06
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    51   7e-06
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    51   7e-06
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    51   7e-06
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    51   7e-06
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    52   7e-06
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    51   7e-06
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    51   7e-06
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    51   7e-06
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    51   7e-06
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    51   7e-06
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    51   7e-06
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    51   7e-06
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    51   8e-06
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    48   8e-06
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...    51   8e-06
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    51   8e-06
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    50   8e-06
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    51   8e-06
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    51   8e-06
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    51   8e-06
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    50   8e-06
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    51   9e-06
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    50   9e-06
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    51   9e-06
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    50   9e-06
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    51   9e-06
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    50   9e-06
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    50   1e-05
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    51   1e-05
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    50   1e-05
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    50   1e-05
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    51   1e-05
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    50   1e-05
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    50   1e-05
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    50   1e-05
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    50   1e-05
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               50   1e-05
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    50   1e-05
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    50   1e-05
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    50   1e-05
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    50   1e-05
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    50   1e-05
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    50   1e-05
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    50   1e-05
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    50   1e-05
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    50   1e-05
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    50   1e-05
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    50   1e-05
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    50   1e-05
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    50   1e-05
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    50   1e-05
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    50   1e-05
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    50   1e-05
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    50   1e-05
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    50   1e-05
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    49   1e-05
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    50   1e-05
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    50   2e-05
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    50   2e-05
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    50   2e-05
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    50   2e-05
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    50   2e-05
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    50   2e-05
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    50   2e-05
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    50   2e-05
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    50   2e-05
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    50   2e-05
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    50   2e-05
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    50   2e-05
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    49   2e-05
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    50   2e-05
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    50   2e-05
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    50   2e-05
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    50   2e-05
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    50   2e-05
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    50   2e-05
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    50   2e-05
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    49   2e-05
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    50   2e-05
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    49   2e-05
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    49   2e-05
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    49   2e-05
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    50   2e-05
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    50   2e-05
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    50   2e-05
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    50   2e-05
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    49   2e-05
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    49   2e-05
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    50   2e-05
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...    49   2e-05
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...    50   2e-05
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    49   2e-05
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    49   2e-05
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    49   2e-05
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    49   2e-05
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              49   2e-05
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    49   2e-05
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    49   2e-05
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    49   2e-05
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    49   3e-05
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    49   3e-05
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    49   3e-05
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    49   3e-05
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    49   3e-05
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    49   3e-05
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    49   3e-05
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    49   3e-05
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    49   3e-05
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    49   3e-05
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    49   3e-05
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    49   3e-05
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    49   3e-05
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    49   3e-05
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    49   3e-05
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    49   3e-05
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    49   4e-05
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    49   4e-05
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    49   4e-05
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    49   4e-05
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    49   4e-05
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    49   4e-05
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    49   4e-05
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    49   4e-05
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    49   4e-05
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    49   4e-05
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    49   4e-05
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    49   4e-05
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    48   5e-05
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    49   5e-05
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    48   5e-05
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    49   5e-05
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    49   5e-05
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    48   5e-05
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    48   6e-05
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    48   6e-05
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    48   6e-05
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    48   6e-05
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    48   6e-05
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    48   6e-05
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    48   6e-05
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    48   6e-05
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    48   6e-05
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    47   7e-05
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    48   7e-05
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    47   7e-05
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    48   7e-05
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    48   7e-05
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    48   7e-05
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    47   7e-05
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    48   7e-05
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    48   7e-05
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    48   7e-05
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    47   7e-05
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    48   7e-05
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    48   7e-05
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    48   7e-05
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    47   7e-05
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    48   8e-05
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    48   8e-05
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    48   8e-05
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    48   8e-05
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    48   8e-05
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    47   8e-05
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               48   8e-05
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    48   8e-05
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    47   8e-05
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    48   8e-05
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    48   8e-05
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    47   8e-05
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    47   9e-05
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    48   9e-05
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    47   9e-05
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    48   9e-05
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    48   9e-05
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    47   9e-05
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    47   9e-05
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    47   9e-05
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    47   9e-05
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    47   9e-05
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    47   1e-04
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               47   1e-04
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    47   1e-04
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     47   1e-04
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    47   1e-04
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    47   1e-04
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    47   1e-04
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    47   1e-04
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    47   1e-04
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    47   1e-04
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    47   1e-04
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    47   1e-04
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    47   1e-04
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    47   1e-04
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    47   1e-04
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    47   1e-04
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    47   1e-04
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    47   1e-04
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    47   1e-04
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    47   1e-04
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    47   1e-04
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    47   1e-04
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    47   1e-04
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    47   1e-04
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    47   1e-04
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    47   1e-04
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    47   1e-04
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    47   1e-04
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    47   1e-04
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    47   1e-04
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    47   1e-04
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    47   1e-04
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    47   1e-04
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     47   1e-04
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       47   1e-04
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    47   2e-04
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    46   2e-04
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    47   2e-04
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    46   2e-04
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    46   2e-04
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    47   2e-04
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    47   2e-04
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    46   2e-04
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    47   2e-04
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    47   2e-04
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    47   2e-04
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    47   2e-04
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    47   2e-04
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    47   2e-04
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    47   2e-04
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    47   2e-04
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    46   2e-04
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    46   2e-04
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    47   2e-04
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    46   2e-04
KAFR0F02710 Chr6 (528336..529493) [1158 bp, 385 aa] {ON} Anc_2.3...    46   2e-04
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    46   2e-04
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             47   2e-04
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      47   2e-04
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    46   2e-04
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    47   2e-04
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    46   2e-04
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    46   2e-04
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    47   2e-04
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    46   2e-04
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     46   2e-04
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    46   2e-04
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    46   2e-04
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    46   2e-04
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    46   2e-04
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    46   2e-04
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    46   2e-04
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    46   2e-04
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    46   2e-04
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    46   2e-04
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    45   2e-04
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    46   2e-04
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    46   2e-04
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    46   2e-04
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    45   3e-04
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    45   3e-04
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    46   3e-04
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    46   3e-04
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    45   3e-04
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    46   3e-04
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    46   3e-04
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    45   3e-04
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    45   3e-04
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    46   3e-04
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    46   3e-04
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     45   3e-04
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    46   3e-04
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    45   3e-04
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    45   3e-04
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    45   4e-04
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    46   4e-04
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    45   4e-04
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    45   4e-04
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      46   4e-04
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    45   4e-04
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    45   4e-04
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    45   4e-04
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    45   4e-04
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    45   4e-04
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    45   4e-04
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    45   4e-04
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    45   4e-04
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    45   5e-04
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    45   5e-04
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    45   5e-04
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    45   5e-04
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    45   5e-04
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    45   5e-04
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    45   5e-04
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    45   5e-04
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               45   5e-04
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    44   6e-04
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    45   6e-04
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    45   6e-04
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    45   6e-04
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    45   6e-04
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    45   6e-04
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    44   6e-04
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    44   6e-04
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    44   6e-04
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    44   6e-04
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...    45   6e-04
YJL057C Chr10 complement(328118..330121) [2004 bp, 667 aa] {ON} ...    45   6e-04
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    44   6e-04
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    44   7e-04
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    44   7e-04
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    45   7e-04
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    44   7e-04
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    45   7e-04
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    44   7e-04
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...    45   7e-04
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    44   7e-04
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    44   7e-04
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    45   8e-04
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    44   8e-04
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    44   8e-04
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    45   8e-04
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    44   8e-04
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    45   8e-04
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    44   8e-04
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    45   8e-04
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    44   9e-04
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    44   9e-04
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    44   9e-04
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    44   9e-04
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    44   9e-04
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    44   0.001
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    44   0.001
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    44   0.001
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    44   0.001
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    44   0.001
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    44   0.001
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               44   0.001
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...    44   0.001
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    44   0.001
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    44   0.001
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    44   0.001
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    44   0.001
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    44   0.001
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    44   0.001
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    44   0.001
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    43   0.001
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    43   0.001
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    43   0.001
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    44   0.001
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    44   0.001
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    44   0.001
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    43   0.001
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    44   0.001
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    43   0.001
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    44   0.001
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    43   0.001
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    44   0.001
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    43   0.001
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    44   0.001
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    44   0.001
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    43   0.001
Kwal_47.17868 s47 (587449..588546) [1098 bp, 365 aa] {ON} YMR139...    43   0.001
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    43   0.001
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    44   0.001
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    43   0.002
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    43   0.002
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    44   0.002
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    44   0.002
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    44   0.002
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    43   0.002
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    43   0.002
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    43   0.002
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    44   0.002
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    43   0.002
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    43   0.002
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    44   0.002
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    44   0.002
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    43   0.002
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    43   0.002
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    43   0.002
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    43   0.002
Skud_13.300 Chr13 (519521..520633) [1113 bp, 370 aa] {ON} YMR139...    43   0.002
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    43   0.002
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    43   0.003
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    43   0.003
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    43   0.003
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    43   0.003
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    42   0.003
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    43   0.003
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    42   0.003
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    43   0.003
NCAS0B07200 Chr2 complement(1363351..1364940) [1590 bp, 529 aa] ...    43   0.003
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...    43   0.003
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    42   0.003
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    43   0.003
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    43   0.003
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    43   0.003
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    42   0.003
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    43   0.003
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    43   0.003
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    43   0.003
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    43   0.003
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    43   0.003
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     42   0.003
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    43   0.003
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    43   0.003
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    42   0.003
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    42   0.004
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    42   0.004
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    42   0.004
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    42   0.004
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    42   0.004
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...    42   0.004
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    42   0.004
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    43   0.004
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    42   0.004
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    42   0.004
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    42   0.004
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    42   0.004
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    42   0.004
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    42   0.004
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    42   0.004
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    42   0.005
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    42   0.005
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    42   0.005
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    42   0.005
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    42   0.005
SAKL0E04950g Chr5 (401903..402994) [1092 bp, 363 aa] {ON} highly...    42   0.005
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    42   0.005
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    42   0.005
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    42   0.005
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    42   0.005
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    42   0.005
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    42   0.006
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    42   0.006
Suva_15.332 Chr15 complement(575263..575547,575959..576084,57614...    42   0.006
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    41   0.007
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    41   0.007
NDAI0F03150 Chr6 complement(757283..758923) [1641 bp, 546 aa] {O...    41   0.007
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    42   0.008
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    41   0.008
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               41   0.008
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    41   0.008
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    41   0.008
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    41   0.008
YHR135C Chr8 complement(372694..374310) [1617 bp, 538 aa] {ON}  ...    41   0.008
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    41   0.008
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    41   0.009
Smik_8.216 Chr8 complement(349478..351145) [1668 bp, 555 aa] {ON...    41   0.009
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    41   0.009
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    41   0.010
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    41   0.010
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    41   0.010
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             40   0.010
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    41   0.010
Ecym_2302 Chr2 (587299..588951) [1653 bp, 550 aa] {ON} similar t...    41   0.010
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    41   0.010
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    41   0.010
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    40   0.011
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    40   0.011
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    41   0.011
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    41   0.011
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    41   0.011
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    41   0.011
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    41   0.011
KAFR0B03270 Chr2 complement(677477..679231) [1755 bp, 584 aa] {O...    41   0.012
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    40   0.012
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    40   0.013
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    40   0.014
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    40   0.015
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    40   0.015
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    40   0.015
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....    40   0.016
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    40   0.017
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    40   0.018
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    40   0.018
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    40   0.019
Skud_8.196 Chr8 complement(346056..346463,346494..347684) [1599 ...    40   0.020
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    40   0.020
CAGL0G06138g Chr7 complement(585585..587204) [1620 bp, 539 aa] {...    40   0.021
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    39   0.021
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    40   0.022
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    39   0.022
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    40   0.022
SAKL0E12100g Chr5 complement(1004036..1005622) [1587 bp, 528 aa]...    40   0.023
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    40   0.023
Kpol_1027.20 s1027 complement(43412..44974) [1563 bp, 520 aa] {O...    40   0.023
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    40   0.023
TBLA0D00250 Chr4 (61918..63618) [1701 bp, 566 aa] {ON} Anc_2.105...    40   0.024
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    39   0.026
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    40   0.026
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    39   0.027
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    40   0.027
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    39   0.027
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    39   0.027
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    39   0.028
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    39   0.028
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    39   0.029
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    39   0.029
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    39   0.033
Suva_6.133 Chr6 (221952..223955) [2004 bp, 667 aa] {ON} YJL057C ...    39   0.034
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    39   0.034
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    39   0.034
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    39   0.035
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    39   0.036
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    39   0.036
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    39   0.036
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    39   0.037
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    39   0.037
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    39   0.037
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    39   0.038
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    39   0.039
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    39   0.041
Skud_14.179 Chr14 complement(334239..335924) [1686 bp, 561 aa] {...    39   0.041
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    39   0.042
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    39   0.043
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    39   0.043
Smik_14.174 Chr14 complement(323054..324709) [1656 bp, 551 aa] {...    39   0.045
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    39   0.045
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    39   0.046
KLLA0D11044g Chr4 complement(942458..944068) [1611 bp, 536 aa] {...    39   0.046
YNL154C Chr14 complement(343636..345276) [1641 bp, 546 aa] {ON} ...    39   0.048
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    39   0.048
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    39   0.049
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    39   0.050
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    39   0.051
Suva_14.185 Chr14 complement(340104..341789) [1686 bp, 561 aa] {...    39   0.052
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    39   0.054
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    39   0.054
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    38   0.054
NCAS0G02120 Chr7 (381894..383465) [1572 bp, 523 aa] {ON} Anc_2.105     39   0.059
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    38   0.061
Kpol_1032.58 s1032 (133258..135336) [2079 bp, 692 aa] {ON} (1332...    39   0.061
AFR040W Chr6 (505602..507245) [1644 bp, 547 aa] {ON} Syntenic ho...    38   0.063
Smik_16.346 Chr16 (617471..618802) [1332 bp, 443 aa] {ON} YPR106...    38   0.064
CAGL0J05940g Chr10 (562687..564147) [1461 bp, 486 aa] {ON} simil...    38   0.064
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    38   0.064
NCAS0C01030 Chr3 (192001..194043) [2043 bp, 680 aa] {ON} Anc_8.732     38   0.066
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    38   0.068
TDEL0F00910 Chr6 (157379..159070) [1692 bp, 563 aa] {ON} Anc_2.1...    38   0.070
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    38   0.076
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    38   0.077
KLTH0B06204g Chr2 complement(502282..503778) [1497 bp, 498 aa] {...    38   0.085
KNAG0F01490 Chr6 (270931..272604) [1674 bp, 557 aa] {ON} Anc_2.1...    38   0.097
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    38   0.098
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    38   0.10 
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    37   0.10 
KLTH0E15026g Chr5 (1331171..1335730) [4560 bp, 1519 aa] {ON} sim...    38   0.11 
Kwal_33.14596 s33 (735962..737464) [1503 bp, 500 aa] {ON} YNL154...    37   0.11 
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    37   0.11 
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    37   0.11 
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    37   0.12 
ZYRO0G08316g Chr7 (677123..679465) [2343 bp, 780 aa] {ON} simila...    37   0.12 
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    37   0.12 
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    37   0.13 
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    37   0.13 
KNAG0H03710 Chr8 complement(687550..689184) [1635 bp, 544 aa] {O...    37   0.13 
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    37   0.13 
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    37   0.13 
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    37   0.14 
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    37   0.14 
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    37   0.15 
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    37   0.16 
KAFR0F00520 Chr6 (111106..112659) [1554 bp, 517 aa] {ON} Anc_2.1...    37   0.17 
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    36   0.20 
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    37   0.23 
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    36   0.26 
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...    36   0.26 
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    36   0.29 
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      36   0.29 
Kwal_26.9032 s26 complement(1047382..1049157) [1776 bp, 591 aa] ...    36   0.30 
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...    36   0.32 
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    36   0.34 
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    36   0.36 
ZYRO0A06182g Chr1 (493846..496062) [2217 bp, 738 aa] {ON} simila...    36   0.37 
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    36   0.38 
TDEL0G01540 Chr7 complement(303940..306300) [2361 bp, 786 aa] {O...    36   0.46 
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    35   0.49 
TPHA0J01160 Chr10 (268613..269905) [1293 bp, 430 aa] {ON} Anc_3....    35   0.55 
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    35   0.58 
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    35   0.59 
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    35   0.63 
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    35   0.71 
Kpol_1051.42 s1051 (98030..99379,99382..100212) [2181 bp, 726 aa...    35   0.81 
YMR216C Chr13 complement(698811..701039) [2229 bp, 742 aa] {ON} ...    35   0.83 
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    35   0.90 
KNAG0J02030 Chr10 complement(368141..370327) [2187 bp, 728 aa] {...    35   0.91 
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    35   0.93 
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    35   0.94 
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    34   1.2  
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    33   1.7  
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    33   1.7  
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    33   1.8  
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    33   2.0  
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    33   2.1  
TBLA0A09370 Chr1 complement(2310412..2311443) [1032 bp, 343 aa] ...    33   2.4  
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    33   2.6  
KNAG0D02200 Chr4 complement(374609..376075) [1467 bp, 488 aa] {O...    33   2.6  
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    33   3.0  
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    33   3.0  
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    33   3.4  
SAKL0H24508g Chr8 (2123140..2124606) [1467 bp, 488 aa] {ON} unip...    33   3.5  
KLLA0D16412g Chr4 complement(1382063..1383652) [1590 bp, 529 aa]...    32   4.1  
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    32   4.3  
Kpol_480.29 s480 (71289..71906) [618 bp, 205 aa] {ON} (71289..71...    32   5.0  
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    32   5.5  
NDAI0K01030 Chr11 (239418..241712) [2295 bp, 764 aa] {ON} Anc_8....    32   8.3  
TDEL0A05060 Chr1 complement(893664..900377) [6714 bp, 2237 aa] {...    32   9.7  

>TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.284
           YNL020C
          Length = 661

 Score = 1228 bits (3177), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 614/661 (92%), Positives = 614/661 (92%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60
           MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV
Sbjct: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120
           PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180
           MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180

Query: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240
           VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300
           YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ
Sbjct: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300

Query: 301 GIQCPVRNFYLLRAMEQQQQSTQNQLRYSRTQPVLNVPIISQPVGFPMHQISGAPLGSST 360
           GIQCPVRNFYLLRAMEQQQQSTQNQLRYSRTQPVLNVPIISQPVGFPMHQISGAPLGSST
Sbjct: 301 GIQCPVRNFYLLRAMEQQQQSTQNQLRYSRTQPVLNVPIISQPVGFPMHQISGAPLGSST 360

Query: 361 SHIVPSNSVPILAARPRSAGSNGTGRSFQTPXXXXXXXXXXQTFHRAASRSPVSTHLSTS 420
           SHIVPSNSVPILAARPRSAGSNGTGRSFQTP          QTFHRAASRSPVSTHLSTS
Sbjct: 361 SHIVPSNSVPILAARPRSAGSNGTGRSFQTPSTSSLSAKSSQTFHRAASRSPVSTHLSTS 420

Query: 421 PVRHGRGNISQIVESNRTSFDRPRYVDSVTQTSDTEEEPLKVASKSSVSLPARESHAVAD 480
           PVRHGRGNISQIVESNRTSFDRPRYVDSVTQTSDTEEEPLKVASKSSVSLPARESHAVAD
Sbjct: 421 PVRHGRGNISQIVESNRTSFDRPRYVDSVTQTSDTEEEPLKVASKSSVSLPARESHAVAD 480

Query: 481 XXXXXXXXXXXXXXXXXERPAVAPKQQVAVPHTKLEHIYAAKIPTGRQSLRQESEIEIPL 540
                            ERPAVAPKQQVAVPHTKLEHIYAAKIPTGRQSLRQESEIEIPL
Sbjct: 481 KSSVVRSSSLRSKSTSSERPAVAPKQQVAVPHTKLEHIYAAKIPTGRQSLRQESEIEIPL 540

Query: 541 TSVRSREAKESIQRRVRDLLNSSEDLPLSKSEPKKDEPKRGQLSKTHHDEKPSVKEKSKQ 600
           TSVRSREAKESIQRRVRDLLNSSEDLPLSKSEPKKDEPKRGQLSKTHHDEKPSVKEKSKQ
Sbjct: 541 TSVRSREAKESIQRRVRDLLNSSEDLPLSKSEPKKDEPKRGQLSKTHHDEKPSVKEKSKQ 600

Query: 601 KVXXXXXXXXXXXXXXXXXXXXFLSGKKMVDTEPSEAGKAVIDAKVESLERDLRKEVTGT 660
           KV                    FLSGKKMVDTEPSEAGKAVIDAKVESLERDLRKEVTGT
Sbjct: 601 KVRPRAPPKPAHLRPKPPPKPAFLSGKKMVDTEPSEAGKAVIDAKVESLERDLRKEVTGT 660

Query: 661 L 661
           L
Sbjct: 661 L 661

>SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 791

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/481 (62%), Positives = 352/481 (73%), Gaps = 31/481 (6%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60
           M+QP +  Y  GTVLTVGSH A++I YLTSGGFA +YSAEI P D    S++ACLKRV+V
Sbjct: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPN-SSSIACLKRVLV 59

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120
           PDKPSLN+LRAEVDAMKLL+ +K VVSYIDSHAAKSS  NGSYEVFLLMEYCA GGLIDF
Sbjct: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180
           MNTRLQNRL+EFE+L IMSQV+QG+AAMHALQPPLIHRDIKIENVLIS  G +KVCDFGS
Sbjct: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179

Query: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240
           VCGVIRPP+NPQE  YVQHD+LKNTTAQYRSPEMIDLYRG P+DEKSDIWALGVFLYKLC
Sbjct: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300
           YYTTPFEK GE+AILHS+FQFPA P YSD+LK LI  +L ENP QRPN+CQ+L +VSR+Q
Sbjct: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299

Query: 301 GIQCPVRNFYLLRAMEQQQQSTQNQ----LRYSRTQP---VLNVPIISQP---------- 343
           G+ CPV+NFYL R M  QQQ  Q Q    LR+S +QP    + +PI  QP          
Sbjct: 300 GVPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSVSQPQMEAITLPITLQPHPQKVLASAQ 359

Query: 344 VGFPMHQISGAP-----LGSSTSHIVPSNSVPILAARPRSAGSNGTGRSFQTPXXXXXXX 398
           V +    ++ +P     L  S S  +P+ + P L     +     T   F          
Sbjct: 360 VSYANTGLTASPTAQQKLLYSRSQPLPARNDPFLNLDKSNLLPPKTKLEF------PELK 413

Query: 399 XXXQTFHRAASRSPVSTH-LSTSPVRHGRGNISQIVESNRTSFDR-PRYVDSVTQTSDTE 456
              +  +   + +P +T   S SPVR+GRG+IS+I++SN TS DR   YVDS TQT +T 
Sbjct: 414 YNKEQLNGIPATTPYATQRRSVSPVRNGRGDISKILKSNPTSVDRLSSYVDSETQTFETI 473

Query: 457 E 457
           E
Sbjct: 474 E 474

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 26/39 (66%)

Query: 539 PLTSVRSREAKESIQRRVRDLLNSSEDLPLSKSEPKKDE 577
           P+    +RE++ SIQ+RV DLL +S+D P+ K+ P   E
Sbjct: 633 PIKMSANRESRNSIQKRVHDLLKNSQDSPVRKTAPDFGE 671

>ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 704

 Score =  562 bits (1448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/619 (51%), Positives = 384/619 (62%), Gaps = 66/619 (10%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60
           MN PEIP Y PGTVL+VG+HHAK++ Y+ SGGFAQVYSAE+ PAD    +N  CLKRVI+
Sbjct: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120
           P+K  LN LRAEV+AMKLL+ +KHVV YIDSHAA+S   NG+YEVFLLME+C  GGLIDF
Sbjct: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180
           MNTRLQNRL+E+EILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLIS  G+YKVCDFGS
Sbjct: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180

Query: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240
           V G IRPP+NPQEFA+VQHD+LKNTTAQYRSPEMIDLYR   IDEKSDIWALG+FLYKLC
Sbjct: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300
           YYTTPFEKGG+ AILHSR+QF A PIYSDRLK LI  ML + P QRPN+CQVLE+VSRMQ
Sbjct: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300

Query: 301 GIQCPVRNFYLLRAMEQQQQSTQ-----------NQLRYSRTQ-----PVLNVPIISQPV 344
           G+  P+RNFYLLRAM+    ST            N       Q     P  ++     PV
Sbjct: 301 GVSSPMRNFYLLRAMQHTNTSTSFITPPVSMVNTNTFMAPPAQVAPLTPAQSLGANGMPV 360

Query: 345 GF---PMHQISGAPLGSSTS----------HIVPSNSVPILAARPRSAGSNGTGRSFQTP 391
           G    PM  ++    G ST            +VP+   P   A P   GS         P
Sbjct: 361 GVTPQPMPIMAKTRSGISTGGNIFPGAANPMVVPTQLGPAQVAGPVPMGSQDMSSGILPP 420

Query: 392 XXXXXXXXXXQTFHRAASRSPVSTHLSTSPVRHGRGNISQIVESNRTSFDRP-RYVDSVT 450
                       F+RA++    +   ST P + G    S +     T  DRP  YVDS T
Sbjct: 421 ------------FNRASTLP--TDGFSTGPGKDGGVITSAVNTGPETIKDRPFNYVDSET 466

Query: 451 QTSD----TEEEPL--KVASKSSVSLPARESHAVADXXXXXXXXXXXXXXXXXERPA--- 501
           QTSD    T  +P     A  S+ SLPA+     AD                 ++PA   
Sbjct: 467 QTSDAGSITTSKPYLHPSAVSSTRSLPAQN----ADHDSRPRSSSLDFKSAARKKPADEE 522

Query: 502 -----VAPKQQVAVPHTKLEHIYAAKIPTGRQSLRQESEIEI---PLTSVRSR-EAKESI 552
                +A   +   P+ +         P G++S    + +      L  ++S  + KESI
Sbjct: 523 ILENLIALSNRRDDPNKRNSFNSFNSSPIGQRSPTGGANVPTTPDSLARIKSNPDTKESI 582

Query: 553 QRRVRDLLNSSEDLPLSKS 571
           Q++V+ LL ++ED P +KS
Sbjct: 583 QKKVQSLLKAAEDSPKNKS 601

>KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p- Sla1p-End3p
           protein complex
          Length = 790

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/479 (61%), Positives = 350/479 (73%), Gaps = 27/479 (5%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60
           MNQ     Y PGT LTVGSH A++I YLTSGGFA +Y+AEI PAD    + +ACLKRV+V
Sbjct: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120
           PDKPSLN LRAEVDAMKLLR N+HVVSYIDSHAAKS   +GSYEVFLLMEYC+GGGLIDF
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180
           MNTRLQNRLQE E+L I S +TQGIAAMHALQPPLIHRDIKIENVLIS    +KVCDFGS
Sbjct: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180

Query: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240
           VCGVIRPP+NPQEF YVQHD+LKNTTAQYR+PEMIDLYRG+PI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300
           YYTTPFEK GE AILHSRFQFP+ P YSD LK LI  ML ENP QRPN+CQVLE+VSR+Q
Sbjct: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300

Query: 301 GIQCPVRNFYLLRAMEQQQQSTQNQLRY--SRTQPVLNVP--IISQPVGFPMHQ------ 350
           G  CP+RNFY+ RAM+QQQQ  Q ++++  S +QP L+    II+ P     +Q      
Sbjct: 301 GTPCPLRNFYVTRAMQQQQQHQQPKIKFDHSASQPKLDSANNIINVPFKMSHNQPLRSTQ 360

Query: 351 -ISGAPLGSSTSHIVPSNSVPILAARPRSAG----------SNGTGRSFQTPXXXXXXXX 399
             +GAP+ ++++  +P  ++  L  +P S+            N   +S QTP        
Sbjct: 361 TFAGAPVNAASNGYLP--ALKPLPIQPVSSSFTNGPFKFIEGNKALQSKQTPHFQPPISH 418

Query: 400 XXQTFHRAASRSPVST---HLSTSPVRHGRGNISQIVESNRTSFD-RPRYVDSVTQTSD 454
                 R+ + +P ST     S SP   GRG+IS+I+ +N T+ +  P Y+ S TQT D
Sbjct: 419 DFNRLGRSQTFTPTSTLASRSSVSPPLAGRGDISKIISANPTNVEPSPIYLSSGTQTDD 477

>Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W
           (REAL)
          Length = 805

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/482 (60%), Positives = 333/482 (69%), Gaps = 36/482 (7%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60
           MN P+I  Y PGT+LTVGSHHAK+I YLTSGGFAQVYSAEI P D +  +N+ACLKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYSAEISPPDPYSSANIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNG-SYEVFLLMEYCAGGGLID 119
           PDK  LNTLRAEVDAMKLL+NNKHVVSYIDSHAAKS   NG +YEVF+LMEYC  GGLID
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGVAYEVFVLMEYCERGGLID 118

Query: 120 FMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFG 179
           FMNTRL+NRLQE EIL+IM Q  QGIAAMHALQPPLIHRDIKIENVLISH G YKVCDFG
Sbjct: 119 FMNTRLKNRLQESEILDIMGQTVQGIAAMHALQPPLIHRDIKIENVLISHEGLYKVCDFG 178

Query: 180 SVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKL 239
           SV GVIRPP+NPQEF YVQHD+L NTTAQYRSPEMIDLYRG PIDEKSDIWALGVFLYK+
Sbjct: 179 SVSGVIRPPKNPQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKI 238

Query: 240 CYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRM 299
           CYYTTPFEK GE AILH+R+Q+P+ P YSDRLK LIR MLME P QRPN+CQVLE+VSR+
Sbjct: 239 CYYTTPFEKTGEAAILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRL 298

Query: 300 QGIQCPVRNFYLLRAMEQQQQ--STQNQLRYSRTQPVLN----VPIISQPVGFPMHQISG 353
           Q   CP+RNFYLLRAM Q  Q  S    + Y+  Q +++      I + P   P+  I  
Sbjct: 299 QNRPCPIRNFYLLRAMNQNAQFGSESTSMTYTPAQQLVSPQSFQNIQAMPNIVPLSNIKT 358

Query: 354 APLGSSTSHIVPSNSV--PILAARPRSAGSNGTGRSFQTPXXXXXXXXXXQTFHR----- 406
            P   S S+ V +N+    +L  R +      TG +F  P            F       
Sbjct: 359 TPNLDSASNFVNNNNKMEAMLQLRTQKL---ETGPNFSIPLTKTKSVPLSDDFTSLYYKE 415

Query: 407 -------------AASRSPVSTHLSTSPVRHGRGNISQIVESNRTSFDRPRYVDSVTQTS 453
                          S+SP    +  SP      N  ++   NR +     YVDS TQT 
Sbjct: 416 LHPFQKPHTFKSVEGSQSPQRKSIPFSPTPVNSNNYDRVSTINRPN----NYVDSETQTL 471

Query: 454 DT 455
           D+
Sbjct: 472 DS 473

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 18/20 (90%)

Query: 546 REAKESIQRRVRDLLNSSED 565
           +E KESIQRRV +LLN+SED
Sbjct: 665 QEKKESIQRRVHNLLNNSED 684

>KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {ON}
           Anc_2.284 YNL020C
          Length = 369

 Score =  536 bits (1380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/341 (73%), Positives = 286/341 (83%), Gaps = 6/341 (1%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60
           MNQP+I  Y+PGT+L VGSH  ++I Y+TSGGFAQ+Y+ EI P D+F DSN+ACLKRVIV
Sbjct: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120
           PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHA+KS+F NGSYEVFLLMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180
           MNTRLQNRL E E+L+I SQV QGIAAMHALQPPL+HRDIKIENVLIS + QYK+CDFGS
Sbjct: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180

Query: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240
           V G+IRPP NPQE  YVQHDVLKNTTAQYRSPEMID YRG PIDEKSDIWA+GVFLYKLC
Sbjct: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240

Query: 241 YYTTPFEK-GGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRM 299
           YYTTPFEK GGE AIL +R+++P  PIYS+RLK LI  MLMENP QRPN+ QV+E++S+M
Sbjct: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300

Query: 300 QGIQCPVRNFYLL-----RAMEQQQQSTQNQLRYSRTQPVL 335
           Q + CP+ NFYL+       M Q Q    N L  S+T P+L
Sbjct: 301 QNVPCPIVNFYLVTQQQKHKMVQLQPIPVNTLNVSQTHPIL 341

>Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {ON}
           YIL095W (PRK1) - probable serine/threonine-protein
           kinase [contig 27] FULL
          Length = 791

 Score =  551 bits (1419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/482 (61%), Positives = 341/482 (70%), Gaps = 30/482 (6%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60
           MNQP    Y  GT LTVGSH A++I YLTSGGFA +YSAEI PAD     NVACLKRV+V
Sbjct: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120
           PDK SLN LRAEVDAMKLLR NKHVVSYIDSHAAKS   +GSYEVFLLMEYC+ GGLIDF
Sbjct: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180
           MNTRLQNRL E E+L IMS +TQGIAAMHAL PPLIHRDIKIENVLIS    +KVCDFGS
Sbjct: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180

Query: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240
           VCGVIRPP+N QEF+YVQ+D+LKNTTAQYRSPEMIDLYRGHPI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300
           YYTTPFEK G+ AILHSRFQFPA P YSDRLK LI  ML ENP+QRPN+CQVLE+VSR+Q
Sbjct: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300

Query: 301 GIQCPVRNFYLLRAMEQQQQSTQN--------QLRYSRTQPVLNVPIISQPVGFPMHQIS 352
            + CP+RNFYLLR+M+QQQQ  Q         ++ +S +QP +++   + PV  P     
Sbjct: 301 NVPCPLRNFYLLRSMQQQQQQHQQQQQTFPSVEVHHSLSQPRMDLK--NGPVLTPFKHAQ 358

Query: 353 GAPLGSSTSHIVPS------NSVPILA---ARP-----RSAGSNGTGRS--FQTPXXXXX 396
            + L +S +    +      N VP+L    A+P     RS       R    Q       
Sbjct: 359 SSALRTSKTFDGAAMNGSINNYVPVLKPHQAQPVQQNYRSDPFTSIDRRTVLQEKIPLQP 418

Query: 397 XXXXXQTFHRAASRSPVS---THLSTSPVRHGRGNISQIVESNRTSFD-RPRYVDSVTQT 452
                Q   RA +  PV+      S SP   GRG+IS IV +N T+ D  P Y++S  QT
Sbjct: 419 ASADFQRLSRAQTFVPVTKSPKRSSASPSFGGRGDISMIVSANPTNVDPTPIYLNSSVQT 478

Query: 453 SD 454
            +
Sbjct: 479 DN 480

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 22/27 (81%)

Query: 545 SREAKESIQRRVRDLLNSSEDLPLSKS 571
           S +A+ SIQ+RV++LL SS+D P+ KS
Sbjct: 645 SSDARSSIQKRVQNLLKSSQDSPVKKS 671

>KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 777

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/497 (57%), Positives = 336/497 (67%), Gaps = 42/497 (8%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60
           MNQP+I  Y  GT+L VGSH  KV+ YL SGGFA VYS EI P D     NVACLKRV+V
Sbjct: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120
           PDK SLNTLRAEVD+MK LR NK +VSYIDSHA KS    G YEV+LLMEYC+GGGLIDF
Sbjct: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180
           MNTRLQNRLQEFEILNIMSQV+QG+AAMHALQPPLIHRDIKIENVL+S   ++K+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180

Query: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240
           V GVIR P+N +EF YVQ+D++KNTTAQYR PEMIDLYRG PIDEKSDIWALGVFLYK C
Sbjct: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240

Query: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300
           YYTTPFEK GE AIL S+F+FPA P YSDR+K LI  ML  +P +RPN+CQV+E+VSR+Q
Sbjct: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300

Query: 301 GIQCPVRNFYLLRAMEQQQQ----------------------STQ--------NQLRYSR 330
           GI CP++NFYLLR M++Q+Q                      STQ        N    S+
Sbjct: 301 GIPCPIKNFYLLRMMDKQEQPRVSPPPHVPQMTVPATVPTSVSTQHLPPQVVSNVQTPSK 360

Query: 331 TQ-----PVLNV----PIISQPVGFPMHQISGAPLGSSTSHIVPSNSVPILAARPRSAGS 381
           T      P L+V    P+++Q       Q +G  +  + S+   S+     +   RSA  
Sbjct: 361 TASIQHLPYLHVSKSQPMVTQQDLLSQKQPAGKTVPQTVSNYTSSDP---FSKIDRSALL 417

Query: 382 NGTGRSFQTPXXXXXXXXXXQTFHRAASRSPVSTHLSTSPVRHGRGNISQIVESNRTSFD 441
           + +      P          Q  H       V    S SPVR+GRG IS I+ SNRTS D
Sbjct: 418 STSATMESLPRAMRIPQLEYQQPHLLTRSQSVVPRASVSPVRNGRGAISSILASNRTSLD 477

Query: 442 RPRYVDSVTQTSDTEEE 458
           RP+YVDS TQTSD   E
Sbjct: 478 RPKYVDSETQTSDHPSE 494

>YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protein
           serine/threonine kinase; regulates the organization and
           function of the actin cytoskeleton and reduces endocytic
           ability of cell through the phosphorylation of the
           Pan1p-Sla1p-End3p protein complex
          Length = 810

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/391 (69%), Positives = 303/391 (77%), Gaps = 12/391 (3%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60
           MN P+I  Y PGT+LTVGSHHAK+I YLTSGGFAQVY+AEI P D + ++N+ACLKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNG-SYEVFLLMEYCAGGGLID 119
           P K  LNTLRAEVDAMKLLRNNKHVVSYIDSHAA+S   NG +YEVF+LME+C  GGLID
Sbjct: 61  PHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARSV--NGIAYEVFVLMEFCERGGLID 118

Query: 120 FMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFG 179
           FMNTRLQNRLQE EIL IMSQ  QGI AMHALQPPLIHRDIKIENVLISH G YKVCDFG
Sbjct: 119 FMNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVCDFG 178

Query: 180 SVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKL 239
           SV GVIRPP+N QEF YVQHD+L NTTAQYRSPEMIDLYRG PIDEKSDIWALGVFLYK+
Sbjct: 179 SVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKI 238

Query: 240 CYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRM 299
           CYYTTPFEK GE  ILH+R+Q+P+ P YSDRLK LIR MLME P QRPN+CQVLE+VSR+
Sbjct: 239 CYYTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRL 298

Query: 300 QGIQCPVRNFYLLRAMEQ----QQQSTQNQLRYSRTQ---PVLNVPIISQPVG-FPMHQI 351
           Q   CP+RNFYLLRAM Q    Q     +   Y  TQ   PV ++  I+QP    P+  +
Sbjct: 299 QNKPCPIRNFYLLRAMNQNANTQLAGEPSSTTYVPTQKFIPVQSLQSINQPPNMMPVTHV 358

Query: 352 SGAP-LGSSTSHIVPSNSVPILAARPRSAGS 381
           S  P LG+    I  +N   + A      GS
Sbjct: 359 STTPNLGTFPISINDNNKTEVTAHAGLQVGS 389

>Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W
           (REAL)
          Length = 808

 Score =  545 bits (1405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/338 (76%), Positives = 284/338 (84%), Gaps = 5/338 (1%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60
           MN P+I  Y PGT+LTVGSHHAK+I YLTSGGFAQVY+AEI P D + ++N+ACLKRVIV
Sbjct: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNG-SYEVFLLMEYCAGGGLID 119
           PDK  LNTLRAEVDAMKLL+NNKHVVSYIDSHAAKS   NG +YEVF+LME+C  GGLID
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGVAYEVFVLMEFCERGGLID 118

Query: 120 FMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFG 179
           FMNTRLQNRL+E EIL IMSQ  QGIAAMHALQPPLIHRDIKIENVLISH G YKVCDFG
Sbjct: 119 FMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFG 178

Query: 180 SVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKL 239
           SV GVIRPP+N QEF YVQHD+L NTTAQYRSPEMIDLYRG PIDEKSDIWALG+FLYK+
Sbjct: 179 SVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKI 238

Query: 240 CYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRM 299
           CYYTTPFEK GE  ILH+R+Q+P  P YSDRLK LIR MLME P +RPN+CQVLE+VSR+
Sbjct: 239 CYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRL 298

Query: 300 QGIQCPVRNFYLLRAMEQQQQ--STQNQLRYSRTQPVL 335
           Q   CP+RNFYLLRAM Q  Q  S    ++Y  TQ  L
Sbjct: 299 QIKPCPIRNFYLLRAMSQTAQLASEPPSMKYVPTQKFL 336

 Score = 32.3 bits (72), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 21/25 (84%), Gaps = 1/25 (4%)

Query: 545 SREAKESIQRRVRDLLNSSEDLPLS 569
           ++E KESIQRRV +LL SSED PL+
Sbjct: 667 NQEKKESIQRRVHNLLKSSED-PLT 690

>Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W
           (REAL)
          Length = 809

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/482 (61%), Positives = 337/482 (69%), Gaps = 36/482 (7%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60
           MN P+I  Y+PGTVLTVGSHHAK+I YLTSGGFAQVY+AEI P D + ++N ACLKRVIV
Sbjct: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNG-SYEVFLLMEYCAGGGLID 119
           PDK  LNTLRAEVDAMKLL+NNKHVVSYIDSHAAKS   NG +YEVF+LME+C  GGLID
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGIAYEVFVLMEFCERGGLID 118

Query: 120 FMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFG 179
           FMNTRLQ+RL+E EIL IMSQ  QGIAAMH LQPPLIHRDIKIENVLISH G YKVCDFG
Sbjct: 119 FMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFG 178

Query: 180 SVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKL 239
           SV GVIRPP+N QEF YVQHD+L NTTAQYRSPEMIDLYR  PIDEKSDIWALGVFLYK+
Sbjct: 179 SVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKI 238

Query: 240 CYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRM 299
           CYYTTPFEK GE AILHSR+Q+P+ P YSDRLKGLI  MLME P QRPN+CQVLE+VSR+
Sbjct: 239 CYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRL 298

Query: 300 QGIQCPVRNFYLLRAMEQQQQ--STQNQLRYSRTQPVLNVPIISQPVG-----FPMHQIS 352
           Q   CP+RNFYLLRAM Q  Q  S    + Y   Q +L    + Q +       P+  + 
Sbjct: 299 QNEPCPIRNFYLLRAMGQNAQLASEPPSVTYVSAQQLLPAQTL-QGIKHLQSMVPVTHVR 357

Query: 353 GAP-LGSSTSHIVPSNSV-PILAARPRSAGSNGTG----RSFQTPXXXXXXX-------- 398
             P LG+ T  I  +N    IL  R +       G    ++   P               
Sbjct: 358 TTPNLGTLTKAITNNNQTESILPVRTQPESDLNLGNPLMKTKSVPLSDDFASLYYRELHP 417

Query: 399 -XXXQTFHRAAS-RSP---VSTHLSTSPVRHGRGNISQIVESNRTSFDRP-RYVDSVTQT 452
               QTF    S +SP   +ST  S+SPV     +      ++ ++ DRP  YVDSVTQT
Sbjct: 418 FQKSQTFKSVESFQSPQRKLSTPSSSSPVNSKNND-----RASTSTVDRPNNYVDSVTQT 472

Query: 453 SD 454
            D
Sbjct: 473 ID 474

>NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {ON} 
          Length = 661

 Score =  540 bits (1391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/343 (73%), Positives = 282/343 (82%), Gaps = 6/343 (1%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60
           MNQP+IP Y PGT+LTVGSH  +V+ YLTSGGFAQ+Y+ +I P D F ++NVACLKRVIV
Sbjct: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120
           PDKPSLNTLRAEVD MKLLRNN HVVSYIDSHAAK +   GSYEVFLLMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180
           MNTRLQ RL+E EILNIMSQVTQGIAAMHAL PPL+HRDIKIENVL++  G+YKVCDFGS
Sbjct: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180

Query: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240
           VCG+IRPP N QE +YVQHD++KNTTAQYR+PEMIDLYRG PIDEKSDIWALGVFLYKLC
Sbjct: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300
           YYTTPFEK GE AILH+ FQFP  P YSDRLK LI  MLME P QRPN  QVLE+VS MQ
Sbjct: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300

Query: 301 GIQCPVRNFYLLRAMEQQQQSTQNQLRYSRTQPVLNVPIISQP 343
            +QCP+ NFYL+         TQ Q+   +TQP  N  +++ P
Sbjct: 301 NVQCPIPNFYLMN-----NNVTQGQMAM-QTQPQNNGAMMASP 337

>NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa]
           {ON} Anc_2.284
          Length = 723

 Score =  541 bits (1394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 241/318 (75%), Positives = 277/318 (87%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60
           MNQP IP Y PGT+LTVGSH+ K+I YLTSGGFAQ+Y+ EI P + + +S  ACLKRVIV
Sbjct: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120
           PDK  LNTLRAEVDAMKLL+NN+HVVSYIDSHAA+S+   G+YEVFLLMEYC GGGLIDF
Sbjct: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180
           MNTRLQNRL E EILNI+SQ  QG++AMHALQP LIHRDIKIENVLIS  G++K+CDFGS
Sbjct: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180

Query: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240
           VC  IRPP+NPQE AYVQHDVLKNTTAQYR+PEM+DLYRG PI+EKSDIWALGVFLYKLC
Sbjct: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300
           YYTTPFEKGGE AILHSR+Q+PA PIY+D+LK LIR  LME+P +RPN+CQ+LE++SR+Q
Sbjct: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300

Query: 301 GIQCPVRNFYLLRAMEQQ 318
           GI CP+ NFYL R +  Q
Sbjct: 301 GIPCPINNFYLSRTINVQ 318

>KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {ON}
           Anc_2.284 YNL020C
          Length = 780

 Score =  540 bits (1390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/347 (71%), Positives = 291/347 (83%), Gaps = 12/347 (3%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60
           MN P+I  +  G +LTVGSHHAKVI YLTSGG+AQVY  EI P+D +I+SN+ACLKRVIV
Sbjct: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120
           PDKPSLNTLRAEVDAMKLL+NN+HVVSYIDSHA+KS+  NG+YEVF+LME+C  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180
           MN+RLQ+RL E EIL IMS  +QGIAAMH LQP L+HRDIKIENVLIS   +YKVCDFGS
Sbjct: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180

Query: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240
           VCG++RPP+N QEF +V HD++KNTTAQYRSPEM+DL +G PI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEK-GGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRM 299
           YYTTPFEK GGE AIL +RFQ+P+ P+YSDRLK LIR ML +NP  RPNVCQVLE+VSR+
Sbjct: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300

Query: 300 QGIQCPVRNFYLLRAMEQQQQSTQNQLRYSRTQPVLNVPI---ISQP 343
           QGI CP+RNFYLLRAME  +++ +        QPV NV +   +SQP
Sbjct: 301 QGIPCPIRNFYLLRAMENNKRTIE--------QPVQNVYMPTTLSQP 339

>Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii ADL217W
          Length = 748

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/470 (58%), Positives = 330/470 (70%), Gaps = 21/470 (4%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60
           MNQ    ++ PGTVLTVGSH  KV+ YLTSGGFAQ+Y  E+   D+ +  +VACLKRV V
Sbjct: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVK-DVACLKRVHV 59

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120
           PDK SLNTLRAEVDAMKLLR NKH+VSYIDSHA+KS   NGSYEV LLMEYC+ GGLI F
Sbjct: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180
           MNTRLQ+RL+EFE+L IM+QV QGI AMHALQPPLIHRDIKIENVLI+  G  KVCDFGS
Sbjct: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179

Query: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240
           VCGVIRPP+N  E +YVQHD+LKNTTAQYR+PEMIDLYRG  +DEKSDIWALGVFLYKLC
Sbjct: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300
           YYTTPFEK GE+AIL + FQFP+ P YS+RLK LI  ML ENP  RPN CQVLE+V R+Q
Sbjct: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299

Query: 301 GIQCPVRNFYLLRAMEQQQQSTQNQLRYSRTQPV--LNVPIISQPVGFPMHQISGAP--- 355
           G  CPV+NFYL R+++QQ  S   QLR+S +QP+  +N      P+  P  Q S  P   
Sbjct: 300 GQPCPVKNFYLERSLKQQIPS---QLRHSVSQPMIAMNPQQAKIPIVIPQVQNSVLPSNT 356

Query: 356 --LGSSTSHIVPSN---------SVPILAARPRSAGSNGTGRSFQTPXXXXXXXXXXQTF 404
             +G  T    P++         ++ +  A+  S   +        P          ++ 
Sbjct: 357 MNMGYVTGAFQPASQPNEVRGDTALRVSKAKLLSTACDWDKTQNFVPGSNYNSKASVESG 416

Query: 405 HRAASRSPVSTHLSTSPVRHGRGNISQIVESNRTSFDRPRYVDSVTQTSD 454
           H   S  P +   S SPVR GRGNI++I+ +N  +  RP YVDS  QT+D
Sbjct: 417 HLPTSSLP-TPRSSVSPVRSGRGNINKIIAANPINIKRPVYVDSEMQTTD 465

>NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284
          Length = 621

 Score =  525 bits (1351), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 248/347 (71%), Positives = 284/347 (81%), Gaps = 6/347 (1%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60
           MNQP++  Y+PGT+L+VGSH A++I YLTSGGFAQVY+AEI P D FI+S++ CLKRVIV
Sbjct: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120
           PDKPSLNTLRAEVDAMKLLRNN HVVSYIDSHAAK     GSYEVFLLMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180
           MNTRLQNRL E EIL+IMSQV+QG+AAMHALQPPL+HRDIKIENVL++  G YK+CDFGS
Sbjct: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180

Query: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240
           VCG+IRPP NPQEF YVQHD++KNTTAQYRSPEMI+L +G PI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300
           YYTTPFEK GE AILH+ FQFP  P YSDR+K LIR  L   P QRPN+ Q+LE+VS++Q
Sbjct: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300

Query: 301 GIQCPVRNFYLLRAMEQQQQSTQNQLRYSRTQPVLNVPIISQPVGFP 347
            + CP+ +FYL R + Q Q  T           V+NVPI S PV  P
Sbjct: 301 NVPCPIPDFYLQRKLAQAQAQT------QAQDVVMNVPIPSYPVAIP 341

>NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {ON}
           Anc_2.284
          Length = 756

 Score =  528 bits (1359), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 253/380 (66%), Positives = 300/380 (78%), Gaps = 10/380 (2%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60
           MNQP IP Y  GT+LTVG+H A +  YLTSGGFAQ+Y+ EI P D +  SNVACLKRVIV
Sbjct: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120
           P K  LNTLRAEVDAMKLL+NN+HVVSYIDS+A KS+F NGSYEV LLMEYC GGGLIDF
Sbjct: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180
           MN+RLQNRL E EILNI+SQ  QG+A MHALQP L+HRDIKIENVL S  G++K+CDFGS
Sbjct: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180

Query: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240
           VCG IRPP+N QE +YVQHD+LKNTTAQYR PEM+DLYRG PIDEKSDIWALGVFLYKLC
Sbjct: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300
           YYTTPFEK GE AILHS+FQ+PA PIYSDRLK LIR ML ENP +RPN+C++LE++S +Q
Sbjct: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300

Query: 301 GIQCPVRNFYLLRAMEQQQQSTQNQLRYSRTQPVLNVPIISQPVGFPMHQISGAPL---G 357
           G+ CP++NFYL+RA   QQ + Q QL+   T P +     +QP+     +    P+    
Sbjct: 301 GVPCPIQNFYLIRA---QQLANQIQLQRQTTVPKI---ATAQPIQQLNARTQTMPIINTK 354

Query: 358 SSTSHIVPSNSVPILAARPR 377
           ++TS + P  +VP+L+   R
Sbjct: 355 ANTSLVTPI-TVPVLSENTR 373

>TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.284
           YNL020C
          Length = 697

 Score =  524 bits (1350), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 240/321 (74%), Positives = 273/321 (85%), Gaps = 4/321 (1%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60
           MNQPEIP Y PG +L VGSH AK++ YLTSGGFAQVY  EI P D    SN+ACLKRVIV
Sbjct: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKS----SFPNGSYEVFLLMEYCAGGG 116
           PDK SLN  RAEV+AMKLLRNNK+VVSYIDSHAAKS      PNGSYEVFLLMEYC+G G
Sbjct: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120

Query: 117 LIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVC 176
           LIDFMNTRLQNRL+EFEILNIMS V+QG+AAMHALQPPL+HRDIKIENVLIS+  ++K+C
Sbjct: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180

Query: 177 DFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFL 236
           DFGSVCGVIRPP N  E  +VQHD+LKNTTAQYRSPEM+ L +  PI+EKSDIWALGVFL
Sbjct: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240

Query: 237 YKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDV 296
           YK+CYYTTPFEK GE AILHSR+Q+PA P YSD LK LIR MLM +P +RPN+CQV+E+V
Sbjct: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300

Query: 297 SRMQGIQCPVRNFYLLRAMEQ 317
           SR+QG+ CP++NFYL RA+ Q
Sbjct: 301 SRLQGVPCPLKNFYLERAIRQ 321

>CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095w PRK1
          Length = 688

 Score =  521 bits (1342), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 244/323 (75%), Positives = 271/323 (83%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60
           MNQPE+   N GT LTVG+H  K++ YLTSGGFAQ+Y+ EI     F  SNVACLKRV V
Sbjct: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120
           PDK SLN LRAEVDAMKLL NNKHVVSYIDSHA +S   +G+YEVFLLMEYC GGGLIDF
Sbjct: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180
           MNTRLQNRL E EIL+IMSQ TQGIA MHAL PPL+HRDIKIENVL+S  G YKVCDFGS
Sbjct: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180

Query: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240
           V GVIRPP+N QE  YVQHD++KNTTAQYR PEM+DLYRG PIDEK+DIWALGVFLYKLC
Sbjct: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300
           YYTTPFEK GE AILH+RFQFP+ P YSDRLK LI+ ML E+P  RPNVCQVLE+VSRMQ
Sbjct: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300

Query: 301 GIQCPVRNFYLLRAMEQQQQSTQ 323
            + CP+RNFYLLRAME+ + ST+
Sbjct: 301 NVPCPIRNFYLLRAMEKVKLSTE 323

>Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON}
           (89266..91407) [2142 nt, 714 aa]
          Length = 713

 Score =  520 bits (1339), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 237/315 (75%), Positives = 270/315 (85%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60
           MNQP+IP Y  G  L VG HHA ++ YLTSGG+AQVY A+I P D+   S++ CLKR+IV
Sbjct: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120
           PDK SLNT RAEVDAMKLLRN  HVVSYIDS+AAKS   NG+YEV LLME+CA GGLIDF
Sbjct: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180
           MNTRLQNRLQEFEILNIMSQVTQG+AAMH+L+PPL+HRDIKIENVLIS++G+YK+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180

Query: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240
           VCGVIRPP + QEF +VQHD+LKNTTAQYR+PEMIDL R  PIDEKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300
           YYTTPFEK GE AILHSR+++ A P YSD LK LIR ML   P QRPN+CQVLE+VSR+Q
Sbjct: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300

Query: 301 GIQCPVRNFYLLRAM 315
           GI CP++NFYL RA+
Sbjct: 301 GIPCPIKNFYLERAI 315

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 67/150 (44%), Gaps = 8/150 (5%)

Query: 425 GRGNISQIVESNRTSFDRPRYVDSVTQTSDTEEEPLKVASKSSVSLPARESHAVADXXXX 484
           GRG+IS+IV SN T FD+    + V  T    E    +AS+   SL  +     +     
Sbjct: 461 GRGDISKIVASNPTLFDKTSKSE-VNSTGSLAENIASIASEKISSLKNQNLSQSSSTGSS 519

Query: 485 XXXXXXXXXXXXXERPAVAPKQQVA---VPHTKLEHIYAAKIPTGRQSLRQESEIEIPLT 541
                               K+  A   +P +K +H     +P+   S  +    E  LT
Sbjct: 520 HRSIIVNDGDLTKLEKVQTSKEFEADSPIPVSKAKH---HSLPSNFSSSIKIGNGEGTLT 576

Query: 542 SVRSREA-KESIQRRVRDLLNSSEDLPLSK 570
           +  S ++   SIQ R+++L+++++++P++K
Sbjct: 577 TSDSNQSDNNSIQDRMKNLIDNADNIPINK 606

>YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON}
           ARK1Serine/threonine protein kinase involved in
           regulation of the cortical actin cytoskeleton; involved
           in control of endocytosis
          Length = 638

 Score =  510 bits (1313), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 232/314 (73%), Positives = 270/314 (85%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60
           MNQP+I  YN GT LTVGSH  ++I YLTSGGFAQVYSA I P D   +S+VACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120
           PDKPSLNTLRAEVDAM+LL+NN++VVSYIDSHAAK+   NGSYEVF+LMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180
           MNTRLQNRL EFEIL IMSQVTQG+AAMHALQPPLIHRDIKIENVLIS   +YK+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240
           VCG+IRPP+N QE +YVQ D+LKNTTAQYRSPEMID +RG PIDEKSDIWALG+FLYKLC
Sbjct: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300
           YYTTPFEKGG+LAIL  +F+FP  P YS++LKGLIR +L+++P  RPNV Q+L+ +S MQ
Sbjct: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300

Query: 301 GIQCPVRNFYLLRA 314
            + CP+ +  +++A
Sbjct: 301 NVPCPINDIQVVQA 314

>Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {ON}
           YNL020C (REAL)
          Length = 639

 Score =  508 bits (1308), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 238/346 (68%), Positives = 275/346 (79%), Gaps = 7/346 (2%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60
           MNQP+I  YN GT LTVGSH  +++ YLTSGGFAQVYSA I P D    SN+ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIVKYLTSGGFAQVYSALISPPDPHSHSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120
           PDKPSLNTLRAEVDAM+LLRNN++VVSYIDSHAAK+   NGSYEVF+LMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLRNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180
           MNTRLQNRL EFEIL IMSQVTQG+AAMHALQPPLIHRDIKIENVLIS   +YK+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240
           VCGVIRPP+NPQE +YVQ D+ KNTTAQYRSPEM+D++RG PIDEKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVQQDIFKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300
           YYTTPFEKGGE AIL   F+FP  P YS++L+ LIR +L++NP QRPNV Q+L+ +S MQ
Sbjct: 241 YYTTPFEKGGEPAILSGHFEFPPYPDYSEQLRDLIRDILVQNPCQRPNVYQLLKRISIMQ 300

Query: 301 GIQCPVRNFYL-------LRAMEQQQQSTQNQLRYSRTQPVLNVPI 339
            + CP+ +  +       L   E  Q S    +R   +   +  PI
Sbjct: 301 NVPCPISDIQVPQAPDSHLNLTELHQLSATQNIRSLNSHSTIERPI 346

>Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {ON}
           YNL020C (REAL)
          Length = 637

 Score =  503 bits (1294), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 248/422 (58%), Positives = 298/422 (70%), Gaps = 34/422 (8%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60
           MNQP+I  YN GT LTVGSH  ++I YLTSGGFAQVYS  I P D   ++NVACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120
           PDKPSLNTLRAEVDAM+LL+NN++VVSYIDSHAAK+   NGSYEVF+LMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180
           MNTRLQNRL EFEIL I+SQVTQG+AAMHALQPPLIHRDIKIENVLIS   +YK+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180

Query: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240
           VCG+IR P+N QE +YVQ D+LKNTTAQYRSPEMID++RG PIDEKSDIWALG+FLYKLC
Sbjct: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300
           YYTTPFEKGGE AIL  +F+FP  P YS++LK LIR +L++NP  RP+V Q+L+ +S MQ
Sbjct: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300

Query: 301 GIQCPVRNFYLLRAMEQQQQSTQNQLRYSRTQPVLNVPIISQPVGFPMHQISGAP-LGSS 359
            + CP+ +   ++A       T+                        +HQ+S    + S 
Sbjct: 301 NVPCPINDIQTVQAPSSHLNLTE------------------------LHQLSATQNIQSL 336

Query: 360 TSHIVPSNSVPILAARPRSAGSNGTGRS---------FQTPXXXXXXXXXXQTFHRAASR 410
            SH+V  NS+P  A +  +  +  T ++         F  P             + A SR
Sbjct: 337 NSHLVMGNSIPTTAFQFSTPVNMATAQTLPIKEESNIFYDPTSCNFAKDSQSRLNNALSR 396

Query: 411 SP 412
           SP
Sbjct: 397 SP 398

>TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON}
           Anc_2.284 YNL020C
          Length = 717

 Score =  504 bits (1297), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 228/323 (70%), Positives = 267/323 (82%), Gaps = 5/323 (1%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60
           MNQP I NY+PGT L VG H   +I YLTSGGFAQ+Y  ++ P +     N+ACLKRVIV
Sbjct: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120
           P+K  LNTLRAEV+AM+LL+   HVV YIDS+AA+S   +G+YEV  LME+C GGGLIDF
Sbjct: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180
           MNTRLQNRL+EFE+LNIM+QVTQGI AMH+L PPLIHRDIKIENVLIS  G+YKVCDFGS
Sbjct: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180

Query: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240
           V G+IRPP+N +EF +VQ D++KNTTAQYR PEM+DLYRG PI+EKSDIWALGVFLYK+C
Sbjct: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300
           YYTTPFE GGE AILH+R+Q+P  P+YS RLK LIR MLME P+QRPNVCQVLE+VS MQ
Sbjct: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300

Query: 301 GIQCPVRNFYLLRAMEQQQQSTQ 323
           GI CP+ NFYL     Q+QQ+TQ
Sbjct: 301 GIPCPLPNFYL-----QRQQATQ 318

>Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {ON}
           YNL020C (REAL)
          Length = 632

 Score =  498 bits (1283), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 237/332 (71%), Positives = 272/332 (81%), Gaps = 8/332 (2%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60
           MNQP+I  YN GT LTVGSH  ++I YLTSGGFAQVYSA I P D   +SNVACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120
           PDK SLNTLRAEVDAMKLLRNN++VVSYIDSHAAK++  NGSYEVF+LMEYC  GGLIDF
Sbjct: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180
           MNTRLQNRL E EIL IM QVTQG+AAMHALQPPLIHRDIKIENVLIS   +YK+CDFGS
Sbjct: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180

Query: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240
           VCGVIRPP+NPQE +YV+ DVLKNTTAQYRSPEM+D++RG PIDEKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300
           YYTTPFEKGGE AIL+ +F+F   P YS++L+ LI ++L++NP QRPNV Q+L+ ++ MQ
Sbjct: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300

Query: 301 GIQCPVRNFYL-------LRAMEQQQQS-TQN 324
               P+R+          L  ME  Q S TQN
Sbjct: 301 NAPYPIRDVQTVQRPSNHLNLMELHQNSATQN 332

>ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL095W (PRK1) and
           YNL020C (ARK1)
          Length = 750

 Score =  494 bits (1271), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 263/476 (55%), Positives = 323/476 (67%), Gaps = 28/476 (5%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60
           MNQ       PG +LTVGSH  K+I YLTSGGFAQ+YS E+  +   I  ++ACLKRV V
Sbjct: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVL-SPGPIQGSLACLKRVHV 59

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120
           PDKPSLNTLRAEVDAMK+L+ ++HVVSYIDSHAAKS   +G+YEV+LLMEYC  GGLIDF
Sbjct: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180
           MN+RLQ RL EFE+L IMS V QGI AMHAL PPLIHRDIKIENVLIS  G +KVCDFGS
Sbjct: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179

Query: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240
           V GVIRPP+N  EF YVQHD+LKNTTAQYR+PEMIDLYR  P+DEKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239

Query: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300
           Y+TTPFEK GE AIL ++FQFP+ P Y+DRLK LI  ML E+P QRPN+CQVLE+VSR+Q
Sbjct: 240 YFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQ 299

Query: 301 GIQCPVRNFYLLRAMEQQQQSTQNQLRYSRTQPVL---------NVPIISQPVGFPMHQI 351
           G+ CP+ NFYL    E+ +      + +S +QP L         + P+++ P   P +Q+
Sbjct: 300 GVPCPLPNFYL----ERMKHGACTPVHHSASQPALPLATHQFSTSTPMVTHPQP-PANQM 354

Query: 352 SGAPLGSS--TSHIV--PSNSVPILAARPR---SAGSNGTGRSFQTPXXXXXXXXXXQTF 404
           S  P G    TS++V    N+ P +   PR   +A          +             F
Sbjct: 355 SPLPHGIQPITSNMVYMMHNTTPNIKDIPRENPAATIQKNALYSMSGSEHLSALSSDMHF 414

Query: 405 HR-----AASRSPVSTHLSTSPVRHGRGNISQIVESN-RTSFDRPRYVDSVTQTSD 454
           +R     + + S V    S++P++  R  I + +     TS  +P YVDS TQT D
Sbjct: 415 NRPQLENSHTFSGVGPRSSSNPIKIPRNEIQKFLSGTPPTSAKKPTYVDSETQTGD 470

>KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {ON}
           Anc_2.284 YNL020C
          Length = 592

 Score =  486 bits (1252), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 220/323 (68%), Positives = 261/323 (80%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60
           MNQP I  Y  GT LTVGSH  ++I YLT+GGFAQ+Y   I P D F  +N+ACLKRVIV
Sbjct: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120
           PDKPSLN LRAEVDAMKLLRNN+ VVSYIDSHAAKSSF NG+YEVFLLMEYC  GGLI+F
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180
           +N+RLQNRL+E E++NIM  V+QG+AAMHALQPPL+HRDIKIENVL+S   ++K+CDFGS
Sbjct: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180

Query: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240
           V G IRPP NPQE A VQ+D+++NTTAQYRSPEMID+ RG PIDEKSDIWALGVFLYK+C
Sbjct: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300
           YYTTPFEK GE  IL SR++FPA P YSDRL+ LI ++L   P+ RPN+  V++++S M+
Sbjct: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300

Query: 301 GIQCPVRNFYLLRAMEQQQQSTQ 323
            I CP+ NFYL   M     + Q
Sbjct: 301 NISCPIINFYLKPNMTDASNNIQ 323

>Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa]
           {ON} complement(102096..104201) [2106 nt, 702 aa]
          Length = 701

 Score =  484 bits (1245), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 217/316 (68%), Positives = 268/316 (84%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60
           MNQ ++P Y P TV+TVGSH AK++ YL SGG+AQVYSA + P D    +N+ACLKRV+V
Sbjct: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120
           PDK SLN LRAEVDA+K+LRN K+VVSYIDSHA+K S   GSYEVF+LMEYC+GG LIDF
Sbjct: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180
           +NTRL+NRL+E EIL+IM+QV  G+A MH LQP LIHRDIKIEN+LIS  G+YKVCDFGS
Sbjct: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180

Query: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240
           VCGVIRPP++ +E  Y+QHD++KNTTAQYRSPEM+DL +G+ I+EKSDIWALGVFL+KLC
Sbjct: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240

Query: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300
           YYTTPFEK GE AIL S+FQ+PA P+YSD LK +IR +L  +P +RPN+CQ++E++SR+Q
Sbjct: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300

Query: 301 GIQCPVRNFYLLRAME 316
           GI  P++NFYL RA+E
Sbjct: 301 GIVPPMKNFYLSRALE 316

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 19/21 (90%)

Query: 545 SREAKESIQRRVRDLLNSSED 565
           +REAK+SI+RRVR+LL  SED
Sbjct: 607 TREAKDSIKRRVRELLLVSED 627

>KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {ON}
           Anc_2.284 YNL020C
          Length = 788

 Score =  458 bits (1179), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 213/320 (66%), Positives = 257/320 (80%), Gaps = 6/320 (1%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60
           MNQP IPNY PG V+ VGSH AK++ YLTSGGFAQ+YS EI P D + +SN+ACLKRVIV
Sbjct: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120
           P+K  LN LR EVDAMKLL+NN+HVVSYIDS+AAKS F NGSYEVFLLMEYC  G L+DF
Sbjct: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180
           MNT+L+ RLQE E+LNIM+QV QGIAAMH L PPLIHRDIKIENVLIS  G +KVCDFGS
Sbjct: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180

Query: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKS---DIWALGVFLY 237
           VCG+IRPP+NPQE  YVQHDV+KNTTAQYRSPEMIDL +G PI+ K      W + + + 
Sbjct: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240

Query: 238 KLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVS 297
            L +YT  F +  E+AIL+ R+Q+PA PIYSDRLK ++R +L  +P +RPN+CQ+LE++S
Sbjct: 241 -LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEIS 297

Query: 298 RMQGIQCPVRNFYLLRAMEQ 317
           ++Q I CP+ NFYL R+  Q
Sbjct: 298 KIQNIPCPIDNFYLERSRHQ 317

>TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON}
           Anc_2.284 YNL020C
          Length = 1443

 Score =  474 bits (1221), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 216/333 (64%), Positives = 256/333 (76%), Gaps = 14/333 (4%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSN--------V 52
           MNQPEIP Y  G VL +G+H   +  YL  GGFAQVYS  +      IDS+        +
Sbjct: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRV------IDSSNARNELGTM 54

Query: 53  ACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYC 112
           ACLKRVIVPDK  LNTLRAEVDAMKLL+ NK++VSYIDSHA +S    G YEVFLLMEYC
Sbjct: 55  ACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYC 114

Query: 113 AGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQ 172
           + GG+IDF+NTRL +RLQEFEIL IMS V QG+AAMH LQPPLIHRDIKIENVLIS  G 
Sbjct: 115 SRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGD 174

Query: 173 YKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWAL 232
           YK+CDFGS C V+RPP+ PQE A++ HD++ NTTAQYRSPEMID Y G+PIDEKSDIWAL
Sbjct: 175 YKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWAL 234

Query: 233 GVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQV 292
           GVFLYKLCYYTTPFEK GE AIL+ +FQFP+ P YSD ++ +I  ML ++P +RPN+CQV
Sbjct: 235 GVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV 294

Query: 293 LEDVSRMQGIQCPVRNFYLLRAMEQQQQSTQNQ 325
           LE VS++QG+ CP+ NF L R   Q  ++  N+
Sbjct: 295 LEQVSKLQGVPCPIENFMLTRIKLQNSRNNSNK 327

>CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} similar
           to uniprot|P53974 Saccharomyces cerevisiae YNL020c ARK1
           or uniprot|P40494 Saccharomyces cerevisiae YIL095w PRK1
          Length = 622

 Score =  451 bits (1160), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 200/311 (64%), Positives = 252/311 (81%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60
           MN P IP Y PGT +TVGSH   ++ YLTSGG+AQ+YSA+I PAD F+ +N+A LKRVIV
Sbjct: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120
           PDK  LNTLRAEVDAMK L+++K++VSYIDSHAAKS + +G+YEVFL+MEYC+ GGLIDF
Sbjct: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180
           MNTRLQNRL E EIL I   ++QG+AAMH LQPPLIHRDIKIENVLIS+  +YK+CDFGS
Sbjct: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180

Query: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240
           V G IRPP+ P+E AYV+HD++ +TTAQYR+PEM+DL +G  +++KSDIWALGVFLYKLC
Sbjct: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300
           YYTTPFE+ GE  IL+   +FP  P YSD +K LI  ML +NP  RPN+ Q+++ VS++ 
Sbjct: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300

Query: 301 GIQCPVRNFYL 311
            + CP+ N ++
Sbjct: 301 NVNCPIPNIHV 311

>TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {ON}
           Anc_2.284 YNL020C
          Length = 707

 Score =  415 bits (1067), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 196/336 (58%), Positives = 245/336 (72%), Gaps = 4/336 (1%)

Query: 9   YNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNT 68
           Y  GT L V SH   + +YLTSGGFAQVY+A I      +   + CLKRVIVP+K SLN 
Sbjct: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNI 68

Query: 69  LRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNR 128
           LRAEVDAMK+L+NNK++VSYIDSHA +      SY V LLMEYC+G GL+DFMN RL+ R
Sbjct: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNLRLKER 128

Query: 129 LQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPP 188
           L+E EIL IM+ V+QG+  MH LQPPL+HRDIKIENVL+S  G +K+CDFGSV GV+R P
Sbjct: 129 LKEEEILKIMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP 188

Query: 189 QNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEK 248
            + +EF Y+Q+D+LKNTTAQYRSPEM++L  G PI+EKSDIWALG+ LYKLCYYTTPFE+
Sbjct: 189 TSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE 248

Query: 249 GGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQGIQCPVRN 308
            G  AI+  +F +PA P Y+D LK +IR +L  NP QRPN+CQ+LE++ R+Q    P+ N
Sbjct: 249 HGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPLPN 308

Query: 309 FYLLRAMEQQQQSTQNQLRYSRTQPVLNVPIISQPV 344
           FY+ RAM   Q  T    R     P+L    +S+PV
Sbjct: 309 FYVQRAMSSLQMDTTQPHRI----PILKYTQMSKPV 340

>KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {ON}
           Anc_3.273 YBR059C
          Length = 912

 Score =  318 bits (815), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 160/323 (49%), Positives = 203/323 (62%), Gaps = 22/323 (6%)

Query: 9   YNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEI------------QPADAFID------- 49
           +NPG V+ VG H  ++I YL  GGFAQ+YS                  D+ ID       
Sbjct: 19  FNPGAVVAVGRHKVEIIKYLAEGGFAQIYSVNFIEYLNEFSNEPDSTEDSNIDEFQQFKL 78

Query: 50  --SNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFL 107
              N+ACLKRV+VPD+  LN LR EV+ M+ L+   ++V Y DS+A++    N  +EV L
Sbjct: 79  EPGNLACLKRVMVPDENGLNELRNEVNVMRKLKGTPNIVQYYDSNASRRHDGNPGFEVLL 138

Query: 108 LMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLI 167
           LME C    L+D+MN RL  +L E EIL IM  VT GI+ MH LQ PLIHRDIKIENVL+
Sbjct: 139 LMELCPNNSLLDYMNQRLTTKLSEKEILKIMYDVTLGISQMHYLQKPLIHRDIKIENVLV 198

Query: 168 SHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKS 227
             +  +K+CDFGS         + QE A +  ++  +TT QYRSPEMIDLYR  PIDEKS
Sbjct: 199 DSSNNFKLCDFGSTSACFPIVTSHQEIAVLTQNIYVHTTPQYRSPEMIDLYRNLPIDEKS 258

Query: 228 DIWALGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRP 287
           DIWALGVFLYKL +YTTPFE  G+ AILHS+++ P    YS RL  LI  ML ENP+ RP
Sbjct: 259 DIWALGVFLYKLLFYTTPFEMTGQFAILHSKYEIPPNN-YSSRLINLIIIMLAENPNLRP 317

Query: 288 NVCQVLEDVSRMQGIQCPVRNFY 310
           N+ QV+  V    GI+ P+++ Y
Sbjct: 318 NIYQVMHQVCITIGIEPPIKDKY 340

>KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa]
           {ON} Anc_3.273 YBR059C
          Length = 1091

 Score =  316 bits (809), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 186/452 (41%), Positives = 255/452 (56%), Gaps = 72/452 (15%)

Query: 6   IPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDS--------------- 50
           I  ++ G  + VGSH  +++ YLT GGFAQ+Y  ++       D+               
Sbjct: 26  IEKFSAGESVAVGSHGVEIVKYLTEGGFAQIYLVKLTEYLNEFDAIDIQNQRQQQELKIG 85

Query: 51  NVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLME 110
           ++ CLKRV+V D+  L+ ++ EV+ MK LR   +VV Y DS+A ++   NG +EVFLLME
Sbjct: 86  DLVCLKRVMVYDEAGLSEMKNEVNVMKQLRGKPNVVQYYDSNATRNRGANGGFEVFLLME 145

Query: 111 YCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHT 170
           YC    L+D+MN RL  +L E EILNIM  +T G++ +H L  PLIHRDIKIENVL+ H 
Sbjct: 146 YCPNKSLLDYMNQRLTTKLTESEILNIMYDITLGVSQLHFLDNPLIHRDIKIENVLVDHN 205

Query: 171 GQYKVCDFGSVCGVIRPP--QNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSD 228
            ++K+CDFGS    I PP     Q+ + + HD+  +TT QYRSPEMIDL+R  P++EK+D
Sbjct: 206 NRFKLCDFGSTN--ICPPIATTNQDISVLTHDIYVHTTPQYRSPEMIDLFRCLPVNEKAD 263

Query: 229 IWALGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPN 288
           IWALGVFLYKL +YTTPFE  G+ AILHS+++ P Q  YS+RL  LI  ML ENP+ RPN
Sbjct: 264 IWALGVFLYKLLFYTTPFELTGQFAILHSKYEIP-QSHYSERLLNLIVVMLAENPNLRPN 322

Query: 289 VCQVLEDVSRMQGIQCP--------VRNFYLLRAMEQQQQSTQNQL-------RYSRTQP 333
           + QVL ++  +  ++ P        V NF      +++ Q  Q+QL         SR+QP
Sbjct: 323 IYQVLSEICSILNVEVPIPDIYGAGVFNFNNFALFQKKVQKIQSQLFQMVQDRTKSRSQP 382

Query: 334 -------VLN---------VPIISQP----------VGFPMHQ---ISGAPLGSSTSHIV 364
                  VLN          P ++ P            FP ++    S   L   TSH +
Sbjct: 383 APTSNEDVLNDLYVSYFDVAPKLTNPHLENENSADKTTFPDNRKSITSEDRLSRHTSHTL 442

Query: 365 PS-NSVPILAARPRSAGS-------NGTGRSF 388
            S  SVP     P++AGS       NG GR +
Sbjct: 443 DSYKSVPTTVTFPQTAGSDQANHKANGEGRYY 474

>SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 858

 Score =  307 bits (786), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 150/315 (47%), Positives = 203/315 (64%), Gaps = 9/315 (2%)

Query: 4   PEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVY-------SAEIQ-PADAFIDSNVACL 55
           P +    PGT++ VGSH  +++ YL  GGFA +Y       S E++ P+ +  + ++ACL
Sbjct: 27  PTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACL 86

Query: 56  KRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGG 115
           KRV+V D+  LN LR EV+ MK L+N+ ++V Y DS+A++    +  YEV LLME C   
Sbjct: 87  KRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNK 146

Query: 116 GLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKV 175
            L+D+MN RL  +L E E+L IM  VT+ +A MH L  PLIHRDIKIENVL+     +K+
Sbjct: 147 SLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKL 206

Query: 176 CDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVF 235
           CDFGS           Q+ A + +++  +TT QYR+PEMIDLYR  PIDEKSDIWALG+F
Sbjct: 207 CDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIF 266

Query: 236 LYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLED 295
           LYKL +YTTPFE  G+ AILHS++  PA   YS +L  LI  ML ENP+ RPN+ QV+  
Sbjct: 267 LYKLLFYTTPFELTGQFAILHSKYDIPANN-YSSKLINLIIIMLAENPNLRPNIYQVIYQ 325

Query: 296 VSRMQGIQCPVRNFY 310
           V  +  +  P  + Y
Sbjct: 326 VCAIMKVDVPFEDKY 340

>Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON}
           (72364..75669) [3306 nt, 1102 aa]
          Length = 1101

 Score =  308 bits (790), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 166/391 (42%), Positives = 222/391 (56%), Gaps = 22/391 (5%)

Query: 12  GTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSN----------VACLKRVIVP 61
           G+ + VG+   +++ YLT GGFAQ+Y  +        DSN          +ACLKRV+V 
Sbjct: 28  GSTVVVGNKKVEIVKYLTEGGFAQIYIVKFLENSNEFDSNNSNIPLKIGDLACLKRVLVQ 87

Query: 62  DKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFM 121
           D+  LN +R EV+ MKLL+   ++V Y DS+A++       +EV LLME C    L+DFM
Sbjct: 88  DENGLNEMRNEVEVMKLLKGAPNIVQYFDSNASRRKDGTNGFEVLLLMELCPNKSLLDFM 147

Query: 122 NTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSV 181
           N RL  +L E EIL IM  VT  +A MH L PPLIHRDIKIENVL+     +K+ DFGS 
Sbjct: 148 NQRLTTKLSEKEILTIMHDVTLAVAQMHTLSPPLIHRDIKIENVLVDSQNGFKLADFGST 207

Query: 182 CGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCY 241
                     Q+ A +  D+  +TT QYRSPEMIDLY+  PIDEKSDIWALG+FLYKL +
Sbjct: 208 SKCFPAVSAHQDIAILSQDIFMHTTPQYRSPEMIDLYKCLPIDEKSDIWALGIFLYKLLF 267

Query: 242 YTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQG 301
           Y TPFE  G+ AILHS++ FP Q  YS RL  LI  ML ENP+ RPN+ QVL ++  + G
Sbjct: 268 YITPFEMTGQFAILHSKYDFP-QTNYSSRLINLIIIMLSENPNLRPNIYQVLHEICSISG 326

Query: 302 IQCPVR--------NFYLLRAMEQQQQSTQNQLRYSRTQPVLNVPIISQPVGFPMHQISG 353
            +  +         NF   R  + + QS Q Q+   + +   N   ++Q     ++ +  
Sbjct: 327 TRLEITDKYGQGPYNFDQFRKFQNELQSLQVQMFNLQQRKTENDGKLNQSDEILLNNLYT 386

Query: 354 APLGSSTSHIVPSNSVPILAARPRSAGSNGT 384
           +    S    + SNS+P       S GSN  
Sbjct: 387 STFELSPKIPIDSNSIPNTTI---STGSNSN 414

>CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P38080 Saccharomyces cerevisiae
           YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 1027

 Score =  306 bits (783), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 155/369 (42%), Positives = 225/369 (60%), Gaps = 19/369 (5%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAE----------IQPADAFIDS 50
           +N P    Y  G +++VG+H  +++SYL  GGFAQ+Y  +          +    A    
Sbjct: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71

Query: 51  NVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLME 110
           ++ACLKRVIV D+  LN +R EV+ MK L+++ ++V Y DS+A++ +     +EV LLME
Sbjct: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131

Query: 111 YCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHT 170
            C    L+D+MN RL+ +L E EIL IM  V+ GI+ MH L  PLIHRDIKIENVL+   
Sbjct: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191

Query: 171 GQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIW 230
             +K+CD GS      P  + Q+ A +  ++  +TT QYR+PEMIDLYR  PI+EKSDIW
Sbjct: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIW 251

Query: 231 ALGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVC 290
           ALG+FLYKL +YTTPFE  G++AILHS++ FP    YS ++  LI  ML ENP+ RPN+ 
Sbjct: 252 ALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPNK-YSSKIINLIIIMLAENPNLRPNIF 310

Query: 291 QVLEDVSRMQGIQCPVR--------NFYLLRAMEQQQQSTQNQLRYSRTQPVLNVPIISQ 342
           QV+  +  +  +  P+         NF L    + + Q+ QNQ+ Y + + V +   +S+
Sbjct: 311 QVVYHICSIMNLPVPIEDRYGLGPYNFDLYTKFQSKVQTIQNQINYLQNKVVSSKSKLSK 370

Query: 343 PVGFPMHQI 351
             G  + ++
Sbjct: 371 EDGLVLDEL 379

>Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)
           [2517 nt, 839 aa]
          Length = 838

 Score =  301 bits (771), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 155/335 (46%), Positives = 207/335 (61%), Gaps = 18/335 (5%)

Query: 9   YNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVA---------CLKRVI 59
           Y PGT++ VG H  +V+ YL  GGFA++Y  +     + +D N           CLKRV+
Sbjct: 29  YVPGTIVIVGIHKVEVVKYLAEGGFAKIYVVKFLEYLSTVDPNGKEVLQNGDQLCLKRVL 88

Query: 60  VPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLID 119
           V D   LN +R EV+ M+ L+    VV Y DS+A++       YEV LLME C+   L+D
Sbjct: 89  VQDDNGLNEMRNEVEVMRKLKGAPCVVQYYDSNASRRIDGAPGYEVLLLMELCSNNSLLD 148

Query: 120 FMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFG 179
           +MN RL  +L E EIL IM  VT  +A MH L  PLIHRDIKIENVL+     +K+CDFG
Sbjct: 149 YMNQRLATKLSEDEILKIMFDVTLAVAQMHYLPSPLIHRDIKIENVLVDSKNNFKLCDFG 208

Query: 180 SVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKL 239
           S    +    + Q+ A +  ++  +TT QYRSPEMIDLYR  P++EKSDIWALGVFLYKL
Sbjct: 209 STSTCLPIVSSHQDIAILTQNIYVHTTPQYRSPEMIDLYRCLPVNEKSDIWALGVFLYKL 268

Query: 240 CYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRM 299
            +YTTPFE+ G+ AILHS+++FP    YS +L  LI  ML ENP+ RPN+ QVL  +  +
Sbjct: 269 MFYTTPFERTGQFAILHSKYEFPLNN-YSSKLINLIIVMLAENPNLRPNIYQVLNQICYI 327

Query: 300 QGIQCPVRNFYLLRA--------MEQQQQSTQNQL 326
            GI+ P+ + Y L A         + + Q+ QNQ+
Sbjct: 328 SGIKNPMDDAYGLGAYSFEKYTEYQSKLQNYQNQM 362

>TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1061

 Score =  305 bits (780), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 156/325 (48%), Positives = 199/325 (61%), Gaps = 27/325 (8%)

Query: 8   NYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAE--------------------IQPADAF 47
           NY  GT + VGSH  +VI Y+  GGFAQ+Y+ +                    +QP D  
Sbjct: 98  NYPAGTPVAVGSHKVEVIKYIAEGGFAQIYTVKFIERLNEFASLPGGNQNQKPLQPGD-- 155

Query: 48  IDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFL 107
               +ACLKRV+V D   LN +R EV+ M+ L+    VV Y DS+A+  S     YEV L
Sbjct: 156 ----IACLKRVLVNDDNGLNEMRNEVNVMQKLQGAPCVVQYYDSNASHRSDSAPGYEVLL 211

Query: 108 LMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLI 167
           LME+C    L+D+MN RL  RL E EI+ IM   T GIA +H L+ PLIHRDIKIENVL+
Sbjct: 212 LMEFCPNNSLLDYMNDRLATRLSEKEIMKIMYDTTLGIAQLHYLKTPLIHRDIKIENVLV 271

Query: 168 SHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKS 227
                +K+CDFGS         N ++ A    ++  NTT QYRSPEMIDLYR  PIDEKS
Sbjct: 272 DQENNFKLCDFGSTSICFPIVTNHRDIAIFTQNIYVNTTPQYRSPEMIDLYRYQPIDEKS 331

Query: 228 DIWALGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRP 287
           DIWALGVFLYKL ++TTPFE+ G+ AILHS+++FP    YS +L  LI  ML ENP  RP
Sbjct: 332 DIWALGVFLYKLLFFTTPFERTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPSVRP 390

Query: 288 NVCQVLEDVSRMQGIQCPVRNFYLL 312
           N+ QVL+ +  + G + P+ + Y L
Sbjct: 391 NIYQVLQYLCSINGWKVPLNDKYGL 415

>KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.273
           YBR059C
          Length = 913

 Score =  301 bits (771), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 155/330 (46%), Positives = 210/330 (63%), Gaps = 24/330 (7%)

Query: 6   IPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAE-IQPADAFID------------SNV 52
           +  Y PG V+ VGSH  +++ Y+  GGFAQ+YS + ++ A+ F               ++
Sbjct: 15  VEKYQPGKVIVVGSHRVEILQYIAEGGFAQIYSVKFLEYANEFDREESPGSKDQLQVGDL 74

Query: 53  ACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGS--------YE 104
           ACLKRVIV D+  LN LR EV+ MK L    ++V Y DS+A++    NG+        +E
Sbjct: 75  ACLKRVIVQDQNGLNELRNEVNVMKKLVGAPNIVQYYDSNASR--LRNGTDSQPQENKFE 132

Query: 105 VFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           V LLME C    L+D+MN RL  +L E EIL +M  V+  IA MH L+ PLIHRDIKIEN
Sbjct: 133 VLLLMELCPNKSLLDYMNLRLATKLSEQEILEVMYDVSLAIAQMHYLRKPLIHRDIKIEN 192

Query: 165 VLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPID 224
           VL+    ++K+CDFGS           ++ AY+  ++  +TT QYRSPEMIDLYR  PID
Sbjct: 193 VLVDQKNRFKLCDFGSTSTCFPMVVTHRDIAYLTQNIYVHTTPQYRSPEMIDLYRCLPID 252

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPD 284
           EKSDIWALG+FLYKL ++TTPFE+ G+ AILHS+F+FP Q  YS +L  LI  ML ENP+
Sbjct: 253 EKSDIWALGIFLYKLLFFTTPFERTGQFAILHSKFEFP-QNNYSFKLINLIIVMLSENPN 311

Query: 285 QRPNVCQVLEDVSRMQGIQCPVRNFYLLRA 314
            RPN+ QVL  + +++ +  P+ + Y L A
Sbjct: 312 LRPNIYQVLHQICQLKQVPIPIADKYGLGA 341

>ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 1115

 Score =  305 bits (780), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 152/327 (46%), Positives = 203/327 (62%), Gaps = 22/327 (6%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYS---------------AEIQPAD 45
           + +P +  Y PGTV+ VG+   ++IS++  GGFAQ+YS               A +QP D
Sbjct: 14  VTKPVVDGYAPGTVVAVGNQQVEIISFIAEGGFAQIYSVKYIKFLGEFNNGSKAPLQPGD 73

Query: 46  AFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEV 105
                 +ACLKRV+VPD+  L+ +R EV+ MK LR  K ++ Y DS+A++ +     YEV
Sbjct: 74  ------IACLKRVLVPDENGLSEMRNEVEVMKQLRGAKAIIQYYDSNASRRTSGQVGYEV 127

Query: 106 FLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENV 165
            LLME C    L+D+MN RL  RL E EIL +M   T  I+ MH L  PLIHRDIKIENV
Sbjct: 128 LLLMELCPNNSLLDYMNQRLATRLTEKEILKVMYDTTLAISQMHYLPIPLIHRDIKIENV 187

Query: 166 LISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDE 225
           L+     +K+CDFGS           Q+ A +  ++  NTT QYRSPEMIDLYR  PI+E
Sbjct: 188 LVDAQNNFKLCDFGSTSTCFPLVTTHQDIAILTQNIYVNTTPQYRSPEMIDLYRCLPINE 247

Query: 226 KSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQ 285
           KSDIWALG+FLYKL ++ TPFE  G+ +ILHS+++FPA   YS +L  LI  ML ENP  
Sbjct: 248 KSDIWALGIFLYKLLFFITPFEMTGQFSILHSKYEFPANK-YSSKLINLIIIMLAENPYV 306

Query: 286 RPNVCQVLEDVSRMQGIQCPVRNFYLL 312
           RPN+ QV+  +  + G + P+ + Y L
Sbjct: 307 RPNIYQVMHHICSVIGCEVPIEDKYGL 333

>NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]
           {ON} Anc_3.273
          Length = 1095

 Score =  301 bits (772), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 150/320 (46%), Positives = 207/320 (64%), Gaps = 15/320 (4%)

Query: 3   QPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAE-IQPADAFIDS---------NV 52
           +P    Y PGT + VG+H  ++I Y+  GGFAQ+Y+ + I+  + F ++         +V
Sbjct: 16  KPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDV 75

Query: 53  ACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAK--SSFPNGSYEVFLLME 110
           ACLKRV+V D+  LN +R EV+ MK L+   ++V Y DS+A++  + FP   +EV LLME
Sbjct: 76  ACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFP--GFEVLLLME 133

Query: 111 YCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHT 170
            C    L+D+MN RL  +L E EIL IM  VT  ++ MH L  PL+HRDIKIENVL+   
Sbjct: 134 LCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQ 193

Query: 171 GQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIW 230
             +K+CDFGS           Q+ A +  ++  +TT QYRSPEMIDLYR  PIDEKSDIW
Sbjct: 194 NNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIW 253

Query: 231 ALGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVC 290
           ALG+FLYKL ++TTPFE  G+ AILHS+++FP    YS +L  LI  ML ENP+ RPN+ 
Sbjct: 254 ALGIFLYKLLFFTTPFELTGQFAILHSKYEFPKNN-YSSKLINLIIIMLAENPNLRPNIY 312

Query: 291 QVLEDVSRMQGIQCPVRNFY 310
           QVL ++  + G++ P+ + Y
Sbjct: 313 QVLHNICSISGMKVPIEDQY 332

>KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 814

 Score =  296 bits (758), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 203/322 (63%), Gaps = 18/322 (5%)

Query: 6   IPN---YNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEI----QPADAFIDS------NV 52
           IPN    +P T + VG+H  +++ +L  GGFA +Y  +        DA IDS      ++
Sbjct: 23  IPNSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDI 82

Query: 53  ACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGS--YEVFLLME 110
           ACLKRVIVPD+  LN LR EV+ MK LR + ++V Y DS+A++   P+GS  +E+ LLME
Sbjct: 83  ACLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASR--HPDGSPGFEILLLME 140

Query: 111 YCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHT 170
            C    L+D+MN +L  +L E EIL IM  V+  IA MH L  PLIHRDIKIENVL+   
Sbjct: 141 LCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKD 200

Query: 171 GQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIW 230
             +K+CDFGS           Q+ A + +++  +TT QYRSPEMIDLYR  PI+EKSDIW
Sbjct: 201 DNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIW 260

Query: 231 ALGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVC 290
           ALG+FLYKL +YTTPFE  G+ AILHS+++ P Q  YS +L  LI  ML ENP  RPN+ 
Sbjct: 261 ALGIFLYKLLFYTTPFELTGQFAILHSKYEIP-QNGYSSKLINLIIIMLAENPSLRPNIY 319

Query: 291 QVLEDVSRMQGIQCPVRNFYLL 312
           QV+  V  +     P  + Y L
Sbjct: 320 QVMHHVCSILKCDVPFTDKYEL 341

>KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}
           Anc_3.273 YBR059C
          Length = 949

 Score =  298 bits (764), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 155/346 (44%), Positives = 209/346 (60%), Gaps = 26/346 (7%)

Query: 6   IPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAE-IQPADAFID--------------- 49
           I  +  G  L VG+H  +++ YLT GGFAQ+Y  + I+  + F +               
Sbjct: 28  IEKFEKGQNLAVGTHKVEIVDYLTEGGFAQIYVVKFIEVLNEFDNEDNGSNVRISNYSLK 87

Query: 50  -SNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLL 108
             +VACLKRV+V D+  LN +R EV+ MK LR   ++V Y DS+A +S   N  YEV LL
Sbjct: 88  LGDVACLKRVLVYDEVGLNEMRNEVNVMKKLRGCPNIVQYYDSNATRSHNGNPGYEVLLL 147

Query: 109 MEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLIS 168
           ME C+   L+++MN RL  +L E E+L IM  VT G+A MH L+ PLIHRDIKIENVL+ 
Sbjct: 148 MELCSNNSLLNYMNQRLATQLSEKEVLKIMYDVTSGVAQMHYLKTPLIHRDIKIENVLVD 207

Query: 169 HTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSD 228
               +K+CDFGS           Q+ A +  +V  +TT QYRSPEMIDLYR  PI+EKSD
Sbjct: 208 SNNNFKLCDFGSATTCPPVATTHQDIALLGQNVYVHTTPQYRSPEMIDLYRYLPINEKSD 267

Query: 229 IWALGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPN 288
           IWALGVFLYKL +YTTPFE  G+ A+LHS+F  PA   YS ++  L+  ML EN + RPN
Sbjct: 268 IWALGVFLYKLLFYTTPFETTGQFAMLHSKFDIPANK-YSSKIINLVIIMLSENLNLRPN 326

Query: 289 VCQVLEDVSRMQGIQCPV--------RNFYLLRAMEQQQQSTQNQL 326
           + QV+  + ++  +  P+         NF      +++ Q+ QNQL
Sbjct: 327 IYQVMHYICQLIQVDTPILDIYGRGPYNFSKYSDYQKKAQAIQNQL 372

>KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} similar
           to uniprot|P38080 Saccharomyces cerevisiae YBR059C AKL1
           Ser-Thr protein kinase
          Length = 901

 Score =  295 bits (755), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 145/316 (45%), Positives = 196/316 (62%), Gaps = 10/316 (3%)

Query: 4   PEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVY---------SAEIQPADAFIDSNVAC 54
           P +     G+ + VG+H  +++ YL  GGFA +Y           E  P+        AC
Sbjct: 24  PVLERLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVKFVEYANELEQAPSITLKVGETAC 83

Query: 55  LKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAG 114
           LKRV+V D+  LN +R EV  MK L    ++V Y DSHA++S      +EV LLME C  
Sbjct: 84  LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRSRDGVPGFEVMLLMELCPN 143

Query: 115 GGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYK 174
             L+D+MN RL  +L E EIL IM  VT+ +A MH L  PLIHRD+KIENVL+     +K
Sbjct: 144 NSLLDYMNQRLTTKLSEQEILKIMFDVTRALAQMHYLPIPLIHRDVKIENVLVDGDNNFK 203

Query: 175 VCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGV 234
           +CDFGS    +      QE A + +++  +TT QYRSPEMIDLYR  PIDEKSDIWALG+
Sbjct: 204 LCDFGSTSTCLPVANTHQEIAVLTNNIYIHTTPQYRSPEMIDLYRCLPIDEKSDIWALGI 263

Query: 235 FLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLE 294
           FLYKL +YTTPFE  G+ AILHS+++FP    YS +L  LI  ML ENP+ RPN+ Q+++
Sbjct: 264 FLYKLLFYTTPFELTGQFAILHSKYEFPINN-YSSKLINLIIIMLAENPNLRPNIYQIMD 322

Query: 295 DVSRMQGIQCPVRNFY 310
           ++  +  ++ P+ + Y
Sbjct: 323 NLCSIMKVENPIEDKY 338

>NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON}
           Anc_3.273
          Length = 1157

 Score =  299 bits (765), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 146/323 (45%), Positives = 201/323 (62%), Gaps = 25/323 (7%)

Query: 12  GTVLTVGSHHAKVISYLTSGGFAQVYSAE-IQPADAFIDSN------------------- 51
           GT + VGSH  ++I Y+  GGFAQ+Y+ + ++  + F DSN                   
Sbjct: 27  GTQVAVGSHKVEIIKYIAEGGFAQIYAVKYVESLNEFEDSNTDENAHLSGDRQAPNPMIL 86

Query: 52  ----VACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFL 107
               +ACLKRV+V D+  LN +R EV+ MK L+   +VV Y DS+A++       +EV L
Sbjct: 87  KLGDIACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRHNGASGFEVLL 146

Query: 108 LMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLI 167
           LME C    L+D+MN RL  +L E EIL IM  +T  ++ MH L+ PL+HRDIKIENVL+
Sbjct: 147 LMELCPNKSLLDYMNQRLTTKLTEHEILKIMYDITFAVSHMHYLKIPLLHRDIKIENVLV 206

Query: 168 SHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKS 227
                +K+CDFGS    +      Q+ A +  ++  +TT QYRSPEMIDLYR  PIDEKS
Sbjct: 207 DAQNNFKLCDFGSTSTRLPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKS 266

Query: 228 DIWALGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRP 287
           DIWALG+FLYKL ++ TPFE  G+ AILHS+++FP    YS +L  LI  ML ENP+ RP
Sbjct: 267 DIWALGIFLYKLLFFITPFEMTGQFAILHSKYEFPKNN-YSSKLINLIIIMLAENPNLRP 325

Query: 288 NVCQVLEDVSRMQGIQCPVRNFY 310
           N+ QVL+++  M  ++ P+ + Y
Sbjct: 326 NIYQVLDNICSMMNVEVPIEDIY 348

>TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3.273
           YBR059C
          Length = 1054

 Score =  295 bits (756), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 156/357 (43%), Positives = 207/357 (57%), Gaps = 47/357 (13%)

Query: 6   IPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAE-IQPADAFIDS-------------- 50
           I  Y  GT+LTVG    +++ YLT GGFAQ+Y+   I+  + F +               
Sbjct: 37  IEKYKQGTILTVGIRRIEILKYLTEGGFAQIYTVRFIEYLNEFDNDDAENDNNSRNLKIG 96

Query: 51  NVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAK--------------- 95
           +VACLKRV+VPD+  L+ +R EVD MK L N  ++V Y DS+A+K               
Sbjct: 97  DVACLKRVLVPDENGLSEMRNEVDVMKKLVNCPNIVQYYDSNASKIKDNSNIDTTNNNDN 156

Query: 96  SSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPL 155
           +   +  +E+ LLMEYC    L+DFMN RL  +L E EIL  M+ +T  +  MH L  PL
Sbjct: 157 NKNTDLGFEILLLMEYCPNKSLLDFMNQRLTTKLTENEILKAMTDITTAVLQMHYLAQPL 216

Query: 156 IHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMI 215
           IHRDIKIENVL+     +K+ DFGS   +  P    Q+ A +  D+  NTT QYRSPEMI
Sbjct: 217 IHRDIKIENVLVDSNNNFKLADFGSTTKIQPPITTHQDIAILNKDIYMNTTPQYRSPEMI 276

Query: 216 DLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLI 275
           DLY+  PIDEKSDIWALGV LYKL +YTTPFE  G+ AILHS+++FPA   YS +   LI
Sbjct: 277 DLYKCLPIDEKSDIWALGVLLYKLLFYTTPFELTGQFAILHSKYEFPANN-YSSKFINLI 335

Query: 276 RRMLMENPDQRPNVCQVLEDVSRMQGIQCPVRNFYLLRAMEQQQQSTQNQLRYSRTQ 332
             ML ENP+ RPN+ QVL                Y L+++     S  N+++ ++ Q
Sbjct: 336 IIMLAENPNLRPNIFQVL----------------YYLKSISNTMNSNNNEVQNTQVQ 376

>Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {ON}
           similar to Ashbya gossypii AGR027C
          Length = 894

 Score =  292 bits (747), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 144/307 (46%), Positives = 193/307 (62%), Gaps = 9/307 (2%)

Query: 12  GTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFID--------SNVACLKRVIVPDK 63
           G++L VG H  ++I YL  GGFA +Y          +D         ++ACLKRV V D+
Sbjct: 31  GSILLVGVHRVEIIEYLAEGGFAHIYKVSFIEYTNELDRHHSVLQRGDIACLKRVQVNDE 90

Query: 64  PSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNT 123
             LN LR EV+ MK L+   +VV Y DS+A++ +     +EV LLME C+ G L+D+MN 
Sbjct: 91  NGLNELRNEVEVMKKLKGCGNVVQYYDSNASRHTDGTPGFEVLLLMELCSNGSLLDYMNQ 150

Query: 124 RLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCG 183
           RL  +L E E+L IM  +T+GI+ MH L+ PLIHRDIKIENVL+     +K+CDFGS   
Sbjct: 151 RLATKLSEREVLKIMYDITKGISHMHFLRTPLIHRDIKIENVLVDSANNFKLCDFGSTST 210

Query: 184 VIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYT 243
            +      QE A + +++  +TT QYRSPEMIDLYR   I+EKSDIWALG+FLYKL +YT
Sbjct: 211 CLPAVSTHQEIAMLTNNIYVHTTPQYRSPEMIDLYRCLAINEKSDIWALGIFLYKLLFYT 270

Query: 244 TPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQGIQ 303
           TPFE  G+ AILHS++  P Q  +S +L  LI  ML ENP  RPN+ Q+L  +  +    
Sbjct: 271 TPFELTGQFAILHSKYDIP-QNNFSSKLINLIIVMLAENPYIRPNIYQILYHICSIMECD 329

Query: 304 CPVRNFY 310
            P+ + Y
Sbjct: 330 VPIEDHY 336

>Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {ON}
           YBR059C (REAL)
          Length = 1108

 Score =  295 bits (756), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 147/319 (46%), Positives = 201/319 (63%), Gaps = 10/319 (3%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAE-IQPADAFIDS--------N 51
           M  P +  + PG ++ VG+H  +VI+YL  GGFAQ+Y  + ++  + F ++        +
Sbjct: 14  MGHPAVERFTPGHIVCVGTHKVEVINYLAEGGFAQIYMVKFVEYLNEFDNAASVPLKIGD 73

Query: 52  VACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEY 111
           VACLKRV+V D+  LN +R EV+ MK L+   +VV Y DS+A++       +EV LLME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTG 171
           C    L+D+MN RL  +L E EI+ IM  V   I+ MH L  PLIHRDIKIENVL+    
Sbjct: 134 CPNKSLLDYMNQRLSTKLTESEIVKIMYDVVLSISQMHYLPVPLIHRDIKIENVLVDANN 193

Query: 172 QYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWA 231
            +K+ DFGS           Q+ A +  ++  +TT QYRSPEMIDLYR  PI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQ 291
           LG+FLYKL ++TTPFE  G+ AILHS+++FP    YS +L  LI  ML ENP+ RPN+ Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFPVNK-YSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VLEDVSRMQGIQCPVRNFY 310
           VL  +  +  I+ P+ + Y
Sbjct: 313 VLYHLCEILNIEVPIEDKY 331

>Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059C
           (AKL1) - Serine-threonine protein kinase [contig 32]
           FULL
          Length = 935

 Score =  292 bits (748), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 144/310 (46%), Positives = 196/310 (63%), Gaps = 10/310 (3%)

Query: 12  GTVLTVGSHHAKVISYLTSGGFAQVY---------SAEIQPADAFIDSNVACLKRVIVPD 62
           G+ + VG+H  +++ YL  GGFA +Y           E  P       ++ACLKRV+V D
Sbjct: 74  GSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTD 133

Query: 63  KPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMN 122
           +  LN +R EV  MK L    ++V Y DSHA+++   +  +EV LLME C    L+D+MN
Sbjct: 134 ENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMN 193

Query: 123 TRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVC 182
            RL  +L E EIL IM  VT+ +A MH L  PLIHRD+KIENVL+     +K+CDFGS  
Sbjct: 194 QRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTS 253

Query: 183 GVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYY 242
                    QE A + +++  +TT QYRSPEMIDLYR  PI+EKSDIWALG+FLYKL +Y
Sbjct: 254 TCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFY 313

Query: 243 TTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQGI 302
           TTPFE  G+ AILHS+++FP    YS +L  LI  ML ENP+ RPN+ QV++++  +  +
Sbjct: 314 TTPFELTGQFAILHSKYEFPVNN-YSSKLINLIIIMLAENPNLRPNIYQVMDNLCSILKV 372

Query: 303 QCPVRNFYLL 312
           + P+ + Y L
Sbjct: 373 KNPLEDKYQL 382

>TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3.273
           YBR059C
          Length = 1049

 Score =  294 bits (752), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 200/316 (63%), Gaps = 10/316 (3%)

Query: 4   PEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAE-IQPADAFID--------SNVAC 54
           P +  + PG V+ VG+H  +V++YL  GGFAQ+Y  + ++  + F +         +VAC
Sbjct: 17  PTMERFLPGAVVAVGTHRVEVVNYLAEGGFAQIYVVKFLEYLNEFENKSKVPMKVGDVAC 76

Query: 55  LKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAG 114
           LKRV+V D+  L+ +R EV+ MK L   +++V Y DS+A +    N  +EV LLME C  
Sbjct: 77  LKRVLVQDENGLSEMRNEVEVMKQLMGAQNIVQYYDSNACRRHNGNAGFEVLLLMELCPN 136

Query: 115 GGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYK 174
             L+D+MN RL  +L E EIL IM  V+  ++ MH L+ PLIHRDIKIENVL+     +K
Sbjct: 137 KSLLDYMNQRLATKLTEKEILKIMYDVSLAVSQMHYLKNPLIHRDIKIENVLVDAQNSFK 196

Query: 175 VCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGV 234
           +CDFGS           QE A +  ++  +TT QYR PEMIDLYR  PI+EKSDIWALG+
Sbjct: 197 LCDFGSTSQCFPVVTTHQEIAILTQNIYVHTTPQYRCPEMIDLYRCLPINEKSDIWALGI 256

Query: 235 FLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLE 294
           FLYKL ++ TPFE  G+ AILHS+++FP    YS +L  LI  ML ENP  RPN+ QVL 
Sbjct: 257 FLYKLLFFITPFEMTGQFAILHSKYEFPPNH-YSSQLINLIIIMLAENPFVRPNIYQVLN 315

Query: 295 DVSRMQGIQCPVRNFY 310
            +  M G++ P+ + Y
Sbjct: 316 HICTMIGVEVPIEDKY 331

>Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {ON}
           YBR059C (REAL)
          Length = 1107

 Score =  294 bits (753), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 145/319 (45%), Positives = 201/319 (63%), Gaps = 10/319 (3%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAE-IQPADAFIDS--------N 51
           M  P +  Y PG ++ VG+H  ++++YL  GGFAQ+Y+ + ++  + F ++        +
Sbjct: 14  MGHPAVERYTPGKIVCVGTHKVEIVNYLAEGGFAQIYAVKFLEYLNEFDNTASLPLKIGD 73

Query: 52  VACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEY 111
           VACLKRV+V D+  LN +R EV+ MK L+   +VV Y DS+A++       +EV LLME 
Sbjct: 74  VACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTG 171
           C    L+D+MN RL  +L E EI+ IM  V   I+ MH L  PLIHRDIKIENVL+    
Sbjct: 134 CPNKSLLDYMNQRLSTKLSESEIVKIMYDVALSISEMHYLPVPLIHRDIKIENVLVDAEN 193

Query: 172 QYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWA 231
            +K+ DFGS           Q+ A +  ++  +TT QYRSPEMIDLYR  PI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTSFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQ 291
           LG+FLYKL ++TTPFE  G+ AILHS+++FP    YS +L  LI  ML ENP+ RPN+ Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFPVNK-YSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VLEDVSRMQGIQCPVRNFY 310
           VL  +  +   + P+ + Y
Sbjct: 313 VLYHICDILNAEVPIEDKY 331

>Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {ON}
           YBR059C (REAL)
          Length = 1090

 Score =  292 bits (748), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 144/319 (45%), Positives = 201/319 (63%), Gaps = 10/319 (3%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAE-IQPADAFIDS--------N 51
           M  P +  Y PG ++ VG+H  ++++YL  GGFAQ+Y  + ++  + F ++        +
Sbjct: 14  MGHPAVERYTPGDIVCVGTHKVEIVNYLAEGGFAQIYVVKFLEYLNEFDNAASVPLKIGD 73

Query: 52  VACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEY 111
           +ACLKRV+V D+  LN +R EV+ MK L+   +VV Y DS+A++       +EV LLME 
Sbjct: 74  LACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTG 171
           C    L+D+MN RL  +L E EI+ IM  V   I+ MH L  PLIHRDIKIENVL+    
Sbjct: 134 CPNKSLLDYMNQRLSTKLTETEIVKIMYDVALSISQMHYLPVPLIHRDIKIENVLVDAKD 193

Query: 172 QYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWA 231
            +K+ DFGS           Q+ A +  ++  +TT QYRSPEMIDLYR  PI+EKSDIWA
Sbjct: 194 SFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQ 291
           LG+FLYKL ++TTPFE  G+ AILHS+++FP    YS +L  LI  ML ENP+ RPN+ Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFPVNK-YSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VLEDVSRMQGIQCPVRNFY 310
           VL  +  +  ++ P+ + Y
Sbjct: 313 VLCHLCDILNVEVPIEDKY 331

>TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {ON}
           Anc_3.273 YBR059C
          Length = 788

 Score =  287 bits (734), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 152/338 (44%), Positives = 206/338 (60%), Gaps = 18/338 (5%)

Query: 6   IPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSN---------VACLK 56
           I  Y PG ++ VG H  ++I YL  GGFA++Y A+       ID N         + CLK
Sbjct: 96  IDTYVPGHIVEVGIHKVEIIKYLAEGGFAKIYVAKFLQYIKQIDINKIQVLQPGDLICLK 155

Query: 57  RVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGG 116
           RV+V D   LN +R EV  MK L    ++V   DS+A++ +     YEV LLME C+   
Sbjct: 156 RVLVTDDNGLNEMRNEVSVMKKLIGAPNIVQLYDSNASRRTDGIAGYEVLLLMELCSNKS 215

Query: 117 LIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVC 176
           L+D+MN RL  +L E EIL IM  VT  +A MH L  PLIHRDIKIENVL+     +K+C
Sbjct: 216 LLDYMNQRLAVKLTEPEILKIMFDVTLAVAQMHYLPIPLIHRDIKIENVLVDSQNNFKLC 275

Query: 177 DFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFL 236
           DFGS    +      ++ A +  ++  +TT QYRSPEMID+YR   I+EKSDIWALG+FL
Sbjct: 276 DFGSTSTCMPIATTHRDMAALTQNLYVHTTPQYRSPEMIDVYRCIHINEKSDIWALGIFL 335

Query: 237 YKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDV 296
           YKL +Y TPFE+ G+ AILHS+++FP Q  YS +L  LI  ML ENP+ RPN+ QVL  +
Sbjct: 336 YKLLFYITPFERTGQFAILHSKYEFP-QHSYSMKLINLIIIMLAENPNLRPNIYQVLAYI 394

Query: 297 SRMQGIQCPVRNFYLLRAMEQQQ--------QSTQNQL 326
            ++  I+ P+ + Y L   + Q+        Q++QNQ+
Sbjct: 395 CKIINIKTPIDDIYGLGPYDFQKYTNYQTALQNSQNQM 432

>YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON}
           AKL1Ser-Thr protein kinase, member (with Ark1p and
           Prk1p) of the Ark kinase family; involved in endocytosis
           and actin cytoskeleton organization
          Length = 1108

 Score =  292 bits (747), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 145/319 (45%), Positives = 200/319 (62%), Gaps = 10/319 (3%)

Query: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAE-IQPADAFIDS--------N 51
           M  P +  Y PG ++ VG+H  +V++YL  GGFAQ+Y  + ++  + F ++        +
Sbjct: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73

Query: 52  VACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEY 111
           VACLKRV+V D+  LN +R EV+ MK L+   ++V Y DS+A++       +EV LLME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTG 171
           C    L+D+MN RL  +L E EI+ IM  V   I+ MH L   LIHRDIKIENVL+    
Sbjct: 134 CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193

Query: 172 QYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWA 231
            +K+ DFGS           Q+ A +  ++  +TT QYRSPEMIDLYR  PI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQ 291
           LGVFLYKL ++TTPFE  G+ AILHS+++FP    YS +L  LI  ML ENP+ RPN+ Q
Sbjct: 254 LGVFLYKLLFFTTPFEMTGQFAILHSKYEFPVNK-YSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VLEDVSRMQGIQCPVRNFY 310
           VL  +  +  ++ P+ + Y
Sbjct: 313 VLYHLCEILNVEVPIEDKY 331

>CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 991

 Score =  288 bits (736), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 163/375 (43%), Positives = 225/375 (60%), Gaps = 29/375 (7%)

Query: 3   QPEIPNYNP-GTVLTVGSHHAKVISYLTSGGFAQVYSAE-IQPADAFIDSNV-------- 52
           QP+I    P G V+TVGSH  +V+SYL  GGFAQ+Y  + ++  + F   N         
Sbjct: 89  QPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLK 148

Query: 53  ----ACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGS----YE 104
               ACLKRV+V D+  LN +R+EV+ MK L+   ++V Y DS+A++    +G+    +E
Sbjct: 149 PGSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFE 208

Query: 105 VFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           V LLME C    L+D+MN RL  +L E EI  IM  +T  +A MH L  PLIHRDIKIEN
Sbjct: 209 VLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIEN 268

Query: 165 VLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPID 224
           VL+     +K+CDFGS         + Q+ A +  D+  +TT QYRSPEMIDL++  PI+
Sbjct: 269 VLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPIN 328

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPD 284
           EKSDIWALGVFLYKL ++TTPFE+ G+ A+LHS+F+FP    YS +L  LI  ML ENP 
Sbjct: 329 EKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPNS-YSSKLINLIIVMLAENPS 387

Query: 285 QRPNVCQVLEDVSRMQGIQCP---VRNFY------LLRAMEQQQQSTQNQLRYSRTQPVL 335
            RPN+ QVL  +S +   + P   + + Y        +    Q++S Q QL+ S  Q  +
Sbjct: 388 LRPNIYQVLYYLSEVTNREVPPTVLSDKYGQGPYNFEKYTRFQKESQQVQLQLSTLQAKI 447

Query: 336 NVPIIS-QPVGFPMH 349
           N P  + QP  + ++
Sbjct: 448 NDPNSTMQPADWELY 462

>AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR059C
           (AKL1)
          Length = 961

 Score =  286 bits (732), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 144/307 (46%), Positives = 192/307 (62%), Gaps = 9/307 (2%)

Query: 12  GTVLTVGSHHAKVISYLTSGGFAQVY-------SAEIQPADAFID-SNVACLKRVIVPDK 63
           G+ + VG H  +VI YL  GGFA +Y       + E+   D  +   +  CLKRV V D+
Sbjct: 32  GSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDE 91

Query: 64  PSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNT 123
             LN LR EV+ MK LRN  ++V Y DS+A++       YEV LLME C  G L+D+MN 
Sbjct: 92  NGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQ 151

Query: 124 RLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCG 183
           RL  +L E E+L IM  +T G++ MH  + PLIHRDIKIENVL+     +K+CDFGS   
Sbjct: 152 RLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSP 211

Query: 184 VIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYT 243
            +    + QE A + +++  +TT QYRSPEMIDLYR  PI+EKSDIWALG+FLYKL +YT
Sbjct: 212 CLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYT 271

Query: 244 TPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQGIQ 303
           TPFE  G+ AILHS+++ P    +S +L  L+  ML ENP  RPNV QV+  +  M   +
Sbjct: 272 TPFELTGQFAILHSKYEIPRNS-FSSKLINLVIIMLAENPYLRPNVYQVMYHICSMMECE 330

Query: 304 CPVRNFY 310
             + + Y
Sbjct: 331 VKIDDLY 337

>TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1361

 Score =  279 bits (713), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 133/316 (42%), Positives = 191/316 (60%), Gaps = 12/316 (3%)

Query: 6   IPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEI-----------QPADAFIDSNVAC 54
           I  Y PG +++VG+H  K+  YL  GGFAQ+Y  +               ++    ++AC
Sbjct: 32  IEKYKPGKLISVGAHQVKIEDYLAEGGFAQIYKVKFIDYLNEFENKKDQLNSLKSGDIAC 91

Query: 55  LKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAG 114
           LKRV+V D+  LN +R EV+ MKLL+   ++V Y DS+A + +     YE+ LLME C  
Sbjct: 92  LKRVLVNDENGLNEMRNEVEVMKLLQGCPNIVQYYDSNALRRNDGLNGYEILLLMELCPN 151

Query: 115 GGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYK 174
             L+D+MN RL+ +L E EI+ IM   T  ++ MH L  PLIH+DIK+EN+L+     +K
Sbjct: 152 NSLLDYMNQRLKTKLNETEIVKIMYDTTLAVSQMHYLDKPLIHKDIKVENILVDSNNNFK 211

Query: 175 VCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGV 234
           +CDFGS         +  + A +  ++  +TT QYRSPEMIDLYR  PI+E SDIWALGV
Sbjct: 212 LCDFGSTSPCYEIVTSHHDIAVLTQNIYMHTTPQYRSPEMIDLYRCLPINETSDIWALGV 271

Query: 235 FLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLE 294
           FLYKL ++ TPFE+ G+ +ILH++F  P    Y  +L  LI  ML EN + RPN+ QV+ 
Sbjct: 272 FLYKLLFFITPFERTGQFSILHAKFDIPVNN-YHPKLINLIIIMLSENLNLRPNIYQVMY 330

Query: 295 DVSRMQGIQCPVRNFY 310
           ++  +     P+ + Y
Sbjct: 331 EICSITNTPLPIEDKY 346

>Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236C -
           Hypothetical ORF [contig 165] FULL
          Length = 346

 Score = 97.8 bits (242), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 85/342 (24%), Positives = 144/342 (42%), Gaps = 64/342 (18%)

Query: 13  TVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAE 72
           + +++     ++   L  GG + VY  E +  + F       LK+   P      ++ + 
Sbjct: 17  SFVSINGRKYRIQKLLGEGGLSFVYLVESKEGELFA------LKKTRCP----FGSIGSI 66

Query: 73  VDAMKLLRNNK-----HVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQN 127
             AMK + N +     ++   +DS   +    +GS  V++L+ Y A G L D +N  L +
Sbjct: 67  SPAMKEVANYQRFSSPYIAQIVDSQVVQE--KDGSKTVYVLLPYFAKGSLQDLINRHLLD 124

Query: 128 --RLQEFEILNIMSQVTQGIAAMHALQP-------------------------------- 153
             ++ E +IL +   + +G+  +H   P                                
Sbjct: 125 CTQMSELDILRMALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLELDTFGE 184

Query: 154 ---PLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNP-QEFAYVQHDVLKNTTAQY 209
                 HRD+K  N++IS      + D GS C   R   N  Q     Q     N T  Y
Sbjct: 185 SQQSYAHRDVKPSNIMISPEDLPVISDLGS-CSRARIDINSRQALLRFQEWSSDNCTLSY 243

Query: 210 RSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGEL-------AILHSRFQFP 262
            +PE++D+     I EK DIW+ G  +Y +C+  +PFE+  ++       AI   ++  P
Sbjct: 244 AAPEILDVKLNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKYTVP 303

Query: 263 AQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQGIQC 304
               YS  L  LI + L  NP+QRP+V +++  +  +QG QC
Sbjct: 304 RGTSYSSSLIELIGKCLSVNPEQRPSVNELIALLMELQG-QC 344

>YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON}
           ENV7Protein proposed to be involved in vacuolar
           functions; mutant shows defect in CPY processing; has
           sequence similarity with the human serine/threonine
           protein kinase STK16
          Length = 364

 Score = 94.7 bits (234), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 81/318 (25%), Positives = 136/318 (42%), Gaps = 61/318 (19%)

Query: 28  LTSGGFAQVYSAEIQPADAFIDSNVA-----CLKRVIVPDKPSLNTLRAEVDAMKLLRNN 82
           L  GG + VY  ++      ID+ +A      LK++I P   S++    E++  K  ++ 
Sbjct: 36  LGEGGMSFVYLVQLSKNSLIIDNGIATPELYALKKIICPSVESISNGMREIENYKRFQS- 94

Query: 83  KHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRL--QNRLQEFEILNIMSQ 140
            +V+  IDS   +    +GS  +++++ Y + G L D +N RL     + E E + IM  
Sbjct: 95  PYVIKSIDSQVMQEK--DGSKTIYIVLPYYSLGSLQDSINRRLLEGTFVSEAECVRIMLG 152

Query: 141 VTQGIAAMHA---------------------------------LQPPLI----------- 156
           VT+G+  +H                                  L+  ++           
Sbjct: 153 VTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLEDTPLEMDMLSSNSAGSIAYA 212

Query: 157 HRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMID 216
           HRDI   N+L S  G   + D GS        +N  + + +Q  V  N T  Y  PE+++
Sbjct: 213 HRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSELQEWVNDNCTLPYTPPELLN 272

Query: 217 LYRGHPIDEKSDIWALGVFLYKLCYYTTPFEK-----GGEL--AILHSRFQFPAQPIYSD 269
           L     +  K DIW+LG   Y L +  +PFE+     G  L  AI   ++ FP    +S+
Sbjct: 273 LKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGASLTYAINTGKYSFPRNSRFSE 332

Query: 270 RLKGLIRRMLMENPDQRP 287
            L  +I++ +  +P QRP
Sbjct: 333 GLLSVIKKCIQVDPIQRP 350

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score = 97.4 bits (241), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 62/210 (29%), Positives = 105/210 (50%), Gaps = 53/210 (25%)

Query: 104 EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
           +V++ +EYC G  L +++   +Q+R+   E   + +Q+   +   H+LQ   +HRD+K+E
Sbjct: 102 KVWMALEYCPGKELYEYL--LMQHRISLEESGKLFAQIVSAVYYAHSLQ--CVHRDLKLE 157

Query: 164 NVLISHTGQYKVCDFG------------SVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRS 211
           N+L+   G+ K+ DFG            +VCG                      T  Y +
Sbjct: 158 NILLDKKGRAKITDFGFTRECATKTMLETVCG----------------------TTVYMA 195

Query: 212 PEMIDL--YRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQ-FPAQPIYS 268
           PE+I+   Y G  I    DIW+LGV LY + + T PF++  E     ++++    +P Y+
Sbjct: 196 PELIERKSYDGFKI----DIWSLGVILYTMIHGTMPFDEEDETK---TKWKIINEEPFYN 248

Query: 269 DRL-----KGLIRRMLMENPDQRPNVCQVL 293
           D +     K LI ++L ++P QRP + QVL
Sbjct: 249 DDVVSKDAKDLISQLLCKDPSQRPQLSQVL 278

>Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 94.4 bits (233), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 82/339 (24%), Positives = 142/339 (41%), Gaps = 61/339 (17%)

Query: 13  TVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVAC-----LKRVIVPDKPSLN 67
           T + V     K+   L  GG + VY  ++      +++ VA      LK++I P+  S++
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGLSFVYLVQLLKGSLIMENGVAAPELYALKKIICPNVESIS 80

Query: 68  TLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRL-- 125
               E++  K  ++  +V+  IDS   +    +GS  +++++ +   G L D +N RL  
Sbjct: 81  NGMREIENYKRFQS-PYVIQSIDSQVMQEK--DGSKSIYIILPFYTLGSLQDSINRRLLE 137

Query: 126 QNRLQEFEILNIMSQVTQGIAAMHA---------------------------------LQ 152
              + E E + IM  V +G+  +H                                  L+
Sbjct: 138 GTFISEAECVRIMLGVIRGLLCLHDPASRQDNTNSRTTVDTVSMTYSDETAFLLEDTPLE 197

Query: 153 PPLI-----------HRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDV 201
             ++           HRDI   N+L S  G   + D GS         N  +   +Q  V
Sbjct: 198 MDMLSSNLGASIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLRELQEWV 257

Query: 202 LKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGEL-------AI 254
             N T  Y +PE++ L     +D K DIW+LG   Y L +  +PFE+  ++       AI
Sbjct: 258 NDNCTLPYTAPELLGLKLNQTLDCKVDIWSLGCTFYTLMFGISPFEREEQIHGASITYAI 317

Query: 255 LHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVL 293
              ++ FP    +S+ L  +I++ +  +P QRP   Q+L
Sbjct: 318 NTGKYSFPRNSRFSEGLLSVIKKCIQVDPVQRPTTSQLL 356

>KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24
           YDR523C
          Length = 543

 Score = 95.9 bits (237), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 104/205 (50%), Gaps = 16/205 (7%)

Query: 100 NGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRD 159
           N  Y ++++MEYC GG   D + T  +  L E ++  ++  V  G+  +HA     IHRD
Sbjct: 82  NEDYLMWIVMEYCGGGSARDLIKTCYREGLAENKVAFVVKSVLLGLQYLHAQHK--IHRD 139

Query: 160 IKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYR 219
           IK  N+L++ +G  KV DFG V   +R     + F           T  + +PE++ +  
Sbjct: 140 IKAANILLTDSGLVKVADFG-VSAEMRSTMKAKTFV---------GTPYWMAPEVV-MNE 188

Query: 220 GHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHS---RFQFPAQPIYSDRLKGLIR 276
           G   +EKSDIW+LG+  Y+L     P  K   + ++ +   R        Y++ +K  I 
Sbjct: 189 GMGYNEKSDIWSLGITTYELLKGVPPLAKYDAIRVMRNIPKRKPPKLHGAYTNLVKHFIA 248

Query: 277 RMLMENPDQRPNVCQVLEDVSRMQG 301
             L+++P++RP+  ++LE    ++G
Sbjct: 249 TCLIKDPEKRPSASELLEHDFMVKG 273

>KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score = 96.3 bits (238), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 63/246 (25%), Positives = 121/246 (49%), Gaps = 46/246 (18%)

Query: 68  TLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQN 127
           T+  E++  KL+  +K+++S ID     ++       +++++E C  G L D +  R + 
Sbjct: 95  TILKEIEIHKLVNGHKNIISMIDHFEIDAT-------MYMVLELCGAGSLYDII-CRSKR 146

Query: 128 RLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRP 187
            L+E+E   +M Q+   +  +H  +  ++H D+K+ N+LI  +   ++CDFG        
Sbjct: 147 SLREWEAKRLMIQLCGAVDWIH--EKNIVHADLKLSNILIDSSNNLQLCDFGH------- 197

Query: 188 PQNPQEFAYVQHDVLKNT-----TAQYRSPEMI---------DLYRGHPIDEKSDIWALG 233
                  ++V  D+  N+     T  Y SPE+I         DLY      ++SDIW++G
Sbjct: 198 -------SFVSTDIDNNSINKFGTPNYLSPEIISNFILSDKKDLY----FPKESDIWSIG 246

Query: 234 VFLYKLCYYTTPFE----KGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNV 289
           + LY + +  TPFE    +     I+  ++ F      S+++K LI+ +L   P +R  +
Sbjct: 247 IVLYAMIFDKTPFEATTLRSTYENIVECKYGFVENKRVSNKVKKLIQNILKIQPLERKTI 306

Query: 290 CQVLED 295
            +++ D
Sbjct: 307 VEIVSD 312

>Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 93.6 bits (231), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 82/333 (24%), Positives = 142/333 (42%), Gaps = 61/333 (18%)

Query: 13  TVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVA-----CLKRVIVPDKPSLN 67
           T + V     K+   L  GG + VY  ++      ++++ A      LK++I P   +++
Sbjct: 21  TTIRVNDRRYKIQRLLGEGGMSFVYLVQLLKGSLSMENSAATAELYALKKIICPSVENIS 80

Query: 68  TLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRL-- 125
               E++  K  ++  +V+  IDS   +    +GS  +++++ Y + G L D +N RL  
Sbjct: 81  NGMREIENYKRFQS-PYVIQSIDSQVMQE--KDGSKTIYIILPYYSLGSLQDSINRRLLE 137

Query: 126 QNRLQEFEILNIMSQVTQGIAAMHA---------------------------------LQ 152
              + E E + IM  VT+G+  +H                                  L+
Sbjct: 138 GTFISEAECVRIMLGVTRGLLCLHDPASRQDNVTTRTTVDTISMTYSDETAMLLEDTPLE 197

Query: 153 PPLI-----------HRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDV 201
             ++           HRDI   N+L S  G   + D GS         N  + + +Q  V
Sbjct: 198 MDMLSSSSAGLIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLSELQEWV 257

Query: 202 LKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEK-----GGEL--AI 254
             N T  Y +PE+++L     +  K DIW++G   Y L +  +PFE+     G  L  AI
Sbjct: 258 NDNCTLPYTAPELLNLKLNQALSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASLTYAI 317

Query: 255 LHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRP 287
              ++ FP    +S+RL  +I+R +  +P QRP
Sbjct: 318 NTGKYSFPRNSRFSERLLDVIKRCIQVDPIQRP 350

>TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON}
           Anc_6.262 YPL236C
          Length = 372

 Score = 92.8 bits (229), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 75/301 (24%), Positives = 130/301 (43%), Gaps = 58/301 (19%)

Query: 55  LKRVIVP--DKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYC 112
           LKR+  P  +  S++    EVD  K  ++  ++++ +DS   +    +GS  + +L+ Y 
Sbjct: 73  LKRIRCPFGNIESISAAMKEVDNYKRFQS-PYIITLVDSQVVQE--KDGSKTLCILLPYF 129

Query: 113 AGGGLIDFMNTRL--QNRLQEFEILNIMSQVTQGIAAMH--------------------- 149
             G L D +N  L     + E E + IM  + +G+  +H                     
Sbjct: 130 PLGSLQDMVNRNLLKGTFVSEAECIRIMIGIARGLRCLHDPSARETSDAETMRDTVSLSY 189

Query: 150 -------ALQPPL----------------IHRDIKIENVLISHTGQYKVCDFGSVCGVIR 186
                      PL                +HRDI++ N+L S  G   V D GS C    
Sbjct: 190 SDEAAFLLDDTPLELDVLSSHNTVNTRSYVHRDIRLANILFSSEGLPVVSDLGSCCKADI 249

Query: 187 PPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPF 246
                 +   +Q  V  N +  Y +PE++++     ID K+DIW++G   Y + +  +PF
Sbjct: 250 TVSTKHQLNELQDWVTANCSFPYTAPELLNVKLNSTIDCKADIWSVGCTCYAMLFGMSPF 309

Query: 247 EK-----GGEL--AILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRM 299
           E+     G  L  AI   ++ FP Q  YS+ L  +I+  L  +P  RP++ ++L+ +  +
Sbjct: 310 ERELQVSGASLTYAIGCGKYTFPKQTRYSESLLAVIKSCLQVDPTARPDINELLDTLQDL 369

Query: 300 Q 300
           Q
Sbjct: 370 Q 370

>Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON}
           (48405..49868) [1464 nt, 488 aa]
          Length = 487

 Score = 94.0 bits (232), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 75/266 (28%), Positives = 128/266 (48%), Gaps = 28/266 (10%)

Query: 31  GGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYID 90
           G F  VY A  +   A +   V  L+      +  ++ L  E+  +  LR+  ++ +YI 
Sbjct: 24  GNFGDVYKAFDKTNGAIVAVKVVNLEHT----EEDIDLLAQEIFFLAELRS-PYITNYIT 78

Query: 91  SHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHA 150
           +     S       ++++MEYC GG   D + T   N L E ++  I  +V +G+  +H 
Sbjct: 79  TMIEDVS-------MWIVMEYCGGGACSDLIKTVYINGLPENKVGFITREVLKGLKYLHD 131

Query: 151 LQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYR 210
            +   IHRDIK  N+L++  G+ K+ DFG V G IR       F           T  + 
Sbjct: 132 QKK--IHRDIKAANILLTDEGKVKLGDFG-VSGQIRATMKRGTFV---------GTPYWM 179

Query: 211 SPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHS--RFQFPA-QPIY 267
           +PE+++    +  +EK+DIW+LG+ +Y+L     P  K   + ++ S  R + P     Y
Sbjct: 180 APEVVN-KESNGYNEKADIWSLGITVYELLKGLPPLSKCDPMKVMVSLPRRKPPKLHGQY 238

Query: 268 SDRLKGLIRRMLMENPDQRPNVCQVL 293
           SD  KG +   L+++P+ RP+   +L
Sbjct: 239 SDVAKGFVAACLVKDPNLRPSAEMLL 264

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score = 94.0 bits (232), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 100/209 (47%), Gaps = 49/209 (23%)

Query: 104 EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
           +V++ +EYC G  L D + +   +R+   E + + +Q+  G+   H+L    +HRD+K+E
Sbjct: 103 KVWMALEYCPGKELYDRVLS--MHRVPTDECVQLFAQIVGGVHYAHSLN--CVHRDLKLE 158

Query: 164 NVLISHTGQYKVCDFG------------SVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRS 211
           N+L+  +G  K+ DFG            ++CG                      T  Y +
Sbjct: 159 NILLDKSGDAKLTDFGFTRECMTKTTLETICG----------------------TTVYMA 196

Query: 212 PEMIDL--YRGHPIDEKSDIWALGVFLYKLCYYTTPF----EKGGELAILHSRFQFPAQP 265
           PE+I+   Y G  I    DIW+LGV LY +   + PF    E   E  I+H   Q     
Sbjct: 197 PELIERKSYDGFKI----DIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQLNENI 252

Query: 266 IYSDRLKGLIRRMLMENPDQRPNVCQVLE 294
           + +D  K LI R+L +NP+ RP V Q+L+
Sbjct: 253 VTAD-AKDLILRLLAKNPNDRPTVEQILK 280

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 74/282 (26%), Positives = 136/282 (48%), Gaps = 34/282 (12%)

Query: 27  YLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           +L  GGFA+ +  + +    F    VA   ++ +  + +   L +E+   K +R+  +VV
Sbjct: 96  FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHF-NVV 151

Query: 87  SYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIA 146
            +ID     ++       V++L+E C  G L++ +  R    + E E+   M+Q+   I 
Sbjct: 152 QFIDCFEDDTN-------VYILLEICPNGSLMELLKKR--RTVTEPEVRYFMTQICGAIK 202

Query: 147 AMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTT 206
            MH+ +  +IHRD+K+ N+        K+ DFG +  V+    N +E  Y         T
Sbjct: 203 YMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFG-LAAVL---ANDRERKYTV-----CGT 251

Query: 207 AQYRSPE-MIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSR-----FQ 260
             Y +PE ++  + GH  +   DIW++GV +Y L     PF+   ++ +++ R     F 
Sbjct: 252 PNYIAPEVLMGKHSGHSYE--VDIWSIGVMIYALLIGKPPFQ-SKDVNMIYERIKNRDFA 308

Query: 261 FPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQGI 302
           FP     S+  K LI  +L  +P +RP++ +++ D    +GI
Sbjct: 309 FPKDKYISNEAKTLIHDILSTDPLERPSIEEII-DYVWFRGI 349

>KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 346

 Score = 89.4 bits (220), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 75/332 (22%), Positives = 142/332 (42%), Gaps = 55/332 (16%)

Query: 15  LTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVP--DKPSLNTLRAE 72
           ++V  H   +   L  GGF+ VY  E +      ++ +  LK++  P     S++    E
Sbjct: 19  VSVNGHRYHIKRLLGEGGFSFVYLVESR------ENGLMALKKIRCPFGSIGSISPAMKE 72

Query: 73  VDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQ-- 130
           VD  +  ++  ++   IDS   +    +GS  V++L+ Y + G L D +N  L +  Q  
Sbjct: 73  VDNYQKFKS-PYIAQIIDSQVVQER--DGSKTVYILLPYFSKGSLQDEINRHLLDCTQVP 129

Query: 131 EFEILNIMSQVTQGIAAMHALQPP-----------------------------------L 155
           E E++ +   V +G+  +H   P                                     
Sbjct: 130 ELEVVRLALGVARGLLCIHDAAPADESDVTYSIVSAPYAEDSSLLNDLELDTFGESHQAY 189

Query: 156 IHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMI 215
            H DIK  N++IS  G   + D GS         + Q     Q    ++ T  + +PE++
Sbjct: 190 AHHDIKPSNIMISSEGMPVISDLGSCSRACVEINSRQALLQFQEWRSEHCTLTFMAPEIL 249

Query: 216 DLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGEL-------AILHSRFQFPAQPIYS 268
           D+     I EK D+W+ G  +Y +C+  +PFE+  ++       ++   ++  P+   YS
Sbjct: 250 DVKLNSVITEKCDVWSFGCTIYTMCFGISPFEREEQISGASVTYSLTTGKYSIPSGTNYS 309

Query: 269 DRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300
             L  ++++ L  +PD RP+V +++  +  +Q
Sbjct: 310 SGLIDVVKKCLNVDPDGRPSVDELISLLMDLQ 341

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 92.0 bits (227), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 76/276 (27%), Positives = 130/276 (47%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           +L  GGFA+ +  +    D F    VA   +  +  + +   L +E+   K +  + ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGDIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-AHPNIV 142

Query: 87  SYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIA 146
            +ID     S+       V++L+E C  G L++ +  R    L E E+    +Q+   I 
Sbjct: 143 QFIDCFEDDSN-------VYILLEICPNGSLMELLKRR--KVLSEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTT 206
            MH+ +  +IHRD+K+ N+        K+ DFG +  V+    N  E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANESERKYTI-----CGT 242

Query: 207 AQYRSPE-MIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSR-----FQ 260
             Y +PE ++  + GH  +   DIW+LGV LY L     PF+   ++  ++ R     F 
Sbjct: 243 PNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKCRDFS 299

Query: 261 FPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDV 296
           FP     SD  K LIR +L  +P +RP++ ++++ V
Sbjct: 300 FPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score = 92.0 bits (227), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 132/276 (47%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           +L  GGFA+ +  + +    F    VA   ++ +  + +   L +E+   K ++++ ++V
Sbjct: 100 FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTKRKLLSEIQIHKSMKHS-NIV 155

Query: 87  SYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIA 146
            +ID     ++       V++L+E C  G L+D +  R    L E E+    +Q+   I 
Sbjct: 156 QFIDCFEDDAN-------VYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 206

Query: 147 AMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTT 206
            +H+ +  +IHRD+K+ N+        KV DFG +  V+    N +E  Y         T
Sbjct: 207 YLHSRR--IIHRDLKLGNIFFDKDYNLKVGDFG-LAAVL---ANDRERKYTVCG-----T 255

Query: 207 AQYRSPE-MIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSR-----FQ 260
             Y +PE ++  + GH  +   DIW++GV +Y L     PF+   ++ +++ R     + 
Sbjct: 256 PNYIAPEVLMGKHSGHSFE--VDIWSIGVMIYALLVGKPPFQ-AKDVNVIYERIKLCKYG 312

Query: 261 FPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDV 296
           +P     S   + LI  +L  NP QRP +  +++DV
Sbjct: 313 YPKDKYVSKEAEILIHDILSLNPLQRPTIIDIIDDV 348

>KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7.86
            YAL017W
          Length = 1440

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 62/183 (33%), Positives = 83/183 (45%), Gaps = 22/183 (12%)

Query: 116  GLIDFMN-TRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYK 174
            G ID  +   L+N + E E+  I  Q+  GI  +H     +IHRDIK ENV++  TG  K
Sbjct: 1272 GCIDLFDLIELKNNMTEMEVKLIFKQIVSGIKHLH--DQAIIHRDIKDENVIVDATGFVK 1329

Query: 175  VCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMI--DLYRGHPIDEKSDIWAL 232
            + DFGS   V   P           DV   T   Y +PE++  D Y G P     DIWA+
Sbjct: 1330 LIDFGSAAHVKSGP----------FDVFVGTI-DYAAPEVLSGDPYEGKP----QDIWAI 1374

Query: 233  GVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQV 292
            G+ LY + +   PF    E  IL     F      S   K LI  +L  N  +RP +  +
Sbjct: 1375 GILLYTIVFKENPFYNIDE--ILEGELTFSESSDVSAECKALISMILNRNVQKRPTIDDI 1432

Query: 293  LED 295
              D
Sbjct: 1433 YND 1435

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score = 91.3 bits (225), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 77/285 (27%), Positives = 136/285 (47%), Gaps = 34/285 (11%)

Query: 27  YLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           +L  GGFA+ +  +      F    VA L    +  + +   L +E+   K +++ ++VV
Sbjct: 87  FLGEGGFARCFQIKDDSGKIFAAKTVAKLS---IKSEKTRKKLLSEIQIHKSMKH-QNVV 142

Query: 87  SYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIA 146
            +ID     ++       V++L+E C  G L+D +  R    L E E+    +Q+   I 
Sbjct: 143 QFIDCFEDDTN-------VYILLEICPNGSLMDLLKKR--KLLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTT 206
            MH+ +  +IHRD+K+ N+        K+ DFG +  V+    N +E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFG-LAAVL---ANDRERKYTV-----CGT 242

Query: 207 AQYRSPE-MIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSR-----FQ 260
             Y +PE ++  + GH  +   DIW++GV LY L     PF+   ++  ++ R     F 
Sbjct: 243 PNYIAPEVLMGKHSGHSYE--VDIWSIGVMLYALLIGKPPFQ-SKDVNTIYERIKCCDFS 299

Query: 261 FPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQGIQCP 305
           FP +   S+  K LI+ +L  +P +RP++ +++ D    +GI  P
Sbjct: 300 FPKEKHISNEAKVLIQDLLSLDPLERPSISEIM-DYVWFRGIFPP 343

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score = 91.3 bits (225), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 99/208 (47%), Gaps = 49/208 (23%)

Query: 104 EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
           +V++ +EYC G  L D + +   +R+   E   + +Q++  +   H++    +HRD+K+E
Sbjct: 106 KVWMALEYCPGKELYDHLLS--LHRISLLECAELFAQISGAVYYAHSMH--CVHRDLKLE 161

Query: 164 NVLISHTGQYKVCDFG------------SVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRS 211
           N+L+   G  K+ DFG            +VCG                      T  Y +
Sbjct: 162 NILLDKNGNAKLTDFGFTRECMTKTTLETVCG----------------------TTVYMA 199

Query: 212 PEMID--LYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGEL----AILHSRFQFPAQP 265
           PE+I+   Y G  I    DIW+LGV LY L   + PF+   E+     I++    + +  
Sbjct: 200 PELIERRTYDGFKI----DIWSLGVILYTLITGSLPFDDDDEVKTKWKIVNEEPNYDSTL 255

Query: 266 IYSDRLKGLIRRMLMENPDQRPNVCQVL 293
           I  D  K LI R+L +NP +RP++ QVL
Sbjct: 256 I-PDDAKDLISRLLAKNPKERPSLPQVL 282

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score = 91.3 bits (225), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 62/208 (29%), Positives = 97/208 (46%), Gaps = 49/208 (23%)

Query: 104 EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
           +V++ +EYC G  L D + ++  +RL   E   + +Q+T  +   H L    +HRD+K+E
Sbjct: 107 KVWMALEYCPGKELYDHLLSK--SRLPTLECAELFAQITGAVHYAHTLN--CVHRDLKLE 162

Query: 164 NVLISHTGQYKVCDFG------------SVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRS 211
           NVL+   G  K+ DFG            +VCG                      T  Y +
Sbjct: 163 NVLLDKNGNAKLTDFGFTRESMTKAVLETVCG----------------------TTVYMA 200

Query: 212 PEMIDLYRGHPIDE-KSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDR 270
           PEMI   +  P D  K DIW+LGV LY L     PF++  +L  L  +      P+  +R
Sbjct: 201 PEMI---QHKPYDGFKVDIWSLGVILYTLLCGCLPFDEDDDL--LTKQKIINDTPVIDER 255

Query: 271 L-----KGLIRRMLMENPDQRPNVCQVL 293
           +     + LI ++L ++P +RPN   +L
Sbjct: 256 ITIPEAQNLIEQLLSKDPTERPNTSAIL 283

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score = 91.3 bits (225), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 101/209 (48%), Gaps = 51/209 (24%)

Query: 105 VFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           V++ +EYC G  L +++   ++ R+   E  ++ SQ+   +   H+++   +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYL--LIKKRIPLDECSHLFSQIVGAVFYAHSMK--CVHRDLKLEN 158

Query: 165 VLISHTGQYKVCDFG------------SVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSP 212
           +L+   GQ K+ DFG            +VCG                      T  Y +P
Sbjct: 159 ILLDKKGQAKLTDFGFTRECATKGILETVCG----------------------TTVYMAP 196

Query: 213 EMIDL--YRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDR 270
           E+I+   Y G+ I    D W+LG+ LY + +   PF++  ++   +       +P Y D 
Sbjct: 197 ELIERKPYEGYKI----DTWSLGIILYTMIHGAMPFDEEDDIKTKYRIVN--NEPFYDDN 250

Query: 271 L-----KGLIRRMLMENPDQRPNVCQVLE 294
                 K LI ++L ++P QRP++ QVL+
Sbjct: 251 FIDANGKDLIMQLLQKDPSQRPSLTQVLQ 279

>KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.24
           YDR523C
          Length = 507

 Score = 90.1 bits (222), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 71/267 (26%), Positives = 123/267 (46%), Gaps = 27/267 (10%)

Query: 31  GGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYID 90
           G F  VY A       ++   V  L+         ++ L  E+  +  L+++ ++++YI 
Sbjct: 25  GNFGDVYKAIDNITKKYVAIKVINLEY----SDEDIDLLAQEIFFLAELKSD-YIINYIT 79

Query: 91  SHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHA 150
           +     S       ++++M+YC GG   D +     N + E ++  I+  V  G+  +H 
Sbjct: 80  TIMEDVS-------MWIVMDYCGGGSCSDLIKIVYPNGIVEEKVSFIVKNVLLGLQYLHE 132

Query: 151 LQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYR 210
            +   IHRDIK  N+L++  GQ K+ DFG V G I+       F           T  + 
Sbjct: 133 QKK--IHRDIKAANILLTDDGQVKLGDFG-VSGQIKATLKRDTFV---------GTPYWM 180

Query: 211 SPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPI---Y 267
           +PE+I+    +  DEK DIW+LG+  Y+L     P  K   + ++ S  +     +   Y
Sbjct: 181 APEVINKEINNGYDEKVDIWSLGITTYELLKGVPPLSKYDPVKVMTSLVKRKPPKLHGPY 240

Query: 268 SDRLKGLIRRMLMENPDQRPNVCQVLE 294
           +D  K  I   L+++P  RPNV  +L+
Sbjct: 241 NDFTKSFISFCLIKDPKLRPNVQNLLK 267

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score = 90.5 bits (223), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 76/292 (26%), Positives = 138/292 (47%), Gaps = 34/292 (11%)

Query: 11  PGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLR 70
           P  + T G  + + + +L  GGFA+ +  +      F    VA   ++ +  + +   L 
Sbjct: 63  PSLIKTKGRDYHRGM-FLGEGGFARCFQMKDDSGKVFAAKTVA---KISIKSEKTRKKLL 118

Query: 71  AEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQ 130
           +E+   K +++  ++V + D     ++       V++L+E C  G L+D +  R Q  L 
Sbjct: 119 SEIQIHKSMKH-PNIVQFTDCFEDDTN-------VYILLEICPNGSLMDLLKQRKQ--LT 168

Query: 131 EFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQN 190
           E E+    +Q+   I  MH+ +  +IHRD+K+ N+        K+ DFG +  V+    N
Sbjct: 169 EPEVRFFTTQIVGAIKYMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFG-LAAVL---AN 222

Query: 191 PQEFAYVQHDVLKNTTAQYRSPEMI-DLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKG 249
            +E  Y         T  Y +PE++   + GH  +   DIW++GV +Y L     PF+  
Sbjct: 223 DRERKYTI-----CGTPNYIAPEVLTGKHTGHSFE--VDIWSIGVMIYALLIGKPPFQ-A 274

Query: 250 GELAILHSR-----FQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDV 296
            E+  ++ R     F FP     S   K LI+ +L  +P +RP++ +++E V
Sbjct: 275 KEVNTIYERIKVCDFSFPKDKPISSEAKVLIKDILSLDPLERPSLAEIMEYV 326

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 90.5 bits (223), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 127/274 (46%), Gaps = 34/274 (12%)

Query: 27  YLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           +L  GGFA+ +  +      F    VA   ++ +  + + N L +E+   K +R+ +++V
Sbjct: 103 FLGEGGFARCFQMKDDDGKVFAAKTVA---KISIKSEKARNKLLSEIQIHKNMRH-QNIV 158

Query: 87  SYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIA 146
            +ID              V++L+E C  G L+D +  R    L E E+    +Q+   + 
Sbjct: 159 HFIDCFE-------DDINVYILLEICPNGSLMDLLKRR--KILTEPEVRFFTTQICGALD 209

Query: 147 AMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTT 206
            MH+    +IHRD+K+ N+        K+ DFG     I   +N +++           T
Sbjct: 210 HMHSRN--IIHRDLKLGNIFFDKDFNLKIGDFG--LAAIINNENERKYTIC-------GT 258

Query: 207 AQYRSPEMIDLYR--GHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELA-----ILHSRF 259
             Y +PE+I   +  GH  +   DIW+LGV ++ +     PF+   E++     I H  +
Sbjct: 259 PNYIAPEVIMGGKQIGHSFE--VDIWSLGVMIFAMITGKPPFQ-AKEVSTIYDRIKHCNY 315

Query: 260 QFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVL 293
            FP     S  +K LI+ +L  NP +RP + ++L
Sbjct: 316 SFPTDKYVSKDVKKLIQDILSMNPMERPTIQEIL 349

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 90.5 bits (223), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 75/276 (27%), Positives = 131/276 (47%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           +L  GGFA+ +  +    + F    VA   +  +  + +   L +E+   K + ++ ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-SHPNIV 142

Query: 87  SYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIA 146
            +ID     S+       V++L+E C  G L++ +  R    L E E+    +Q+   I 
Sbjct: 143 QFIDCFEDDSN-------VYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTT 206
            MH+ +  +IHRD+K+ N+        K+ DFG +  V+    N  E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANESERKYTI-----CGT 242

Query: 207 AQYRSPE-MIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSR-----FQ 260
             Y +PE ++  + GH  +   DIW+LGV LY L     PF+   ++  ++ R     F 
Sbjct: 243 PNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKCRDFS 299

Query: 261 FPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDV 296
           FP     SD  K LIR +L  +P +RP++ ++++ V
Sbjct: 300 FPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 90.5 bits (223), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 76/285 (26%), Positives = 136/285 (47%), Gaps = 34/285 (11%)

Query: 27  YLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           +L  GGFA+ +  +      F    VA L    +  + +   L +E+   K +R+  ++V
Sbjct: 106 FLGEGGFARCFQIKDDSGKIFAAKTVAKLS---IKTEKTRKKLLSEIQIHKSMRH-ANIV 161

Query: 87  SYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIA 146
            +ID    +++       V++L+E C  G L++ +  R    L E E+    +Q+  GI 
Sbjct: 162 QFIDCFEDETN-------VYILLEICPNGSLMELLKKR--KTLTEPEVRFFTTQICGGIK 212

Query: 147 AMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTT 206
            MH+ +  +IHRD+K+ N+        K+ DFG +  V+    N +E  Y         T
Sbjct: 213 YMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFG-LAAVL---ANDRERKYTVCG-----T 261

Query: 207 AQYRSPE-MIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSR-----FQ 260
             Y +PE ++  + GH  +   DIW++GV +Y L     PF+   ++  ++ R     F 
Sbjct: 262 PNYIAPEVLMGKHSGHSYE--VDIWSIGVMIYALLIGKPPFQ-AKDVNTIYERIKCCDFV 318

Query: 261 FPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQGIQCP 305
           FP +   S   + L++ +L  +P +RP++ +VL D    +GI  P
Sbjct: 319 FPKEKYISSEARILVQDLLSLDPLERPSIMEVL-DYVWFRGIFPP 362

>Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C
           (REAL)
          Length = 364

 Score = 88.2 bits (217), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 78/333 (23%), Positives = 137/333 (41%), Gaps = 61/333 (18%)

Query: 13  TVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVA-----CLKRVIVPDKPSLN 67
           T + V     K+   L  GG + VY  ++      +++ +       LK++I P   S++
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGMSFVYLVQLLKNSLIMENGIITPEMYALKKIICPSVESIS 80

Query: 68  TLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRL-- 125
               E++  K  ++  +V+  IDS   +    NGS  +++++ Y + G L D +N RL  
Sbjct: 81  NGMREIENYKRFQS-PYVIQSIDSQVTQEK--NGSKIIYIILPYYSLGSLQDSINRRLLE 137

Query: 126 QNRLQEFEILNIMSQVTQGIAAMH------------------------------------ 149
              + E E + IM  VT+G+  +H                                    
Sbjct: 138 GTFISEAECVRIMLGVTRGLLCLHDPASRQDNITPRVNVDAVSMTYSDETAMLLEDTPLE 197

Query: 150 --------ALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDV 201
                   A      HRDI   N+L S  G   + D GS         +  + + +Q  V
Sbjct: 198 MDVLSSGSAGSIAYAHRDITPSNILYSSEGLPVIADLGSCSQADIRIGSRNQLSELQEWV 257

Query: 202 LKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGEL-------AI 254
             N T  Y +PE+++L     +  K DIW++G   Y L +  +PFE+  ++       AI
Sbjct: 258 NDNCTLPYTAPELLNLKLNQILSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASITYAI 317

Query: 255 LHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRP 287
              ++ FP    +S+ L  +I++ +  +P QRP
Sbjct: 318 NTGKYSFPRNSRFSEALLNVIKKCIQVDPIQRP 350

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 90.1 bits (222), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 75/276 (27%), Positives = 131/276 (47%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           +L  GGFA+ +  +    + F    VA   +  +  + +   L +E+   K + ++ ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-SHPNIV 142

Query: 87  SYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIA 146
            +ID     S+       V++L+E C  G L++ +  R    L E E+    +Q+   I 
Sbjct: 143 QFIDCFEDDSN-------VYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTT 206
            MH+ +  +IHRD+K+ N+        K+ DFG +  V+    N  E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANESERKYTI-----CGT 242

Query: 207 AQYRSPE-MIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSR-----FQ 260
             Y +PE ++  + GH  +   DIW+LGV LY L     PF+   ++  ++ R     F 
Sbjct: 243 PNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKCRDFS 299

Query: 261 FPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDV 296
           FP     SD  K LIR +L  +P +RP++ ++++ V
Sbjct: 300 FPRDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score = 90.1 bits (222), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 76/292 (26%), Positives = 138/292 (47%), Gaps = 34/292 (11%)

Query: 11  PGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLR 70
           P  + T G  + + + +L  GGFA+ +  +      F    VA   ++ +  + +   L 
Sbjct: 63  PSLIKTKGRDYHRGM-FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLL 118

Query: 71  AEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQ 130
           +E+   K +R+  ++V + D     ++       V++L+E C  G L+D +  R Q  L 
Sbjct: 119 SEIQIHKSMRH-PNIVQFTDCFEDDTN-------VYILLEICPNGSLMDLLKQRKQ--LT 168

Query: 131 EFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQN 190
           E E+    +Q+   I  MH+ +  +IHRD+K+ N+        K+ DFG +  V+    N
Sbjct: 169 EPEVRFFTTQIVGAIKYMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFG-LAAVL---AN 222

Query: 191 PQEFAYVQHDVLKNTTAQYRSPEMI-DLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKG 249
            +E  Y         T  Y +PE++   + GH  +   D+W++GV +Y L     PF+  
Sbjct: 223 DRERKYTI-----CGTPNYIAPEVLTGKHTGHSFE--VDVWSIGVMIYALLIGKPPFQ-A 274

Query: 250 GELAILHSR-----FQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDV 296
            E+  ++ R     F FP     S   K LI+ +L  +P +RP++ +++E V
Sbjct: 275 KEVNTIYERIKVCDFNFPRDKPISSEAKVLIKDILSLDPLERPSLTEIMEYV 326

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score = 90.5 bits (223), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 100/197 (50%), Gaps = 27/197 (13%)

Query: 104 EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
           E++L++EY  GG L D++ ++   +L E E ++  +Q+ QG++  H+    + HRD+K E
Sbjct: 200 ELYLVLEYVDGGELFDYLVSK--GKLSEPEAVHYFTQIIQGVSYCHSFN--ICHRDLKPE 255

Query: 164 NVLISHTGQY-KVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMI--DLYRG 220
           N+L+    +  K+ DFG     +  P    E +          +  Y SPE++    Y G
Sbjct: 256 NLLLDKKNKVIKIADFG--MAALELPNKLLETSC--------GSPHYASPEIVMGKPYHG 305

Query: 221 HPIDEKSDIWALGVFLYKLCYYTTPFE----KGGELAILHSRFQFPAQPIYSDRLKGLIR 276
            P    SD+W+ G+ L+ L     PF     K   L +   RFQ P  P  ++  K LI 
Sbjct: 306 GP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGRFQLP--PYLTNDAKDLIT 359

Query: 277 RMLMENPDQRPNVCQVL 293
           R+L+ NP++R  + ++L
Sbjct: 360 RILVTNPEKRLTINEIL 376

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 89.0 bits (219), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 96/196 (48%), Gaps = 22/196 (11%)

Query: 105 VFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           ++++MEYC GG   D +       L E ++  I   V +G+  +H  +   IHRD+K  N
Sbjct: 92  MWIVMEYCGGGSCSDLIRYHYNEGLHEDKVAFITKNVLRGLQYLHEQRK--IHRDVKAAN 149

Query: 165 VLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPID 224
           VL++  G  K+ DFG V G +R       F           T  + +PE+I     H  +
Sbjct: 150 VLLTDDGLVKLADFG-VSGQLRSTAKRNTFV---------GTPYWMAPEIIS-NSSHGYN 198

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPI------YSDRLKGLIRRM 278
           EK+DIW+LG+ +Y+L     P+ K     ++ +    P + +      +SD  K  I   
Sbjct: 199 EKADIWSLGITVYELLKGCPPYAKYDAGKVMRN---IPKKNLQDCMVSFSDAAKLFISAC 255

Query: 279 LMENPDQRPNVCQVLE 294
           L+++PD+RP   ++L+
Sbjct: 256 LIKDPDERPTATELLQ 271

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 90.1 bits (222), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 103/219 (47%), Gaps = 38/219 (17%)

Query: 104 EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
           E++L++EY  GG L D++  R   +L E E ++   Q+ QG++  H     + HRD+K E
Sbjct: 138 ELYLVLEYVEGGELFDYLIAR--GKLPEQEAIHYFKQIVQGVSYCHNFN--ICHRDLKPE 193

Query: 164 NVLISHTGQ-YKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTA--QYRSPEMI--DLY 218
           N+L+    +  K+ DFG                   + +L+ +     Y SPE++    Y
Sbjct: 194 NLLLDKKNKTVKIADFGMAA------------LETTNRLLETSCGSPHYASPEIVMGQKY 241

Query: 219 RGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGE----LAILHSRFQFPAQPIYSDRLKGL 274
            G P    SD+W+ G+ L+ L     PF         L + H R+Q P+    S   K L
Sbjct: 242 HGSP----SDVWSCGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMPSN--VSKEAKDL 295

Query: 275 IRRMLMENPDQRPNVCQVLE-------DVSRMQGIQCPV 306
           I ++L+ +P++R  V ++LE       D     G+ CP+
Sbjct: 296 ISKILVVDPEKRITVDKILEHPLLVKYDNPGKGGLACPL 334

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 89.4 bits (220), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 74/276 (26%), Positives = 130/276 (47%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           +L  GGFA+ +  +    + F    VA   +  +  + +   L +E+   K +  + ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-AHPNIV 142

Query: 87  SYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIA 146
            ++D     S+       V++L+E C  G L++ +  R    L E E+    +Q+   I 
Sbjct: 143 QFVDCFEDDSN-------VYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTT 206
            MH+ +  +IHRD+K+ N+        K+ DFG +  V+    N  E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANESERKYTI-----CGT 242

Query: 207 AQYRSPE-MIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSR-----FQ 260
             Y +PE ++  + GH  +   DIW+LGV LY L     PF+   ++  ++ R     F 
Sbjct: 243 PNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKCRDFS 299

Query: 261 FPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDV 296
           FP     SD  K LIR +L  +P +RP++ ++++ V
Sbjct: 300 FPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score = 89.7 bits (221), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 101/196 (51%), Gaps = 27/196 (13%)

Query: 105 VFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           V++++EYC+G  L + +    + RL   E   + SQ+   +   H L+   +HRD+K+EN
Sbjct: 103 VWMVLEYCSGHELYEHL--LKEQRLSLEESKKLFSQIASAVYYAHELK--CVHRDLKLEN 158

Query: 165 VLISHTGQYKVCDFGSVCGVIRPPQNPQEFAY-VQHDVLKNTTAQYRSPEMID--LYRGH 221
           VL+   G  K+ DFG            +E A   Q + +  TT  Y +PE+I+   Y G 
Sbjct: 159 VLLDGNGHAKLTDFGFT----------REMATRSQLETICGTTV-YMAPELIERKCYDGF 207

Query: 222 PIDEKSDIWALGVFLYKLCYYTTPFEKGGE----LAILHSRFQFPAQPIYSDRLKGLIRR 277
            +    DIW+LG+ LY +     PF++  +    L I++    F  + I  D +  LI+ 
Sbjct: 208 KV----DIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDFNQEWISDDAI-DLIQG 262

Query: 278 MLMENPDQRPNVCQVL 293
           ML +NP++R ++ QVL
Sbjct: 263 MLRKNPNERISLAQVL 278

>NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24
          Length = 535

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 75/283 (26%), Positives = 129/283 (45%), Gaps = 36/283 (12%)

Query: 19  SHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKL 78
           +H+  V   +  G F  VY A  +  +  +   V  L+         L  L  E+  +  
Sbjct: 19  AHNYIVKECVGRGNFGDVYRAIDRTTNKVVAIKVVDLENT----NERLEVLAQEIFFLAE 74

Query: 79  LRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIM 138
           L++  ++++YI +    +S       ++++MEYC GG   D +     N L E ++  I 
Sbjct: 75  LKS-PYIINYITTLLEDAS-------MWIVMEYCGGGSCSDLLKYYFNNGLPEKKVAYIT 126

Query: 139 SQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQ 198
            ++ +G+  +H  +   IHRDIK  N+L++  G  K+ DFG V G ++            
Sbjct: 127 REILKGLQYLH--EQKKIHRDIKAANILLTEEGHVKLGDFG-VSGQLKSTLRRGTIV--- 180

Query: 199 HDVLKNTTAQYRSPEM----IDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAI 254
                  T  + +PE+    I+ Y     DEK DIW+LG+ +++L     P  K   + +
Sbjct: 181 ------GTPYWMAPEVASQNIEGY-----DEKIDIWSLGITVFELLKGVPPLVKLDPIRV 229

Query: 255 LH--SRFQFP-AQPIYSDRLKGLIRRMLMENPDQRPNVCQVLE 294
           L   SR   P  Q  YSD  K  +   L++NP++RP    +L+
Sbjct: 230 LANLSRKSAPRLQGAYSDAAKSFVALCLIKNPNERPAAVDLLK 272

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 89.0 bits (219), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 73/285 (25%), Positives = 138/285 (48%), Gaps = 34/285 (11%)

Query: 27  YLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           +L  GGFA+ +  + +    F    VA   ++ +  + +   L +E+   K +++  ++V
Sbjct: 97  FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTKKKLLSEIQIHKSMKH-PNIV 152

Query: 87  SYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIA 146
            ++D     ++       V++L+E C+ G L+D M  R    L E E+    +Q+   + 
Sbjct: 153 HFVDCFEDDTN-------VYILLEICSNGSLMDLMKKR--KTLTEPEVRFFTTQICGAVK 203

Query: 147 AMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTT 206
            MH+ +  +IHRD+K+ N+        KV DFG +  V+    N +E  Y         T
Sbjct: 204 YMHSRR--VIHRDLKLGNIFFDKDYNLKVGDFG-LAAVL---ANNRERKYTV-----CGT 252

Query: 207 AQYRSPE-MIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSR-----FQ 260
             Y +PE ++  + GH  +   DIW++GV +Y L     PF+   ++ +++ R     + 
Sbjct: 253 PNYIAPEVLMGKHAGHSFE--VDIWSIGVMIYALLVGKPPFQ-AKDVNVIYDRIKACQYG 309

Query: 261 FPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQGIQCP 305
           +P     S   K LI  +L  +P +RP++ ++++DV   +GI  P
Sbjct: 310 YPKDKYVSSEAKTLIADILCVDPVERPSIREIIDDV-WFRGIFPP 353

>KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {ON}
           weakly similar to uniprot|Q03306 YDR466W Saccharomyces
           cerevisiae YDR466W Protein kinase with similarity to
           mammalian phosphoinositide-dependent kinase 1 (PDK1) and
           yeast Pkh1p and Pkh2p, two redundant upstream activators
           of Pkc1p; identified as a multicopy suppressor of a pkh1
           pkh2 double mutant
          Length = 647

 Score = 89.0 bits (219), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/280 (25%), Positives = 125/280 (44%), Gaps = 30/280 (10%)

Query: 28  LTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKH--- 84
           L  G ++ VY A  +         V   K +I  +K    T+  E + + LL +  H   
Sbjct: 16  LGHGSYSTVYKAVDRSTGQLFAIKVCSKKHIISENKVKYVTI--EKNTLNLLAHGNHPGI 73

Query: 85  VVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQG 144
           +  Y   H +++        ++ ++++  GG L+  + T  Q R  E    + M Q+   
Sbjct: 74  IKLYYTFHDSEN--------LYFVLDFAPGGELLQLLQT--QGRFNEAWTKHFMCQLIDA 123

Query: 145 IAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKN 204
           +  +H  +  ++HRD+K EN+L+S  G+  + DFG    +          ++V       
Sbjct: 124 LEYIHGCK--VVHRDLKPENLLLSSEGKLMITDFGVASNLAATDNLSSTSSFVG------ 175

Query: 205 TTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQ 264
            TA+Y SPE++   + +     SDIWA+G  LY+    T PF    ELA           
Sbjct: 176 -TAEYVSPELLLQNKSNFC---SDIWAVGCMLYQFTQGTPPFRGENELAAFEKIVNLDYH 231

Query: 265 PIY--SDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQGI 302
            IY  S  +  L+ ++L+ +PD R  + Q+ ++ +  QGI
Sbjct: 232 WIYMVSQHITDLVSKILVLDPDSRYTLPQI-KNHAWFQGI 270

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 89.0 bits (219), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 100/209 (47%), Gaps = 51/209 (24%)

Query: 105 VFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           V++ +EYC G  L +++  +    L+E   L   SQ+   +   H+++   +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYLLAKKHIPLEECSEL--FSQIVGAVYYAHSMK--CVHRDLKLEN 158

Query: 165 VLISHTGQYKVCDFG------------SVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSP 212
           +L+   G  K+ DFG            ++CG                      T  Y +P
Sbjct: 159 ILLDKKGHAKLTDFGFTRECATKGILETICG----------------------TTVYMAP 196

Query: 213 EMIDL--YRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDR 270
           E+I+   Y G+ I    D W+LG+ LY + + T PF++  E+   +    +   P Y + 
Sbjct: 197 ELIERKPYEGYKI----DTWSLGIILYTMIHGTMPFDEVDEVKTKYKIVHY--NPTYDND 250

Query: 271 L-----KGLIRRMLMENPDQRPNVCQVLE 294
                 K LI ++L ++P+QRP++ QVL+
Sbjct: 251 YIDSNGKELISQLLEKDPNQRPSLTQVLQ 279

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 61/200 (30%), Positives = 99/200 (49%), Gaps = 33/200 (16%)

Query: 105 VFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           V++ +EYC G  L D++   L+ R+   E   + +Q+   +   H+LQ   +HRD+K+EN
Sbjct: 103 VWMALEYCPGNELYDYL--LLKQRIPLDETRRLFAQIVSAVFYAHSLQ--CVHRDLKLEN 158

Query: 165 VLISHTGQYKVCDFGSV--CGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMI--DLYRG 220
           +L+   G   + DFG    C               Q + +  TT  Y +PE+I  + Y G
Sbjct: 159 ILLDKNGYAMLTDFGFTRECAT-----------KTQLETVCGTTV-YMAPELIKREAYDG 206

Query: 221 HPIDEKSDIWALGVFLYKLCYYTTPFEKGGE----LAILHSRFQFPA--QPIYSDRLKGL 274
           + +    D W+LG+ LY + +   PF++       L I+H     PA      S + K L
Sbjct: 207 YKV----DTWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEE---PAVLDEYTSPQAKDL 259

Query: 275 IRRMLMENPDQRPNVCQVLE 294
           I R+L +N  QRPN+ +VL+
Sbjct: 260 IVRLLDKNAAQRPNLNEVLQ 279

>ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakly
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1262

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 73/233 (31%), Positives = 106/233 (45%), Gaps = 33/233 (14%)

Query: 66   LNTLRAEVDAMKLLRNNKH----VVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFM 121
            L T+ +E+  M  L  NKH    +++ ID       F +  Y  ++        G ID  
Sbjct: 1049 LGTIPSEIQIMAAL--NKHPDGNILTLIDF------FEDDDY-YYIETPVHGETGCIDLF 1099

Query: 122  N-TRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180
            +   L+  + E+E   I  QV   I  +H+    ++HRDIK ENV++   G  K+ DFGS
Sbjct: 1100 DLIELKTNMTEYEAKLIFRQVVSAIRHLHS--QGIVHRDIKDENVVVDSKGFVKLIDFGS 1157

Query: 181  VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEK-SDIWALGVFLYKL 239
               V   P           DV   T   Y +PE++    G P D K  DIWA+GV LY +
Sbjct: 1158 AAYVKSGP----------FDVFVGTI-DYAAPEVL---SGEPFDGKPQDIWAIGVLLYTI 1203

Query: 240  CYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQV 292
             +   PF    E  IL    +F      S+    LI+ +L +NP QRP + +V
Sbjct: 1204 VFKENPFYNIDE--ILEVNLKFHGTKGVSEECINLIKMILNKNPSQRPTIDEV 1254

>Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL095W
            (REAL)
          Length = 1478

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/295 (25%), Positives = 136/295 (46%), Gaps = 44/295 (14%)

Query: 52   VACLKRVIVPDKPSLN--------TLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSY 103
            +  +K+V VP   S N         LR+EV  +K L ++ ++V Y+        F N   
Sbjct: 1200 MMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL-DHLNIVQYL-------GFENKDN 1251

Query: 104  EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
               L +EY AGG +   +  R+  R  E  I ++ +QV +G+A +H+    ++HRD+K +
Sbjct: 1252 IYSLFLEYVAGGSVGSLI--RMYGRFDEPLIKHLTTQVLKGLAYLHS--KGILHRDMKAD 1307

Query: 164  NVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPI 223
            N+L+   G  K+ DF    G+ R  ++     Y   D+    T  + +PEM+D  +G+  
Sbjct: 1308 NLLLDQDGICKISDF----GISRKSKD----IYSNSDMTMRGTVFWMAPEMVDTKQGY-- 1357

Query: 224  DEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQF----PAQPIYSDRL-------K 272
              K DIW+LG  + ++     P+     L ++ + F+      A PI  D L       +
Sbjct: 1358 SAKVDIWSLGCIVLEMFAGKRPW---SNLEVVAAMFKIGKSKSAPPIPEDTLPLISQVGR 1414

Query: 273  GLIRRMLMENPDQRPNVCQVLEDVSRMQGIQCPVRNFYLLRAMEQQQQSTQNQLR 327
            G +      NP++RP   ++L     +  +    ++  L + ++   +   ++LR
Sbjct: 1415 GFLDACFEINPEKRPTATELLSHRFSVVNVTFDFKSTELAKFIKSNDKLNSSKLR 1469

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 58/203 (28%), Positives = 97/203 (47%), Gaps = 39/203 (19%)

Query: 104 EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
           +V++++EYC    L D++ ++   R+   E   I +Q+   +   H+L    +HRD+K+E
Sbjct: 104 KVWMVIEYCPNKELYDYLLSK--KRISLDESARIFAQIVGAVYYAHSLS--CVHRDLKLE 159

Query: 164 NVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNT-------TAQYRSPEMI- 215
           N+L+      K+ DFG                    D  KNT       T  Y +PE++ 
Sbjct: 160 NILLDKDNNAKLTDFG-----------------FTRDFSKNTQLETICGTTVYMAPELLR 202

Query: 216 -DLYRGHPIDEKSDIWALGVFLYKLCYYTTPFE----KGGELAILHSRFQFPAQPIYSDR 270
            + Y G+ I    DIWALG+ LY +   T PF+    K  EL I+ +   +  +    D 
Sbjct: 203 REKYDGYKI----DIWALGILLYTIINGTMPFDEDDPKKTELKIISASPDYDNKYFNDDS 258

Query: 271 LKGLIRRMLMENPDQRPNVCQVL 293
           +  L+ R+L ++P  RP + Q+L
Sbjct: 259 I-DLVNRLLSKDPSMRPTIEQIL 280

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 76/277 (27%), Positives = 134/277 (48%), Gaps = 35/277 (12%)

Query: 27  YLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           +L  GGFA+ +  +      F    VA L    +  + +   L +E+   K +++  ++V
Sbjct: 95  FLGEGGFARCFQMKDDKGKVFAAKTVAKLS---IKSEKTRRKLLSEIQIHKSMKH-PNIV 150

Query: 87  SYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIA 146
            + D     ++       V++L+E C  G +++ +  R +  L E E+   M Q+   I 
Sbjct: 151 QFTDCFEDDTN-------VYILLEICPNGSVMELL--RQRKHLTEPEVRFCMIQIIGAIR 201

Query: 147 AMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTT 206
            MH+ +  +IHRD+K+ N+        K+ DFG +  V+    N +E  Y         T
Sbjct: 202 YMHSRR--VIHRDLKLGNIFFDKEYNLKIGDFG-LAAVL---ANDKERKYTI-----CGT 250

Query: 207 AQYRSPEMI-DLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSR-----FQ 260
             Y +PE++   + GH  +   DIW++GV LY L +   PF+   E+  ++ R     F 
Sbjct: 251 PNYIAPEVLTGKHTGHSYE--VDIWSIGVMLYALLFGKPPFQ-AKEVETIYERIKCRDFI 307

Query: 261 FPA-QPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDV 296
           FPA +P+ SD  K LI  +L  NP  RP++ ++ ++V
Sbjct: 308 FPADKPVSSDA-KNLISHLLQLNPAARPSLYEITDNV 343

>TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_7.86
            YAL017W
          Length = 1262

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 70/234 (29%), Positives = 107/234 (45%), Gaps = 31/234 (13%)

Query: 66   LNTLRAEVDAMKLLR--NNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMN- 122
            L T+ +E+  M  L   +NK+++S +D       F +  Y  ++        G ID  + 
Sbjct: 1049 LGTIPSEIQIMSTLNKTSNKNILSILDF------FEDDDY-YYVEQPVHGKTGCIDLFDL 1101

Query: 123  TRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVC 182
               +  + EFE   I  Q+  GI+ +H  +  ++HRDIK ENV++   G  K+ DFGS  
Sbjct: 1102 IEFKTNMTEFEAKLIFKQIISGISHLH--ESGIVHRDIKDENVIVDAKGFVKLIDFGSAA 1159

Query: 183  GVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMI--DLYRGHPIDEKSDIWALGVFLYKLC 240
             V   P           DV   T   Y SPE++  + Y G P     DIWALG+ LY + 
Sbjct: 1160 YVKNGP----------FDVFVGTI-DYASPEVLRGEKYEGKP----QDIWALGILLYTIV 1204

Query: 241  YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLE 294
            +   PF    E  IL    +FP     S     LI+ +L  +  +RP++  + E
Sbjct: 1205 FKENPFYNIDE--ILEGDMKFPETENISANCIDLIKLILNRSALERPSITDISE 1256

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 75/276 (27%), Positives = 129/276 (46%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           +L  GGFA+ +         F    VA L    +  + +   L +E+   K ++N  ++V
Sbjct: 88  FLGEGGFARCFQFNDDSGKIFAAKTVAKLS---IKSEKTRRKLLSEIQIHKSMKN-VNIV 143

Query: 87  SYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIA 146
            +ID     ++       V++L+E C  G L+D +  R    L E E+    +Q+   I 
Sbjct: 144 QFIDCFEDDTN-------VYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 194

Query: 147 AMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTT 206
            MH+ +  +IHRD+K+ N+        K+ DFG +  V+    N +E  Y         T
Sbjct: 195 YMHSRR--VIHRDLKLGNIFFDKDYNLKIGDFG-LAAVL---ANDRERKYTV-----CGT 243

Query: 207 AQYRSPE-MIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSR-----FQ 260
             Y +PE ++  + GH  +   DIW++GV LY L     PF+   ++  ++ R     F 
Sbjct: 244 PNYIAPEVLMGKHTGHSYE--VDIWSIGVMLYALLIGKPPFQ-SKDVNTIYERIKCCDFT 300

Query: 261 FPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDV 296
           FP     S   K LI+ +L  +P +RP+V ++++ V
Sbjct: 301 FPKDKYISPEAKILIQDLLSLDPLERPSVDEIIDYV 336

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 70/276 (25%), Positives = 129/276 (46%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           +L  GGFA+ +         F    VA   ++ +  + +   L +E+   K +++  ++V
Sbjct: 100 FLGEGGFARCFQIRDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKH-VNIV 155

Query: 87  SYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIA 146
            +ID     ++       V++L+E C  G L+D +  R    L E E+    +Q+   I 
Sbjct: 156 QFIDCFEDDTN-------VYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 206

Query: 147 AMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTT 206
            MH+ +  +IHRD+K+ N+        K+ DFG    +     N +E  Y         T
Sbjct: 207 YMHSRK--VIHRDLKLGNIFFDRKYNLKIGDFGLAATL----ANDRERKYTV-----CGT 255

Query: 207 AQYRSPE-MIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSR-----FQ 260
             Y +PE ++  + GH  +   DIW++GV +Y L     PF+   ++  ++ R     F 
Sbjct: 256 PNYIAPEVLMGKHSGHSYE--VDIWSIGVMIYALIIGRPPFQ-SKDVNTIYERIKCRDFS 312

Query: 261 FPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDV 296
           FP   + S   K LI+ +L  +P +RP+V ++++ +
Sbjct: 313 FPKDKLISSEAKILIQDILSLDPLERPSVNEIMDYI 348

>ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {ON}
           some similarities with uniprot|Q03306 Saccharomyces
           cerevisiae YDR466W
          Length = 890

 Score = 88.2 bits (217), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 92/348 (26%), Positives = 160/348 (45%), Gaps = 47/348 (13%)

Query: 28  LTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVS 87
           L +G +++VY A  +     + +   C KR I+ +   +  +  E + + LL    H   
Sbjct: 18  LGNGSYSRVYKAVDRSDPQRVYAVKVCSKRHIIHEN-KVKYVTIEKNTLNLLARANHP-G 75

Query: 88  YIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAA 147
            +  H   S+F +    ++ ++++ AGG L+  +N     +  E    + ++Q+      
Sbjct: 76  IVKLH---STF-HDEENLYFVLDFAAGGELLSLLNR--VGKFTEPCARHFIAQLIDTTEF 129

Query: 148 MHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTA 207
           +H+    +IHRD+K ENVL+   G+  V DFG+   + +  +N +  A          TA
Sbjct: 130 IHSQG--VIHRDLKPENVLLHRDGRLMVTDFGTATNITK--ENTEGGASFV------GTA 179

Query: 208 QYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHS--RFQFPAQP 265
           +Y SPE++ LY  +     SD+WALG  LY+      PF    EL         ++P   
Sbjct: 180 EYVSPELL-LY--NQCQFASDVWALGCMLYQFIEGVPPFRGENELHTFEKIVALEYP--- 233

Query: 266 IYSDRLKG----LIRRMLMENPDQRPNVCQVLEDVSRMQGIQCPVRNFYLL-----RAME 316
            +++  KG    L+RR+L  +P QRP++  + +D       Q   RN   L     +   
Sbjct: 234 -WANNNKGGVVSLVRRILTLDPSQRPSLTSIKQD---KWFEQVDWRNREALWKGIWQVQP 289

Query: 317 QQQQSTQNQLRYSRTQPVLNVPIISQPVGFPMHQISGAPLGSSTSHIV 364
           Q+QQ  + Q R + + P  N+P+  Q    P      A +G++TS IV
Sbjct: 290 QRQQPLEYQYRNNISNP--NLPLAKQKRRKP------AKVGNTTSSIV 329

>Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL095W
            (REAL)
          Length = 1481

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 70/261 (26%), Positives = 123/261 (47%), Gaps = 44/261 (16%)

Query: 52   VACLKRVIVPDKPSLN--------TLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSY 103
            +  +K+V VP   S N         LR+EV  +K L ++ ++V Y+        F N + 
Sbjct: 1203 MMAVKQVEVPKYSSQNEAILGTVEALRSEVSTLKDL-DHLNIVQYL-------GFENKNN 1254

Query: 104  EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
               L +EY AGG +   +  R+  R  E  I ++ +QV +G+A +H+    ++HRD+K +
Sbjct: 1255 IYSLFLEYVAGGSVGSLI--RMYGRFDESLIRHLTTQVLKGLAYLHS--KGILHRDMKAD 1310

Query: 164  NVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPI 223
            N+L+   G  K+ DF    G+ R  ++     Y   D+    T  + +PEM+D  +G+  
Sbjct: 1311 NLLLDQDGICKISDF----GISRKSKD----IYSNSDMTMRGTVFWMAPEMVDTKQGY-- 1360

Query: 224  DEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQF----PAQPIYSDRL-------K 272
              K DIW+LG  + ++     P+     L ++ + F+      A PI  D L       +
Sbjct: 1361 SAKVDIWSLGCIVLEMFAGKRPW---SNLEVVAAMFKIGKSKSAPPIPEDTLPLISQVGR 1417

Query: 273  GLIRRMLMENPDQRPNVCQVL 293
              +      NP++RP   ++L
Sbjct: 1418 SFLDACFEINPEERPTATELL 1438

>TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa]
           {ON} Anc_1.24 YDR523C
          Length = 468

 Score = 86.3 bits (212), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 74/278 (26%), Positives = 126/278 (45%), Gaps = 36/278 (12%)

Query: 31  GGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYID 90
           G F  VY A  + +   +   V  L+         +N L  E+  +  L++  ++ +YI 
Sbjct: 26  GNFGDVYKACEKVSGKVVAVKVVNLEHT----DEDINLLAQEIFFLAELKS-PYITNYIT 80

Query: 91  SHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHA 150
           +     S       ++++MEYC GG   D +       L E +   I  +V +G+  +H 
Sbjct: 81  TMTEDVS-------MWIIMEYCGGGSCADLLRNIYNCGLPESKSAYITREVLKGLEYLHE 133

Query: 151 LQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYR 210
            +   IHRDIK  N+L++  G+ K+ DFG V G IR       F           T  + 
Sbjct: 134 QKK--IHRDIKAANILLTDEGKVKLGDFG-VSGQIRATLKRGTFV---------GTPFWM 181

Query: 211 SPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQ--PI-- 266
           +PE++        DEK+DIW+LG+ +Y+L   + P  K   + ++      P +  P+  
Sbjct: 182 APEVVS-KDSDGYDEKADIWSLGITVYELLKGSPPLYKCDPMKVM---VNLPKRKPPVLH 237

Query: 267 --YSDRLKGLIRRMLMENPDQRPNVCQVL--EDVSRMQ 300
             YS   K  +   L++NP  RP+  ++L  E V+ +Q
Sbjct: 238 GHYSSAAKHFVASCLVKNPKNRPSAVELLNSEFVTNLQ 275

>KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly
           similar to uniprot|Q03306 Saccharomyces cerevisiae
           YDR466W
          Length = 653

 Score = 86.7 bits (213), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 76/282 (26%), Positives = 132/282 (46%), Gaps = 42/282 (14%)

Query: 28  LTSGGFAQVYSAEIQPADAFIDSNV-ACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKH-- 84
           L  G ++ V+ A ++ A+   +  +  C K+ I+ ++  +  +  E D + LL    H  
Sbjct: 16  LGQGSYSTVFRA-VERANGLRNYAIKVCSKKHIIRER-KVKYVTVEKDLLNLLAGGGHPG 73

Query: 85  -VVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQ 143
            V  +   H   +        ++ ++E+ +GG L+  +  R   RL E     I SQ+  
Sbjct: 74  VVRLFCTFHDTDN--------LYYVLEFVSGGELLGLV--RRMGRLPEEWCRRIASQLVD 123

Query: 144 GIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVC----GVIRPPQNPQEFAYVQH 199
            +  MHA    +IHRD+K ENVL+S  G+  + DFG+ C    G   P    +  ++V  
Sbjct: 124 TVDYMHAKG--VIHRDLKPENVLLSQEGRIVITDFGAACCASEGGSAPGAADRAASFVG- 180

Query: 200 DVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGEL------A 253
                 TA+Y SPE++   +       SD+WALG  +Y+L     PF    EL       
Sbjct: 181 ------TAEYVSPELLLHSQ---CSFGSDVWALGCIIYQLTQGAPPFRGDTELQSFEKIV 231

Query: 254 ILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLED 295
            L  R+ + A P+    +  L++ +L+ +P QRP+  Q+ ++
Sbjct: 232 ALDYRWVYAAPPL----IVALVQSILVLDPLQRPSAKQLKQN 269

>TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1237

 Score = 87.4 bits (215), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 88/184 (47%), Gaps = 22/184 (11%)

Query: 116  GLIDFMN-TRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYK 174
            G ID  +   L+  + EFE   I  QV  GI  +H  +  ++HRDIK ENV++   G  K
Sbjct: 1069 GSIDLFDLIELKTNMTEFEAKLIFKQVISGIKHLH--EQGIVHRDIKDENVIVDSKGFVK 1126

Query: 175  VCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMI--DLYRGHPIDEKSDIWAL 232
            + DFGS   V   P           DV   T   Y +PE++  + Y G P     DIWA+
Sbjct: 1127 LIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYEGKP----QDIWAV 1171

Query: 233  GVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQV 292
            G+ LY + +   PF    E  I+    +F      S+    LI+++L +N  +RP +  +
Sbjct: 1172 GILLYTIVFKENPFYNIDE--IMEGTLKFSIGSEVSEECVNLIKKILNKNAPKRPTIQDI 1229

Query: 293  LEDV 296
             +DV
Sbjct: 1230 YDDV 1233

>SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 364

 Score = 84.7 bits (208), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 83/354 (23%), Positives = 146/354 (41%), Gaps = 75/354 (21%)

Query: 13  TVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAE 72
           +VL  G H+A +   L  GGF+ VY  + +      ++++  LK++  P       + + 
Sbjct: 20  SVLINGQHYA-IQRLLGEGGFSFVYLVQSRE-----NNDLFALKKIHCP----FGNIESV 69

Query: 73  VDAMKLLRNNKHVVSYIDSHAAKSSF---PNGSYEVFLLMEYCAGGGLID---------- 119
            +AM+ + + K   S   +H   S      +GS  VF+L+ Y   G L+D          
Sbjct: 70  SEAMREVNSYKKFRSPYITHCVSSQVLQEQDGSKTVFILLPYFPTGSLLDKINTHLLDGT 129

Query: 120 -----------------------------------FMNTRLQNR-------LQEFEILNI 137
                                               +NT LQ R        ++  +LN 
Sbjct: 130 TISEEEIVRILVSVARGLRTMHNPAGQEDSIEDQTSVNTDLQYRDTVSMTYNEDLRLLND 189

Query: 138 ---MSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEF 194
              +  ++   ++  A      H+DIK  N++ S  G   +CD GS         +  + 
Sbjct: 190 SLELDVLSGNTSSFMASTTAYSHKDIKPANIMFSSDGLPVICDLGSCSRAHVDISSRSQL 249

Query: 195 AYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGEL-- 252
              Q    ++ T  +RSPE++++     IDEK DIW+LG  LY +C+  +PFE+  +L  
Sbjct: 250 VEFQEWCNEHCTLPFRSPELLNVTLNSKIDEKVDIWSLGCTLYCMCFGISPFEREEQLSG 309

Query: 253 -----AILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQG 301
                AI   +F  P    YS  L  +I+  +  +  +RP++ ++L  +  +QG
Sbjct: 310 ASMTYAIATGKFSIPPNTNYSPELIKIIKDCIEVDSKKRPSIDELLARLQDLQG 363

>Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095W
            (BCK1) - MEKK serine/threonine kinase [contig 48] FULL
          Length = 1446

 Score = 87.0 bits (214), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 112/236 (47%), Gaps = 30/236 (12%)

Query: 66   LNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRL 125
            L  LR+EV  +K L ++ ++V Y+        F N +Y   L +EY AGG +   +  RL
Sbjct: 1193 LEALRSEVATLKDL-DHTNIVQYL-------GFENKNYVYSLFLEYVAGGSVGSLI--RL 1242

Query: 126  QNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVI 185
              +  E  I  +  QV +G++ +H+ +  ++HRD+K +N+L+   G  K+ DF    G+ 
Sbjct: 1243 YGKFDENLIRFLAVQVLRGLSYLHSKK--ILHRDMKADNLLLDVDGICKISDF----GIS 1296

Query: 186  RPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTP 245
            +   N     Y   D+    T  + +PEM+D  +G+    K DIW+LG  + ++     P
Sbjct: 1297 KKSNN----IYSNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRP 1350

Query: 246  FEKGGELAILHSRFQFPAQP--------IYSDRLKGLIRRMLMENPDQRPNVCQVL 293
            +     +A +    +F + P        I S   K  +      NP++RP   ++L
Sbjct: 1351 WSNLEVVAAMFKIGKFKSAPPIPEDTQKIISAEGKEFLDACFEINPEKRPTADELL 1406

>Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {ON}
            YJL095W (REAL)
          Length = 1484

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 71/261 (27%), Positives = 126/261 (48%), Gaps = 44/261 (16%)

Query: 52   VACLKRVIVPDKPSLN--------TLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSY 103
            +  +K+V VP   S N         LR+EV  +K L ++ ++V Y+        F N + 
Sbjct: 1206 MMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL-DHLNIVQYL-------GFENKNS 1257

Query: 104  EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
               L +EY AGG +   +  R+  R  E  I ++ +QV +G+A +H+    ++HRD+K +
Sbjct: 1258 IYSLFLEYVAGGSVGSLI--RMYGRFDESLIKHLTTQVLRGLAYLHS--KGILHRDMKAD 1313

Query: 164  NVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPI 223
            N+L+   G  K+ DF    G+ R  ++     Y   D+    T  + +PEM+D  +G+  
Sbjct: 1314 NLLLDQDGICKISDF----GISRKSKD----IYSNSDMTMRGTVFWMAPEMVDTKQGY-- 1363

Query: 224  DEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQF----PAQPIYSDRLKGLIR--R 277
              K DIW+LG  + ++     P+     L ++ + F+      A PI  D L  + R  R
Sbjct: 1364 SAKVDIWSLGCIVLEMFAGKRPW---SNLEVVAAMFKIGKSKSAPPIPEDTLPLITRVGR 1420

Query: 278  MLME-----NPDQRPNVCQVL 293
              ++     +P++RP   ++L
Sbjct: 1421 SFLDACFEIDPEKRPTATKLL 1441

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 97/208 (46%), Gaps = 49/208 (23%)

Query: 104 EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
           +V++ +EYC G  L D  +     R+   E   + +Q++  +   H++    +HRD+K+E
Sbjct: 106 KVWMALEYCPGKELYD--HLLSLRRISLLECGELFAQISGAVYYAHSMH--CVHRDLKLE 161

Query: 164 NVLISHTGQYKVCDFG------------SVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRS 211
           N+L+   G  K+ DFG            +VCG                      T  Y +
Sbjct: 162 NILLDKNGNAKLTDFGFTRECMTKTTLETVCG----------------------TTVYMA 199

Query: 212 PEMID--LYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGE----LAILHSRFQFPAQP 265
           PE+I+   Y G  I    DIW+LGV LY L     PF+   E      I++   ++ A+ 
Sbjct: 200 PELIERRTYDGFKI----DIWSLGVILYTLITGYLPFDDDDEAKTKWKIVNEEPKYDAKV 255

Query: 266 IYSDRLKGLIRRMLMENPDQRPNVCQVL 293
           I  D  + LI R+L +NP +RP++ QVL
Sbjct: 256 I-PDDARDLISRLLAKNPGERPSLSQVL 282

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 86.7 bits (213), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 121/270 (44%), Gaps = 35/270 (12%)

Query: 31  GGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPS--LNTLRAEVDAMKLLRNNKHVVSY 88
           G F  VY         +I +N  C  +V+  D     +  ++ EV  +  L+   ++  Y
Sbjct: 28  GKFGIVYKG------YYIKTNRVCAIKVLNLDSADDEVEDVQKEVQFLSSLKQVPNITHY 81

Query: 89  IDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAM 148
             S+   +       E++++MEYCAGG L   +      ++ E  I  IM ++   IA M
Sbjct: 82  YGSYLNNT-------ELWVIMEYCAGGSLRTLLR---PGKIGEQYIGVIMRELL--IALM 129

Query: 149 HALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQ 208
           H  +  +IHRDIK  NVLI++ G  K+CDFG    + +     Q  A          T  
Sbjct: 130 HIHKDGVIHRDIKAANVLITNDGHIKLCDFGVAAQLSQTKIRRQTMA---------GTPY 180

Query: 209 YRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGEL----AILHSRFQFPAQ 264
           + +PE+I    G   D K DIW+LG+  Y++     P+     L     I  S+      
Sbjct: 181 WMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRLEG 238

Query: 265 PIYSDRLKGLIRRMLMENPDQRPNVCQVLE 294
             +S  LK  I   L E+P +RP+  ++L+
Sbjct: 239 RQHSSALKEFIALCLDEDPKERPSAEELLK 268

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score = 84.7 bits (208), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 74/270 (27%), Positives = 115/270 (42%), Gaps = 33/270 (12%)

Query: 28  LTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVS 87
           L  G F +VY    +P+       +  + ++ + +       + E+D    L +      
Sbjct: 124 LGKGKFGKVYCVRHKPSGLICA--LKVMNKMEIVNFNVQKQFKREIDIQYHLNHKNLTKL 181

Query: 88  YIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAA 147
           Y   H +K+        V+L+MEY  GG L   +  +    + +    N + Q+T  +  
Sbjct: 182 YAFFHDSKN--------VYLVMEYLIGGELYKLL--KKNGPMNDITASNYVYQMTDALNY 231

Query: 148 MHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTA 207
           MH  +  +IHRD+K EN+LI    Q K+ DFG     I  P N +             T 
Sbjct: 232 MHKRK--IIHRDLKPENILIGFNNQIKLTDFG---WSIYNPNNQKRKTLC-------GTI 279

Query: 208 QYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGE----LAILHSRFQFPA 263
            Y SPE+I        DE  D+WALG+  Y+L     PFE+  +      I  S  +FP 
Sbjct: 280 DYLSPELIS---SREYDENVDVWALGILTYELVVGAPPFEEDTKEQTYKRIAKSDLKFP- 335

Query: 264 QPIYSDRLKGLIRRMLMENPDQRPNVCQVL 293
            P  S   + LI  +L   P +R N+ QV+
Sbjct: 336 -PNVSSEARDLITNLLKVVPSERFNLQQVM 364

>KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1229

 Score = 86.7 bits (213), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 71/236 (30%), Positives = 106/236 (44%), Gaps = 31/236 (13%)

Query: 65   SLNTLRAEVDAMKLLRNNKH--VVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMN 122
            +L T+ +E+  M  L    H  ++  +D       F +  Y  +L  E     G ID  +
Sbjct: 1015 TLGTIPSEIQIMVTLNRKPHENILRILDF------FEDDDY-YYLETEMHGETGSIDLFD 1067

Query: 123  -TRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSV 181
               L+  + EFE   +  QV  GI  +H     ++HRDIK ENV++ + G  K+ DFGS 
Sbjct: 1068 LIELKTNMTEFEAKLLFKQVASGIKHLH--DNGIVHRDIKDENVIVDNKGFVKLIDFGSA 1125

Query: 182  CGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMI--DLYRGHPIDEKSDIWALGVFLYKL 239
              V   P           DV   T   Y +PE++  + Y G P     DIWA+GV LY +
Sbjct: 1126 AYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYEGKP----QDIWAIGVLLYTI 1170

Query: 240  CYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLED 295
             Y   PF    E  IL    +  +    S     LIR++L  +  +RP +  ++ED
Sbjct: 1171 IYKENPFYNIDE--ILDGDLRIQSTHEVSAECVALIRKILNRSVSKRPTIDDIMED 1224

>CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31 or
            uniprot|Q08217 Saccharomyces cerevisiae YOL045w
          Length = 1206

 Score = 86.7 bits (213), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 60/183 (32%), Positives = 87/183 (47%), Gaps = 20/183 (10%)

Query: 116  GLIDFMNT-RLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYK 174
            G +D  +    ++ + EFE   I  Q+  GI  +H     ++HRDIK ENV++   G  K
Sbjct: 1038 GSVDLFDIIEFKSNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGFVK 1095

Query: 175  VCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKS-DIWALG 233
            + DFGS   V   P           DV   T   Y +PE++    G+P + KS DIWA+G
Sbjct: 1096 LIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLG---GNPYEGKSQDIWAIG 1141

Query: 234  VFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVL 293
            + LY L Y   PF    E  IL    +F      S   K LI ++L     +RP + ++ 
Sbjct: 1142 ILLYTLIYKENPFYNIDE--ILEGELRFNDSADVSQECKALITKILNRCVRKRPTIDEIC 1199

Query: 294  EDV 296
            +DV
Sbjct: 1200 QDV 1202

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 74/273 (27%), Positives = 126/273 (46%), Gaps = 33/273 (12%)

Query: 28  LTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVS 87
           L  GGFA+ +  +     +F    V+  K+ I  ++     L +E+   + LR + H+V 
Sbjct: 99  LGEGGFARCFHIKDDVGISFACKIVS--KKSIKTERTKFKLL-SEIQIHQNLRYS-HIVK 154

Query: 88  YIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAA 147
           ++D              V++L+E C  G L+D +  R    L E E+  + +QV   I  
Sbjct: 155 FMDCFE-------DELNVYILLELCPNGSLMDLLKKR--KILTEAEVKFMTTQVCGAINY 205

Query: 148 MHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTA 207
           MH+    +IHRD+K+ NV        K+ DFG    +     N  E  Y         T 
Sbjct: 206 MHS--NNIIHRDLKLGNVFFDKNFNIKIGDFGLAATL----SNVSEKKYTMCG-----TP 254

Query: 208 QYRSPEMIDLYR--GHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILH----SRFQF 261
            Y +PE+I L +  GH  +  +DIW+LG+ +Y +     PF+      I       +++F
Sbjct: 255 NYIAPEVI-LSKQIGHSFE--ADIWSLGIMIYAMVLGKPPFQAKDVTTIYEKIKLCQYEF 311

Query: 262 PAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLE 294
           P     ++ +K LI+ +L+ +P QRP +  +L+
Sbjct: 312 PPDKYITNDVKVLIQDLLVLDPSQRPRIMDILK 344

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 60/208 (28%), Positives = 97/208 (46%), Gaps = 49/208 (23%)

Query: 104 EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
           +V++ +EYC G  L D + +   +R+   E   + +Q++  +   H++    +HRD+K+E
Sbjct: 106 KVWMALEYCPGKELYDHLLS--LHRISLLECGELFAQISGAVYYAHSMH--CVHRDLKLE 161

Query: 164 NVLISHTGQYKVCDFG------------SVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRS 211
           N+L+   G  K+ DFG            +VCG                      T  Y +
Sbjct: 162 NILLDKNGNAKLTDFGFTRECMTKTTLETVCG----------------------TTVYMA 199

Query: 212 PEMI--DLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGE----LAILHSRFQFPAQP 265
           PE+I    Y G  I    D W+LGV LY L   + PF+   E      I++   ++  + 
Sbjct: 200 PELIGRKTYDGFKI----DTWSLGVILYTLITGSLPFDDDDEAKTKWKIVNEEPKYDPKL 255

Query: 266 IYSDRLKGLIRRMLMENPDQRPNVCQVL 293
           I  D  K LI R+L +NP +RP++ QVL
Sbjct: 256 I-PDDAKDLISRLLAKNPGERPSLPQVL 282

>NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141
          Length = 905

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 87/333 (26%), Positives = 141/333 (42%), Gaps = 71/333 (21%)

Query: 10  NPGTVLTVGSHHAKVISYLTSGGFAQVYSAE-IQPAD-----AFIDS----NVACLKRVI 59
           N  T + VGS    V   +  G FA V+ A  I P       + +DS    N  C    I
Sbjct: 26  NERTTIYVGSDRYIVDKEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCFAIKI 85

Query: 60  VP-----DKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAG 114
           VP     +K  L  L  E+  +K + ++ H+V  ID       F   S + +L+MEYC+ 
Sbjct: 86  VPRSKLKNKKLLENLEIEIAILKKI-SHPHIVKLID-------FERTSKDFYLIMEYCSL 137

Query: 115 GGLIDFMNTRLQ----------------------NRLQEFEILNIMSQVTQGIAAMHALQ 152
           G L   +  R Q                      N L +  ILN + Q++  +  + +  
Sbjct: 138 GDLTFLIKKRQQLIKNHPLLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRSKN 197

Query: 153 PPLIHRDIKIENVLIS-----HTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTA 207
             L+HRDIK +N+L+S     +       D G V     P     +F + +   L NT+ 
Sbjct: 198 --LVHRDIKPQNLLLSAPLINYNDPKSFHDLGFVGIYNLPILKIADFGFAR--FLPNTSM 253

Query: 208 Q--------YRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAIL---- 255
                    Y +PE+++ Y+ +  + K+D+W++G  LY++CY   PF+    L +     
Sbjct: 254 AETLCGSPLYMAPEILN-YQKY--NAKADLWSVGTVLYEMCYGNPPFKASNHLELYKKIK 310

Query: 256 --HSRFQFPAQPIYSDRLKGLIRRMLMENPDQR 286
             +    FP      + LK LI ++L  +P +R
Sbjct: 311 KANDLIYFPTYIEIDNNLKSLISKLLTFDPQER 343

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 75/285 (26%), Positives = 133/285 (46%), Gaps = 34/285 (11%)

Query: 27  YLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           +L  GGFA+ +  +      F    VA   ++ +  + +   L +E+   K +R+  ++V
Sbjct: 84  FLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHF-NIV 139

Query: 87  SYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIA 146
            +ID     ++       V++L+E C  G L+D +  R    L E E+    +Q+   + 
Sbjct: 140 QFIDCFEDDTN-------VYILLEICPNGSLMDLLKRR--KVLTEPEVRFFTTQIVGAVK 190

Query: 147 AMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTT 206
            MH+ +  +IHRD+K+ N+        K+ DFG +  V+    N +E  Y         T
Sbjct: 191 YMHSRR--VIHRDLKLGNIFFDKHYNLKIGDFG-LAAVL---ANDRERKYTV-----CGT 239

Query: 207 AQYRSPEMI-DLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQ----- 260
             Y +PE++   + GH  +   DIW+ GV +Y L     PF+   E+ I++ R +     
Sbjct: 240 PNYIAPEVLTGKHTGHSYE--VDIWSCGVMIYALLIGKPPFQ-AKEVNIIYERIKCGDYV 296

Query: 261 FPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQGIQCP 305
           FP     S     LIR +L  +P +RP++ +++ D    +GI  P
Sbjct: 297 FPRDKCISQEALTLIRDILSIDPLERPSLDEII-DYVWFRGIFPP 340

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 72/276 (26%), Positives = 130/276 (47%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           +L  GGFA+ +  +      F    VA   ++ +  + +   L +E+   K +R+  ++V
Sbjct: 84  FLGEGGFARCFQIKDDGGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHT-NIV 139

Query: 87  SYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIA 146
            ++D     ++       V++L+E C  G L+D +  R    L E E+    +Q+   + 
Sbjct: 140 QFVDCFEDDTN-------VYILLEICPNGSLMDLLKRR--KMLTEPEVRFFTTQIVGAVK 190

Query: 147 AMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTT 206
            MH+ +  +IHRD+K+ N+        KV DFG +  V+    N +E  Y         T
Sbjct: 191 YMHSRR--VIHRDLKLGNIFFDKHYNLKVGDFG-LAAVL---ANDRERKYTV-----CGT 239

Query: 207 AQYRSPEMI-DLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSR-----FQ 260
             Y +PE++   + GH  +   DIW+ GV +Y L     PF+   E+ I++ R     F 
Sbjct: 240 PNYIAPEVLTGKHTGHSYE--VDIWSCGVMIYALLIGKPPFQ-AKEVNIIYERIKCGDFV 296

Query: 261 FPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDV 296
           FP     S     LI+ +L  +P +RP++ ++++ V
Sbjct: 297 FPKDKFISPEALVLIKDILSIDPLERPSLDEIIDYV 332

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 128/276 (46%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           +L  GGFA+ +  +      F    VA   ++ +  + +   L +E+   K + ++ ++V
Sbjct: 86  FLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSM-SHTNIV 141

Query: 87  SYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIA 146
            +ID           +  V++L+E C  G L++ +  R    + E E+   M+Q+  GI 
Sbjct: 142 QFIDCFE-------DNVNVYILLEICPNGSLMELIKKR--KTITEPEVRFFMTQICGGIQ 192

Query: 147 AMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTT 206
            MH+ +  +IHRD+K+ N+        K+ DFG     +      ++F           T
Sbjct: 193 YMHSNR--VIHRDLKLGNIFFDEHYNLKIGDFG--LAAVLANDRERKFTIC-------GT 241

Query: 207 AQYRSPE-MIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSR-----FQ 260
             Y +PE ++  + GH  +   DIW++GV LY L     PF+   ++  ++ R     F 
Sbjct: 242 PNYIAPEVLMGKHSGHSYE--VDIWSIGVMLYALLIGKPPFQ-AKDVNTIYERIKQRNFA 298

Query: 261 FPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDV 296
           +P     S   K LI  +L  NP +RP++ ++++ V
Sbjct: 299 YPKDKKISQDAKYLIDDILSLNPMERPSIQEIMDYV 334

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 82/300 (27%), Positives = 131/300 (43%), Gaps = 41/300 (13%)

Query: 5   EIPNYNPGTVLTVGSHHAKVISY-LTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDK 63
           +I ++  G  L +GS     ++Y  T+G  A +   ++     F DSNV  +     PD 
Sbjct: 14  QIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAI---KVISKTIFQDSNVTSMVDNTTPDA 70

Query: 64  PSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNT 123
                 R E+  MKLL N+ +V+   D     S+       +++++EY   G L + +  
Sbjct: 71  LPYGIER-EIVIMKLL-NHANVLRLYDVWETNSN-------LYMVLEYAEKGELFNLLVE 121

Query: 124 RLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCG 183
           R    L E E +    Q+  GI+  HAL   ++HRD+K EN+L+      K+ DFG    
Sbjct: 122 R--GPLPENEAIRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDTKYNIKIADFGMA-- 175

Query: 184 VIRPPQNPQEFAYVQHDVLKNTTA---QYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240
                      A    D L  T+     Y +PE++     H     SD+W+ GV LY L 
Sbjct: 176 -----------ALETEDKLLETSCGSPHYAAPEIVSGIPYHGF--ASDVWSCGVILYALL 222

Query: 241 YYTTPF-EKGGE-----LAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLE 294
               PF E+ G      L +   +F+ P     S   + LI ++L+ NP +R     +L+
Sbjct: 223 TGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILK 282

>YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}
            BCK1Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway, which
            controls cell integrity; upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1478

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/261 (27%), Positives = 126/261 (48%), Gaps = 44/261 (16%)

Query: 52   VACLKRVIVPDKPSLN--------TLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSY 103
            +  +K+V VP   S N         LR+EV  +K L ++ ++V Y+        F N + 
Sbjct: 1200 MMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL-DHLNIVQYL-------GFENKNN 1251

Query: 104  EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
               L +EY AGG +   +  R+  R  E  I ++ +QV +G+A +H+    ++HRD+K +
Sbjct: 1252 IYSLFLEYVAGGSVGSLI--RMYGRFDEPLIKHLTTQVLKGLAYLHSKG--ILHRDMKAD 1307

Query: 164  NVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPI 223
            N+L+   G  K+ DF    G+ R  ++     Y   D+    T  + +PEM+D  +G+  
Sbjct: 1308 NLLLDQDGICKISDF----GISRKSKD----IYSNSDMTMRGTVFWMAPEMVDTKQGY-- 1357

Query: 224  DEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQF----PAQPIYSDRLKGL--IRR 277
              K DIW+LG  + ++     P+     L ++ + F+      A PI  D L  +  I R
Sbjct: 1358 SAKVDIWSLGCIVLEMFAGKRPW---SNLEVVAAMFKIGKSKSAPPIPEDTLPLISQIGR 1414

Query: 278  MLME-----NPDQRPNVCQVL 293
              ++     NP++RP   ++L
Sbjct: 1415 NFLDACFEINPEKRPTANELL 1435

>Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL045W
            (REAL)
          Length = 1101

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 69/234 (29%), Positives = 102/234 (43%), Gaps = 29/234 (12%)

Query: 66   LNTLRAEVDAMKLLRNN--KHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNT 123
            L T+ +E+  M  L  N  K+++  +D       F +  Y       +   G +  F   
Sbjct: 888  LGTIPSEIQIMATLNKNSQKNILKLLDF------FEDDDYYYIETPVHGETGSIDLFDVI 941

Query: 124  RLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCG 183
              +  + E E   +  QV   I  +H     ++HRDIK ENV++   G  K+ DFGS   
Sbjct: 942  EFKKDMVEHEAKLVFKQVVASIKHLH--NQGIVHRDIKDENVIVDSHGFVKLIDFGSAAY 999

Query: 184  VIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMI--DLYRGHPIDEKSDIWALGVFLYKLCY 241
            V   P           DV    T  Y +PE++    Y+G P     DIWALGV LY + Y
Sbjct: 1000 VKSGP----------FDVFVG-TMDYAAPEVLGGSSYKGKP----QDIWALGVLLYTIIY 1044

Query: 242  YTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLED 295
               P+    E  IL    +F      S+   GLI+R+L    D+RP + ++ ED
Sbjct: 1045 KENPYYNIDE--ILEGELRFDKAEKVSEGCIGLIKRILTREVDKRPTIDEIYED 1096

>NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1411

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 85/183 (46%), Gaps = 22/183 (12%)

Query: 116  GLIDFMN-TRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYK 174
            G ID  +    +  + EFE   I  QV  GI  +H     ++HRDIK ENV++   G  K
Sbjct: 1243 GCIDLFDLIEFKTNMTEFEAKLIFKQVVSGIKHLH--HQGIVHRDIKDENVIVDSKGLVK 1300

Query: 175  VCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMI--DLYRGHPIDEKSDIWAL 232
            + DFGS   V   P           DV   T   Y +PE++  + Y G P     DIWAL
Sbjct: 1301 IIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLSGEPYEGKP----QDIWAL 1345

Query: 233  GVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQV 292
            G+ LY + +   PF    E  IL    +F +    ++    LI+++L+     RP + ++
Sbjct: 1346 GILLYTIVFKENPFYNIDE--ILEGDLKFDSNTEVTEDCMELIKKVLIRQVRNRPAIDEI 1403

Query: 293  LED 295
             +D
Sbjct: 1404 FDD 1406

>KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa]
           {ON} Anc_2.496 YHL007C
          Length = 836

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/277 (25%), Positives = 128/277 (46%), Gaps = 49/277 (17%)

Query: 31  GGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKH--VVSY 88
           G    VY+A     DA +      +K++ +  +P    +  E+  MK   ++KH  +V++
Sbjct: 560 GASGGVYTAYEVGTDASV-----AIKQMNLEKQPKKELIINEIIVMK---DSKHPNIVNF 611

Query: 89  IDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAM 148
           IDS   K        +++++ME+  GG L D +   +   L E +I  +  +  +G+  +
Sbjct: 612 IDSFLLKG-------DLWVIMEFMEGGSLTDVVTHCI---LTEGQIGTVCRETLRGLQFL 661

Query: 149 HALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNT--- 205
           H+    +IHRDIK +N+L+S  G  K+ DFG  C  I            +H++ + T   
Sbjct: 662 HSNG--VIHRDIKSDNILLSMKGDIKLTDFG-FCAQIN-----------EHNLKRTTMVG 707

Query: 206 TAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILH-------SR 258
           T  + +PE++      P   K DIW+LG+ + ++     P+     L  L+        +
Sbjct: 708 TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIESEPPYLNETPLRALYLIATNGTPK 764

Query: 259 FQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLED 295
            + P   + SD L   +   L  NPD+R +   +LED
Sbjct: 765 LKEPE--LLSDVLNDFLSWCLKVNPDERASASTLLED 799

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 62/208 (29%), Positives = 98/208 (47%), Gaps = 49/208 (23%)

Query: 104 EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
           +V++ +EYC G  L D  +     RL   E   + +Q++  +   H++    +HRD+K+E
Sbjct: 106 KVWMALEYCPGKELYD--HLLSLRRLSLLECGELFAQISGAVYYAHSMH--CVHRDLKLE 161

Query: 164 NVLISHTGQYKVCDFG------------SVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRS 211
           N+L+   G  K+ DFG            +VCG                      T  Y +
Sbjct: 162 NILLDRNGNAKLTDFGFTRECMTKTTLETVCG----------------------TTVYMA 199

Query: 212 PEMID--LYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGEL----AILHSRFQFPAQP 265
           PE+I+   Y G  I    DIW+LGV LY L     PF+   E+     I++   ++ ++ 
Sbjct: 200 PELIERKTYDGFKI----DIWSLGVILYTLITGYLPFDDDDEVKTKWKIVNEEPKYDSKF 255

Query: 266 IYSDRLKGLIRRMLMENPDQRPNVCQVL 293
           I  D  K LI R+L +NP +RP++ QVL
Sbjct: 256 I-PDDAKDLISRLLAKNPGERPSLPQVL 282

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 70/285 (24%), Positives = 132/285 (46%), Gaps = 34/285 (11%)

Query: 27  YLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           +L  GGFA+ +         F    VA L    +  + +   L +E+   K +++ +++V
Sbjct: 150 FLGEGGFARCFQIRDDSGKLFAAKTVAKLS---IKTEKTRKKLLSEIQIHKSMKH-QNIV 205

Query: 87  SYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIA 146
            +ID     ++       V++L+E C  G L++ +  R Q  L E E+    +Q+   I 
Sbjct: 206 QFIDCFEDDTN-------VYILLEICPNGSLMELLKKRKQ--LTEPEVRFFTTQICGAIK 256

Query: 147 AMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTT 206
            MH+ +  +IHRD+K+ N+        K+ DFG     +      ++F           T
Sbjct: 257 YMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFG--LAAVLANDRERKFTVC-------GT 305

Query: 207 AQYRSPE-MIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSR-----FQ 260
             Y +PE ++  + GH  +   D+W++GV +Y L     PF+   ++  ++ R     F 
Sbjct: 306 PNYIAPEVLMGKHSGHSYE--VDVWSIGVMVYALLVGKPPFQ-AKDVNTIYERIKCCDFI 362

Query: 261 FPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQGIQCP 305
           FP +   S   K L++ +L  +P +RP++ +++ D    +GI  P
Sbjct: 363 FPKEKPISHEAKVLVQDLLSLDPLERPSISEIM-DYVWFRGIFPP 406

>ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOL045W and
            YAL017W (FUN31)
          Length = 1259

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 87/183 (47%), Gaps = 22/183 (12%)

Query: 116  GLIDFMN-TRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYK 174
            G ID  +   L+  + E E   +  QV  G+  +H  +  ++HRDIK ENV++ + G+ K
Sbjct: 1091 GSIDLFDLIELKTNMTEHEAKLLFKQVASGLRHLH--ENGIVHRDIKDENVIVDNRGRVK 1148

Query: 175  VCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMI--DLYRGHPIDEKSDIWAL 232
            + DFGS   V R P           DV   T   Y +PE++  D Y G P     D+WA+
Sbjct: 1149 IIDFGSAAYVKRGP----------FDVFVGTI-DYAAPEVLGGDPYEGKP----QDVWAV 1193

Query: 233  GVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQV 292
            GV LY + Y   PF    E  IL    +     + S+    LI R+L  + ++RP V  +
Sbjct: 1194 GVLLYTIIYKENPFYNIDE--ILDGDLRISPAVVVSEECVALITRILNRSVNRRPTVDDI 1251

Query: 293  LED 295
              D
Sbjct: 1252 CGD 1254

>KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON} 
          Length = 649

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 115/257 (44%), Gaps = 31/257 (12%)

Query: 56  KRVIVPDKPSLNTLRAEVDAMKLL--RNNKHVVSYIDSHAAKSSFPNGSYE-VFLLMEYC 112
           K+V  P+K +   +  E++  K++   ++ H+V      A + +F  G    ++++++YC
Sbjct: 70  KKVHCPNKENKRKIIKELEIYKVICRSHHNHIV------ALRDAFQWGKESCIYMILDYC 123

Query: 113 AGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQ 172
           +   L   +  R    L E E   +M Q+  GI  +H     +IH D+K+ N+L     Q
Sbjct: 124 SNNSLQSILQYR--GSLNEVECKELMIQLCGGIYWLHL--NNVIHGDLKLSNILFDEGQQ 179

Query: 173 YKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPE---MIDLYRGHPIDEKSDI 229
            K+CDFGS       P+ P E     + +   T   +++     M  L    PI    DI
Sbjct: 180 LKICDFGSSFIATSSPRGPGEIMGTPYYLAPETVYTHKNINKSGMAILLISFPI----DI 235

Query: 230 WALGVFLYKLCYYTTPFEKG---------GELA--ILHSRFQFPAQPIYSDRLKGLIRRM 278
           W++G+ LY L Y   PF K           EL   I     +FP         + LI +M
Sbjct: 236 WSMGIVLYSLLYGINPFIKSVDELHNVSLDELMQRITSGVIEFPTNKAVGAGAQQLILKM 295

Query: 279 LMENPDQRPNVCQVLED 295
           L +NP +R  + +++ D
Sbjct: 296 LSQNPLERITLVEIVCD 312

>NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {ON}
           Anc_2.496
          Length = 909

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 111/235 (47%), Gaps = 39/235 (16%)

Query: 73  VDAMKLLRNNKH--VVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQ 130
           ++ + +++ +KH  +V++IDS+           +++++MEY  GG L D +   +   L 
Sbjct: 670 INEILVMKGSKHPNIVNFIDSYLLDG-------DLWVIMEYMEGGSLTDVVTHCI---LT 719

Query: 131 EFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQN 190
           E +I  +  +   G+  +H+    ++HRDIK +N+L+S  G  K+ DFG  C        
Sbjct: 720 EGQIGAVCRETLSGLQFLHSKG--VLHRDIKSDNILLSINGNIKLTDFG-FC-------- 768

Query: 191 PQEFAYVQHDVLKNTTA----QYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPF 246
               A V    LK TT      + +PE++      P   K DIW+LG+ + ++     P+
Sbjct: 769 ----AQVNETTLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 821

Query: 247 EKGGELAILH-----SRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDV 296
                L  L+        +   +   SD LK  +   L  NPDQR +  ++LEDV
Sbjct: 822 LNETPLRALYLIATNGTPELKEREKLSDVLKHFLDWCLSVNPDQRASATELLEDV 876

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 73/282 (25%), Positives = 134/282 (47%), Gaps = 34/282 (12%)

Query: 27  YLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           +L  GGFA+ +  +      F    VA   ++ +  + +   L +E+   K +++  ++V
Sbjct: 82  FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKH-PNIV 137

Query: 87  SYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIA 146
            +ID     ++       V++L+E C  G L+D +  R    L E E+    +Q+   I 
Sbjct: 138 QFIDCFEDDTN-------VYILLEICPNGSLMDLLKKR--KVLTEPEVRYFTTQIVGAIK 188

Query: 147 AMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTT 206
            MH  +  +IHRD+K+ N+        K+ DFG +  V+    N +E  Y         T
Sbjct: 189 YMHNRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANDRERKYTV-----CGT 237

Query: 207 AQYRSPEMI-DLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQ----- 260
             Y +PE++   + GH  +   DIW++GV +Y L     PF+   E+ I++ R +     
Sbjct: 238 PNYIAPEVLAGKHSGHSYE--VDIWSIGVMIYALLIGKPPFQ-AKEVNIIYERIKSGDYI 294

Query: 261 FPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQGI 302
           FP +   S  +  LI+ +L  +P +RP++ +++ D    +GI
Sbjct: 295 FPREKPTSKEVMVLIQDILSIDPIERPSLDEIM-DYVWFRGI 335

>Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}
           similar to Ashbya gossypii AFL143C
          Length = 363

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 72/300 (24%), Positives = 127/300 (42%), Gaps = 63/300 (21%)

Query: 52  VACLKRVIVPDKPSLNTLRAEVDAMKLLR-NNKHVVSYIDSHAAKSSFPNGSYEVFLLME 110
           V  LK+V  P   +    RA  +     R N+ ++ + +D   A+    NG+  +++L+ 
Sbjct: 59  VYALKKVTCPIGRADFVTRAMTEISNYQRFNSPYITNILDFQVAQHD--NGTKIIYMLLP 116

Query: 111 YCAGGGLIDFMNTRL--QNRLQEFEILNIMSQVTQGIAAMH------------------- 149
           Y   G L D +N  +   + L E  ++ +M  + +G+  MH                   
Sbjct: 117 YFPAGSLQDLINNMIIRGDSLSESRVVRLMLDICRGVRCMHEPSESDFRDPYDVAYFDAA 176

Query: 150 ------------------ALQPPL--------IHRDIKIENVLISHTGQYKVCDFGSVCG 183
                              L PPL        +H  +  EN+++S  G   + +  S   
Sbjct: 177 SLRYSDETHLLVDAMELDLLSPPLTNSEPSAYVHCGLNPENIMLSSEGLPVIYNMASC-- 234

Query: 184 VIRPP---QNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240
            +R P    +  +   +Q  + +N+   Y  PE++DL+    I  + DIW+LG   Y L 
Sbjct: 235 -VRAPLELTSNSKLLGLQEWLNENSCLPYTCPELLDLHPNTSITNRCDIWSLGCICYALM 293

Query: 241 YYTTPFEKGGELA---ILHS----RFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVL 293
           Y  + F +  +L    I HS     F FP +P YS  LK +++R L+ +P +RP++ + L
Sbjct: 294 YSISSFAREQQLCGTPIKHSISTGNFSFPDEPRYSQSLKRIVQRCLVIDPHKRPDIYETL 353

>TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {ON}
           Anc_1.24 YDR523C
          Length = 482

 Score = 84.0 bits (206), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 97/197 (49%), Gaps = 24/197 (12%)

Query: 105 VFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           ++++MEYC GG   D +       + E ++  I+    +G+  +H  +   IHRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKMVYSKGIPESKVSYILRDTVKGLKYLHDQKK--IHRDIKAAN 143

Query: 165 VLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDL-YRGHPI 223
           +L++  G+ K+ DFG V G IR       F           T  + +PE+I+   +G+  
Sbjct: 144 ILLTDCGKVKLGDFG-VSGQIRATMKRGTFV---------GTPYWMAPEVINKQCKGY-- 191

Query: 224 DEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQP------IYSDRLKGLIRR 277
           +EK+DIW+LG+  Y+L     P  K     ++      P +        YS++ K  +  
Sbjct: 192 NEKADIWSLGITAYELLKGVPPLSKYDPFKVM---LNIPKRKPPKLHGQYSEKAKYFVSL 248

Query: 278 MLMENPDQRPNVCQVLE 294
            L+++P QRP++  +LE
Sbjct: 249 CLIKDPKQRPSIEALLE 265

>ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q7LGU7 Saccharomyces cerevisiae YPL236C
           Hypothetical ORF
          Length = 369

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 75/296 (25%), Positives = 124/296 (41%), Gaps = 59/296 (19%)

Query: 50  SNVACLKRVIVP--DKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFL 107
           +N+  LKR+  P  +  S++    EVD  K  ++  +++  +DS  A+    +GS  V++
Sbjct: 64  TNLYALKRIRCPFGNIESISGAMKEVDNYKRFQS-PYIIHLVDSQVAQQR--DGSKTVYI 120

Query: 108 LMEYCAGGGLIDFMNTRLQNR--LQEFEILNIMSQVTQGIAAMHA--------------- 150
           L+ Y   G L D  +  L N   + E E + I+  + +G+  +H                
Sbjct: 121 LLPYFPLGSLQDSTSRNLLNGTFISEAECIRIVIGIARGLRCLHDPSARSQDAEQQQEHD 180

Query: 151 ------------------LQPPLI------------HRDIKIENVLISHTGQYKVCDFGS 180
                             L+  ++            HRDIK  N+L S  G   + + GS
Sbjct: 181 AVSMSYSDEAAFLLEDTPLELDILSSANTINSNFYAHRDIKPSNILFSSDGLPVISNLGS 240

Query: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240
                       +   +Q  V  + T  Y +PE++ +     +D K DIW+LG   Y + 
Sbjct: 241 CSKADLSINTGMQLTELQAWVSDHCTVAYTAPELLHITLNRSVDTKVDIWSLGCTCYFML 300

Query: 241 YYTTPFEK-----GGEL--AILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNV 289
           +  +PFE+     G  L  AI    F FP+Q  YS+ L  LI + L  NP  RP++
Sbjct: 301 FGISPFEREEQISGASLKYAIGTGNFSFPSQDRYSEGLLKLITKCLQVNPAARPDI 356

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 113/243 (46%), Gaps = 18/243 (7%)

Query: 52  VACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEY 111
           V  L +  +  +  +  +  E +A++ + N+K +V    +   +SS       ++ L+EY
Sbjct: 207 VKVLNKEYLIKQKKVKYVNIEKNALQRINNSKMIVKLFFTFQDESS-------LYFLLEY 259

Query: 112 CAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTG 171
           C  G  +  M  +    L E       +QV   I  +H     +IHRDIK EN+L+    
Sbjct: 260 CPNGDFLSLM--KKYGSLNETVACYYSAQVIDAIDYLHT--NGIIHRDIKPENILLDKEF 315

Query: 172 QYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWA 231
           + K+ DFG+    I       +F  +        TA+Y +PE+++      +D + D+WA
Sbjct: 316 KIKLTDFGT--AKILDSSTNNKFDLLTRSKSFVGTAEYVAPELLN---DSFVDYRCDVWA 370

Query: 232 LGVFLYKLCYYTTPFEKGGELAILHS--RFQFPAQPIYSDRLKGLIRRMLMENPDQRPNV 289
            G  LY++     PF+   E        + Q+     +   ++ L++++L+++ +QRP++
Sbjct: 371 FGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLIIRDLVKKILVKDLNQRPSI 430

Query: 290 CQV 292
            Q+
Sbjct: 431 SQI 433

>Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL045W
            (REAL)
          Length = 1101

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 84/183 (45%), Gaps = 22/183 (12%)

Query: 116  GLIDFMNT-RLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYK 174
            G ID  +    +  + E E   +  QV   I  +H     ++HRDIK ENV++   G  K
Sbjct: 933  GSIDLFDVIEFKKDMVEHEAKLVFKQVVASIKHLHG--QGIVHRDIKDENVIVDSHGFVK 990

Query: 175  VCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMI--DLYRGHPIDEKSDIWAL 232
            + DFGS   +   P           DV    T  Y +PE++    Y+G P     DIWAL
Sbjct: 991  LIDFGSAAYIKSGP----------FDVFVG-TMDYAAPEVLGGSSYKGKP----QDIWAL 1035

Query: 233  GVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQV 292
            GV LY + Y   P+    E  IL    +F      S+   GLI+R+L    D+RP + ++
Sbjct: 1036 GVLLYTIIYKENPYYNIDE--ILEGELRFDKSEKVSEECIGLIKRILTREVDKRPTIDEI 1093

Query: 293  LED 295
             ED
Sbjct: 1094 YED 1096

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 58/217 (26%), Positives = 107/217 (49%), Gaps = 18/217 (8%)

Query: 104 EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
            ++ L+EY + G L+  +  +      E   +   +Q+   I  +H++   +IHRDIK E
Sbjct: 333 NLYFLLEYASNGDLLTLL--KKYGSFDETSTIYFTAQIIDSIHYIHSMG--IIHRDIKPE 388

Query: 164 NVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNT-----TAQYRSPEMI-DL 217
           N+L++   + K+ DFG+   ++ P Q  Q  +    ++L+ +     TA+Y SPE++ D 
Sbjct: 389 NILLTKDFKIKLTDFGT-AKILDPSQPSQSQSQPHFNLLERSKSFVGTAEYVSPELLTDS 447

Query: 218 YRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHS--RFQFPAQPIYSDRLKGLI 275
           Y     D + DIWA G  L++L     PF+   E        + Q+     +   L+ LI
Sbjct: 448 Y----TDSRCDIWAFGCILFQLIAGKPPFKATNEYLTFQKIIKLQYAFTAGFPTILRDLI 503

Query: 276 RRMLMENPDQRPNVCQVLEDV-SRMQGIQCPVRNFYL 311
           +++L++NP+ R  + Q+   +  R +    P   +YL
Sbjct: 504 KKILIKNPNNRLTIHQIKSHLFYRSKDFSNPWNIWYL 540

>KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON}
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase
          Length = 1338

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 69/253 (27%), Positives = 115/253 (45%), Gaps = 35/253 (13%)

Query: 31   GGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPS--------LNTLRAEVDAMKLLRNN 82
            G F  VY A            +  +K+V VP+  S        +  L++EV  +K L N+
Sbjct: 1047 GSFGAVYLAL-----NVTTGEMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKDL-NH 1100

Query: 83   KHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVT 142
             ++V Y+          NG Y +FL  EY AGG +   +  R+  R  +  I ++  QV 
Sbjct: 1101 VNIVQYLGFEEK-----NGIYSLFL--EYVAGGSVGSLI--RMYGRFDDQLIRHLTKQVL 1151

Query: 143  QGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVL 202
            +G+A +H+    ++HRD+K +N+L+ + G  K+ DF    G+ R   N     Y   D+ 
Sbjct: 1152 EGLAYLHSKG--ILHRDMKADNLLLDNDGVCKISDF----GISRKSNN----IYSNSDMT 1201

Query: 203  KNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQFP 262
               T  + +PEM+D   G+    K DIW+LG  + ++     P+     +A +    +  
Sbjct: 1202 MRGTVFWMAPEMVDTAHGY--SAKVDIWSLGCVVLEMFAGKRPWSNFEVVAAMFQIGKSK 1259

Query: 263  AQPIYSDRLKGLI 275
              P   D  K L+
Sbjct: 1260 TAPPIPDDTKDLV 1272

>CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} similar
           to uniprot|Q12236 Saccharomyces cerevisiae YOL100w PKH2
          Length = 1076

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 63/248 (25%), Positives = 117/248 (47%), Gaps = 24/248 (9%)

Query: 52  VACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEY 111
           V  L +  +  +  +  +  E +A++ L N++ +V    +   +SS       ++ L+EY
Sbjct: 210 VKVLNKEYLIKQKKVKYVNIEKNALQRLNNSRGIVKLFFTFQDESS-------LYFLLEY 262

Query: 112 CAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTG 171
              G  +  M  +    L E       +Q+  GI  +H+    +IHRDIK EN+L+    
Sbjct: 263 APNGDFLSVM--KKYGSLSEDCTRYYSAQIIDGIKYLHS--KGIIHRDIKPENILLDKDM 318

Query: 172 QYKVCDFGSVCGVIRPPQ----NPQEFAYVQHDVLKNTTAQYRSPEMI-DLYRGHPIDEK 226
           + K+ DFG+   ++ P      NP EF  +        TA+Y SPE++ D Y    +D +
Sbjct: 319 KVKITDFGT-AKILEPKNEDEDNP-EFNLLTRSKSFVGTAEYVSPELLNDSY----VDAR 372

Query: 227 SDIWALGVFLYKLCYYTTPFEKGGELAILHS--RFQFPAQPIYSDRLKGLIRRMLMENPD 284
            DIWA G  ++++     PF+   E        + Q+     +   ++ L++R+L++ P+
Sbjct: 373 CDIWAFGCMVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPVVVRDLVKRILLKVPE 432

Query: 285 QRPNVCQV 292
           QR  + Q+
Sbjct: 433 QRLTIPQI 440

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 95/200 (47%), Gaps = 31/200 (15%)

Query: 104 EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
           E++L++EY  GG L D++ ++   +L E E +    Q+ +G+   H+    + HRD+K E
Sbjct: 234 ELYLVLEYVDGGELFDYLVSK--GKLTELEAVRYFKQIIRGVQYCHSFN--ICHRDLKPE 289

Query: 164 NVLISHTGQY-KVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTA--QYRSPEMI--DLY 218
           N+L+    +  K+ DFG                 V + +LK +     Y SPE++    Y
Sbjct: 290 NLLLDKKRKLIKIADFGMAA------------LQVSNTLLKTSCGSPHYASPEIVMGKTY 337

Query: 219 RGHPIDEKSDIWALGVFLYKLCYYTTPFE----KGGELAILHSRFQFPAQPIYSDRLKGL 274
            G P    SD+W+ G+ L+ L     PF     K   + + + R+Q P     S   K L
Sbjct: 338 NGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLLIKVQNGRYQMP--NYLSKDAKDL 391

Query: 275 IRRMLMENPDQRPNVCQVLE 294
           I R+L+ NP  R    Q+LE
Sbjct: 392 ISRILLVNPKARLTTEQILE 411

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score = 84.0 bits (206), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 104/203 (51%), Gaps = 37/203 (18%)

Query: 104 EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
           +V++ +EYC G  L D++   +  R+   E   + +Q+   +   H+L    +HRD+K+E
Sbjct: 102 KVWMSLEYCPGKELYDYL--LVMRRIPLDECSRLFAQIVGAVYYAHSLN--CVHRDLKLE 157

Query: 164 NVLISHTGQYKVCDFGSV--CGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMI--DLYR 219
           N+L+   G  K+ DFG    C               Q + +  TT  Y +PE++  D Y 
Sbjct: 158 NILLDMQGNAKLADFGFTRECATKN-----------QLETICGTTV-YMAPELLRRDTYD 205

Query: 220 GHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQFP---AQPIYSDRLKG--- 273
           G  I    DIW+LGV LY L   + PF++  E     +R ++     +P Y++++     
Sbjct: 206 GFKI----DIWSLGVILYTLINGSMPFDEEDE-----TRTEWKIINEEPDYNEKIFNANS 256

Query: 274 --LIRRMLMENPDQRPNVCQVLE 294
             LI+ +L+++P +RP++ ++L+
Sbjct: 257 IELIKSLLIKDPKKRPSMTEILK 279

>KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7.86
            YAL017W
          Length = 1055

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 90/198 (45%), Gaps = 21/198 (10%)

Query: 98   FPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIH 157
            F +  Y    L  +   G +  F    L+  + EFE   I  Q+  GI  +H     ++H
Sbjct: 870  FEDDDYYYIELESHGETGSIDLFDLIELKTNMTEFEAKLIFKQIVSGIKYLH--DQGIVH 927

Query: 158  RDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMI-- 215
            RDIK ENV++   G  K+ DFGS       P       +V        T  Y +PE++  
Sbjct: 928  RDIKDENVIVDSNGFVKLIDFGSAAYTKTGPFE----VFVG-------TIDYAAPEILGG 976

Query: 216  DLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLI 275
            + Y+G P     DIWALGV LY L Y   PF    E  IL  + +F      +     LI
Sbjct: 977  NPYKGKP----QDIWALGVLLYTLIYKENPFYNVDE--ILEGQLRFDGTCNVTQDCIDLI 1030

Query: 276  RRMLMENPDQRPNVCQVL 293
            R +L ++ + RP++ +++
Sbjct: 1031 RWILTKSVNDRPSIDEIV 1048

>ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]
           {ON} similar to uniprot|P08458 Saccharomyces cerevisiae
           YDR523C SPS1 dispensable for mitosis involved in
           middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 471

 Score = 82.8 bits (203), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 74/268 (27%), Positives = 125/268 (46%), Gaps = 30/268 (11%)

Query: 31  GGFAQVYSAEIQPADAFIDSNVACLKRV-IVPDKPSLNTLRAEVDAMKLLRNNKHVVSYI 89
           G F  VY A     D  ++  V  +K V +   +  ++ L  E+  +  LR+   + +YI
Sbjct: 24  GNFGDVYKA----CDK-VEGKVVAVKVVNLEHSEEDIDLLAQEIFFLAELRS-PFITNYI 77

Query: 90  DSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMH 149
            +     S       ++++MEYC GG   D +     N + E ++  I SQV +G+  +H
Sbjct: 78  TTLTEDVS-------MWIVMEYCGGGSCADLIKHIYINGMPEKKVAFITSQVLRGLVYLH 130

Query: 150 ALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQY 209
             +   IHRDIK  N+L++  G  K+ DFG V G IR       F           T  +
Sbjct: 131 EQKK--IHRDIKAANILLTDEGTVKLGDFG-VSGQIRATLKRGTFV---------GTPYW 178

Query: 210 RSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHS--RFQFPA-QPI 266
            +PE++        DEK+DIW+LG+ +Y+L     P  K   + ++ +  + + PA    
Sbjct: 179 MAPEVVS-KENDGYDEKADIWSLGITVYELLKGAPPLSKCDPMKVMINLPKRKPPALHGH 237

Query: 267 YSDRLKGLIRRMLMENPDQRPNVCQVLE 294
           YS   K  +   L++NP  R +  +++E
Sbjct: 238 YSHSAKNFVSSCLVKNPVGRASAYEMVE 265

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score = 84.0 bits (206), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 105/232 (45%), Gaps = 36/232 (15%)

Query: 72  EVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQE 131
           E+  MKLL N+ +V+   D    KS+       +++++EY   G L + +  R    L E
Sbjct: 89  EIIIMKLL-NHTNVLRLYDVWETKSN-------LYMVLEYVEKGELFNLLVER--GPLPE 138

Query: 132 FEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNP 191
            E +    Q+  GI+  HAL   ++HRD+K EN+L+ H    K+ DFG            
Sbjct: 139 NEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGMA---------- 186

Query: 192 QEFAYVQHDVLKNTTA---QYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPF-E 247
              A    D L  T+     Y +PE++     H  +  SD+W+ GV LY L     PF E
Sbjct: 187 ---ALESKDKLLETSCGSPHYAAPEIVSGLPYHGFE--SDVWSCGVILYALLTGRLPFDE 241

Query: 248 KGGE-----LAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLE 294
             G      L +    ++ P     S   + LI ++L  +PD+R    ++L+
Sbjct: 242 DNGNIRSLLLKVQSGEYEMPGNDEISSEAQDLIAKILTVDPDRRIKTREILK 293

>KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 925

 Score = 83.6 bits (205), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 66/285 (23%), Positives = 129/285 (45%), Gaps = 26/285 (9%)

Query: 14  VLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSN----VACLKRVIVPDKPSLNTL 69
           V+  G +  K    L  G ++ V  A        I+SN    V  L +  +  +  +  +
Sbjct: 147 VIKKGINDFKFGETLGDGSYSTVLLA------TSIESNKKYAVKILNKEYLIKQKKVKYV 200

Query: 70  RAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRL 129
             E + ++ L+N K ++S   +   +SS       ++ L+EY   G L+  M  R    +
Sbjct: 201 NIEKNTLQRLKNTKGIISLYFTFQDESS-------LYFLLEYAPNGDLLSLM--RKHGSV 251

Query: 130 QEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQ 189
            E       +Q+   +  MH     +IHRD+K EN+L+    + K+ DFG+   +    +
Sbjct: 252 NEKCTQYYAAQIIDALGFMH--DKGVIHRDLKPENILLDVDMKVKLTDFGTARLLDSTSE 309

Query: 190 NPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKG 249
           +  ++  +        TA+Y SPE+++    + +D + DIWA G  L+++     PF+  
Sbjct: 310 DDLKYDLLTRSNSFVGTAEYVSPELLN---DNYVDFRCDIWAFGCILFQMIAGKPPFKAN 366

Query: 250 GELAILHS--RFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQV 292
            E        + QF     +   ++ L++ +L++NP++R  + Q+
Sbjct: 367 NEYLTFQKVMKVQFAFTAGFPMTVRDLVKNILIKNPERRLLINQI 411

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score = 83.6 bits (205), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 81/297 (27%), Positives = 131/297 (44%), Gaps = 44/297 (14%)

Query: 9   YNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSL-- 66
           +  G+ L VGS    V++Y  + G  Q  + +I     F     A    +I  + P +  
Sbjct: 17  WKLGSTLGVGSTGKVVMAYNETKG--QQAAVKIISKSIF----NAQGSTMIGGNDPDVLP 70

Query: 67  NTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQ 126
             +  E+  MKLL N+ +V+   D           S ++++++EY   G L + +  R  
Sbjct: 71  YGIEREIIIMKLL-NHPNVLRLYDVWET-------SKDLYMVLEYVEKGELFNLLVER-- 120

Query: 127 NRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIR 186
             L E E +    Q+  GI+  HAL   ++HRD+K EN+L+ H    K+ DFG       
Sbjct: 121 GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNVKLADFGMA----- 173

Query: 187 PPQNPQEFAYVQHDVLKNTTA---QYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYT 243
                   A    D L  T+     Y +PE++     H  +  SD+W+ GV LY L    
Sbjct: 174 --------ALESKDKLLETSCGSPHYAAPEIVSGLPYHGFE--SDVWSCGVILYALLTGR 223

Query: 244 TPF-EKGGE-----LAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLE 294
            PF E+ G      L +   +F+ P     S   + LI R+L  +P+QR    ++L+
Sbjct: 224 LPFDEEDGNIRNLLLKVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTREILK 280

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score = 83.6 bits (205), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 96/199 (48%), Gaps = 31/199 (15%)

Query: 104 EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
           E+FL++EY  GG L D++ +R   RL E E ++   Q+ +G A  H     + HRD+K E
Sbjct: 131 ELFLVLEYVDGGELFDYLVSR--GRLPEKEAIHYFRQIIEGTAYCHGFN--ICHRDLKPE 186

Query: 164 NVLISHTGQ-YKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTA--QYRSPEMI--DLY 218
           N+L+    +  K+ DFG                   + +L+ +     Y SPE++    Y
Sbjct: 187 NLLLDKKNKRIKIADFGMAA------------LQTSNKLLETSCGSPHYASPEIVMGKNY 234

Query: 219 RGHPIDEKSDIWALGVFLYKLCYYTTPFE----KGGELAILHSRFQFPAQPIYSDRLKGL 274
            G P    SD+W+ G+ L+ L     PF     K   L +   ++Q P     S   + L
Sbjct: 235 NGGP----SDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQS--VSSGAQDL 288

Query: 275 IRRMLMENPDQRPNVCQVL 293
           I R+L+ +PD+R ++ ++L
Sbjct: 289 ISRILVVDPDKRISINEIL 307

>KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {ON}
           similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007C STE20 Signal transducing kinase of the PAK (p21-
           activated kinase) family involved in pheromone response
           and pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 954

 Score = 83.2 bits (204), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 72/294 (24%), Positives = 135/294 (45%), Gaps = 48/294 (16%)

Query: 21  HAKVISYLTSGGFAQVYSAEIQPADAF---------IDSNVA-CLKRVIVPDKPSLNTLR 70
           +AK+    T G  +++Y + I+              + +N +  +K++ +  +P    + 
Sbjct: 650 YAKLTEICTDGDPSKLYKSLIKIGQGASGGVYTAYEVGTNASVAIKQMNLEKQPKKELII 709

Query: 71  AEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQ 130
            E+  MK  ++  ++V++IDS+  +        +++++MEY  GG L D +   +   L 
Sbjct: 710 NEILVMKASKH-ANIVNFIDSYLLRG-------DLWVVMEYMEGGSLTDVVTHCI---LT 758

Query: 131 EFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQN 190
           E +I  +  +  +G+  +H+    +IHRDIK +N+L+S TG+ K+ DFG  C        
Sbjct: 759 EGQIGAVSRETLKGLQFLHS--KGVIHRDIKSDNILLSMTGEIKLTDFG-FC-------- 807

Query: 191 PQEFAYVQHDVLKNTTA----QYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPF 246
               A +    LK TT      + +PE++      P   K DIW+LG+ + ++     P+
Sbjct: 808 ----AQINEINLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 860

Query: 247 EKGGELAILH-----SRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLED 295
                L  L+        +       SD LKG +   L  +PD+R    ++L D
Sbjct: 861 LNETPLRALYLIATNGTPELKDADSLSDDLKGFLGWCLHVDPDERATASELLSD 914

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score = 83.2 bits (204), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 57/207 (27%), Positives = 93/207 (44%), Gaps = 47/207 (22%)

Query: 104 EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
           +V++ +EYC G  L + +   + +R+   E   + +Q+   +   H+L    +HRD+K+E
Sbjct: 102 KVWMALEYCPGRELYEHL--LMLHRIPLDECAKLFAQIVSAVHYAHSLN--CVHRDLKLE 157

Query: 164 NVLISHTGQYKVCDFG------------SVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRS 211
           N+L+   G  K+ DFG            ++CG                      T  Y +
Sbjct: 158 NILLDKNGNAKLTDFGFTRECVSKSSLETICG----------------------TTVYMA 195

Query: 212 PEMI--DLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAI---LHSRFQFPAQPI 266
           PE+I    Y G  I    DIW+LGV LY +   T PF++  E      + + F       
Sbjct: 196 PELIQRQAYDGFKI----DIWSLGVILYTMINGTMPFDEDDETKTKWKIVNDFPNFNDNF 251

Query: 267 YSDRLKGLIRRMLMENPDQRPNVCQVL 293
            S   K LI+R+L + P +RP + Q+L
Sbjct: 252 VSHEAKDLIKRLLAKCPSERPTMEQIL 278

>NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {ON}
            Anc_7.86
          Length = 1382

 Score = 83.6 bits (205), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 104/235 (44%), Gaps = 31/235 (13%)

Query: 66   LNTLRAEVDAMKLLRNNKH--VVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMN- 122
            L T+ +E+  M  L    H  ++S +D       F +  Y  ++        G ID  + 
Sbjct: 1169 LGTIPSEIQIMATLNKKPHDNILSLLDF------FEDDDY-YYIETPVHGETGCIDLFDL 1221

Query: 123  TRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVC 182
               +  + EFE   I  Q+  GI  +H     ++HRDIK ENV++   G  K+ DFGS  
Sbjct: 1222 IEFKTNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGCVKIIDFGSAA 1279

Query: 183  GVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMI--DLYRGHPIDEKSDIWALGVFLYKLC 240
             V   P           DV   T   Y +PE++  + Y G P     DIWA+G+ LY + 
Sbjct: 1280 YVKSGP----------FDVFVGTI-DYAAPEVLSGEPYEGKP----QDIWAIGILLYTIV 1324

Query: 241  YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLED 295
            +   PF    E  IL    +F      S+    LI+++L+ +  +RP + ++  D
Sbjct: 1325 FKENPFYNIDE--ILEGELKFNNSNDISEDCIELIKKILIRSVPKRPLIEEIFND 1377

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 57/180 (31%), Positives = 86/180 (47%), Gaps = 22/180 (12%)

Query: 116  GLIDFMN-TRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYK 174
            G ID  +   ++  + E E + I  Q+  GI  +H     ++HRDIK ENV++   G  K
Sbjct: 1045 GSIDLFDLIEMKTDMTEHEAMLIFKQIASGIKNLH--DNGIVHRDIKDENVIVDCNGFVK 1102

Query: 175  VCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMI--DLYRGHPIDEKSDIWAL 232
            + DFGS   V   P           DV   T   Y +PE++  + Y G P     DIWA+
Sbjct: 1103 IVDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYEGKP----QDIWAI 1147

Query: 233  GVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQV 292
            GV LY + Y   PF    E  IL +  +  +    SD    LIR++L  +  +RP++ ++
Sbjct: 1148 GVLLYTIIYKENPFYNIDE--ILDADLRVNSSERISDDCIALIRKILNRSVSKRPSIDEI 1205

>TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1300

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 58/183 (31%), Positives = 87/183 (47%), Gaps = 20/183 (10%)

Query: 115  GGLIDFMN-TRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQY 173
             G ID  +    +  + E E   I  QV  G+  +H+L   ++HRDIK ENV+I   G  
Sbjct: 1130 SGCIDLFDLIEFRTDMTEDEAKLIFKQVASGLQHLHSLG--IVHRDIKDENVIIDSKGYV 1187

Query: 174  KVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEK-SDIWAL 232
            K+ DFGS   V   P           DV   T   Y +PE++    G+P + K  DIWAL
Sbjct: 1188 KIIDFGSAAYVKNGP----------FDVFVGTI-DYAAPEVL---AGNPYEGKPQDIWAL 1233

Query: 233  GVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQV 292
            G+ LY + +   PF    E  I+     F  +   +     LI++ML++   +RP++ +V
Sbjct: 1234 GILLYTIIFKENPFYNIDE--IIEGNVNFDNEASVNPVCVQLIKKMLIKTVPKRPDINEV 1291

Query: 293  LED 295
              D
Sbjct: 1292 FSD 1294

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 59/199 (29%), Positives = 97/199 (48%), Gaps = 31/199 (15%)

Query: 104 EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
           E+FL++EY  GG L D++ +R   RL E E ++   Q+ +G A  H+    + HRD+K E
Sbjct: 131 ELFLVLEYVDGGELFDYLVSR--GRLSEKEAIHYFRQIIEGTAYCHSFN--ICHRDLKPE 186

Query: 164 NVLISHTGQ-YKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTA--QYRSPEMI--DLY 218
           N+L+    +  K+ DFG                   + +L+ +     Y SPE++    Y
Sbjct: 187 NLLLDKKNKRIKIADFGMAA------------LQTSNKLLETSCGSPHYASPEIVMGKTY 234

Query: 219 RGHPIDEKSDIWALGVFLYKLCYYTTPFE----KGGELAILHSRFQFPAQPIYSDRLKGL 274
            G P    SD+W+ G+ L+ L     PF     K   L +   ++Q P Q I S   + L
Sbjct: 235 NGGP----SDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMP-QAI-SLEAQDL 288

Query: 275 IRRMLMENPDQRPNVCQVL 293
           I R+L+ +P++R  +  +L
Sbjct: 289 ISRILVVDPNKRITINDIL 307

>TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1367

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 87/183 (47%), Gaps = 22/183 (12%)

Query: 116  GLIDFMN-TRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYK 174
            G ID  +    ++ + E E   I  QV  GI  +H     ++HRD+K ENV++   G  K
Sbjct: 1199 GCIDLFDLIEFKSNMTESEARLIFIQVVLGIKHLH--DSNIVHRDVKDENVIVDAKGFVK 1256

Query: 175  VCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMI--DLYRGHPIDEKSDIWAL 232
            + DFGS   V   P           DV   T   Y +PE++  + Y G P     DIWA+
Sbjct: 1257 LIDFGSAAYVNSGP----------FDVFVGTI-DYAAPEVLSGEPYLGKP----QDIWAI 1301

Query: 233  GVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQV 292
            G+ LY + +   PF    E  IL +  +       S     LI+R+L +NP++RP + ++
Sbjct: 1302 GILLYTIMFKENPFYNIDE--ILEAELKINNTSDASQDCIDLIKRILTKNPNKRPTIDEI 1359

Query: 293  LED 295
            + D
Sbjct: 1360 VND 1362

>CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096w KIN2 ser/thr protein kinase
          Length = 1192

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 57/214 (26%), Positives = 103/214 (48%), Gaps = 26/214 (12%)

Query: 102 SYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIK 161
           S   ++L EY AGG L+D++       L+E         V   +  +HA    ++HRD+K
Sbjct: 204 SNHFYMLFEYVAGGQLLDYIIQ--HGSLREHHARKFARGVASALQYLHANN--IVHRDLK 259

Query: 162 IENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGH 221
           IEN++IS++G+ K+ DFG +  V    +    F           +  + +PE++   + H
Sbjct: 260 IENIMISNSGEIKIIDFG-LSNVYDTRKQLHTFC---------GSLYFAAPELL---KAH 306

Query: 222 P-IDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRF-----QFPAQPIYSDRLKGLI 275
           P    + D+W+ GV LY L     PF+     ++LH +      ++P     S  +  L+
Sbjct: 307 PYTGPEVDVWSFGVVLYVLVCGKVPFDDENS-SVLHEKIKRGKVEYPQH--LSIEVMSLL 363

Query: 276 RRMLMENPDQRPNVCQVLEDVSRMQGIQCPVRNF 309
            +ML+ +P +R ++ QV+E     +G   P  ++
Sbjct: 364 SKMLVVDPSRRASLKQVVEHPWMTKGYDTPAPSY 397

>YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}
           SPS1Putative protein serine/threonine kinase expressed
           at the end of meiosis and localized to the prospore
           membrane, required for correct localization of enzymes
           involved in spore wall synthesis
          Length = 490

 Score = 81.6 bits (200), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 95/200 (47%), Gaps = 32/200 (16%)

Query: 105 VFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           ++++MEYC GG   D +     N L E ++  I+ +VT G+  +H  +   IHRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 165 VLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEM----IDLYRG 220
           +L++  G  K+ DFG V G IR       F           T  + +PE+    +D Y  
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIRSTLKRDTFV---------GTPYWMAPEVVCCEVDGY-- 194

Query: 221 HPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHS-------RFQFPAQPIYSDRLKG 273
              +EK+DIW+LG+  Y+L     P  K   + ++ +       + Q P    +SD  K 
Sbjct: 195 ---NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP----FSDAAKD 247

Query: 274 LIRRMLMENPDQRPNVCQVL 293
            +   L++ P  RP+   +L
Sbjct: 248 FVAGCLVKTPADRPSAYNLL 267

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 97/199 (48%), Gaps = 31/199 (15%)

Query: 104 EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
           E++L++EY  GG L D++ ++   +L E E ++   Q+  GI+  H+    + HRD+K E
Sbjct: 209 ELYLVLEYVDGGELFDYLVSK--GKLTESEAVHYFKQIINGISYCHSFN--ICHRDLKPE 264

Query: 164 NVLISHTGQ-YKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTA--QYRSPEMI--DLY 218
           N+L+    +  K+ DFG                 V + +L+ +     Y SPE++    Y
Sbjct: 265 NLLLDKKRRIIKIADFGMAA------------LQVSNRLLQTSCGSPHYASPEIVMGKCY 312

Query: 219 RGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAIL----HSRFQFPAQPIYSDRLKGL 274
            G P    SDIW+ G+ L+ L     PF       +L    + R+Q P+    S   K L
Sbjct: 313 NGAP----SDIWSCGIILFALLTGHLPFNDDNIKKLLIKVQNGRYQMPS--YISQEAKNL 366

Query: 275 IRRMLMENPDQRPNVCQVL 293
           I R+L+ +P +R +  Q+L
Sbjct: 367 ISRILVVDPSKRISTEQIL 385

>AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YJL095W (BCK1)
          Length = 1423

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/260 (26%), Positives = 119/260 (45%), Gaps = 42/260 (16%)

Query: 52   VACLKRVIVP-----DKPSLNTLRAEVDAMKLLRNNKH--VVSYIDSHAAKSSFPNGSYE 104
            +  +K+V VP     D+ ++N   A +  +  L++  H  +V Y+        F N +  
Sbjct: 1149 MMAVKQVEVPKFGSQDETTVNNAEALISEVSTLKDLDHLNIVQYL-------GFENKNCI 1201

Query: 105  VFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
              L +EY AGG +   +  RL     E  I  + +QV +G+A +H     ++HRD+K +N
Sbjct: 1202 YSLFLEYVAGGSVGSLI--RLYGHFDEQLIRFLTTQVLEGLAYLHLRG--ILHRDMKADN 1257

Query: 165  VLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPID 224
            +L+ + G  K+ DF    G+ R   N     Y   ++    T  + +PEM+D  +G+   
Sbjct: 1258 LLLDNDGVCKISDF----GISRKSNN----IYSNSEMTMRGTVFWMAPEMVDTTQGY--S 1307

Query: 225  EKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQF----PAQPIYSDRL-------KG 273
             K DIW+LG  + ++     P+     L ++ + FQ      A PI  D L       + 
Sbjct: 1308 AKVDIWSLGCVVLEMFAGKRPW---SNLEVVAAMFQIGKSKSAPPIPEDTLPHISQDGRA 1364

Query: 274  LIRRMLMENPDQRPNVCQVL 293
             +    M +P++RP    +L
Sbjct: 1365 FLDDCFMIDPEERPTADTLL 1384

>CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa]
           {ON} similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007c STE20 Serine/threonine-protein kinase
          Length = 915

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 65/261 (24%), Positives = 121/261 (46%), Gaps = 48/261 (18%)

Query: 78  LLRNNKH--VVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEIL 135
           ++R +KH  +V++IDS+ AK        +++++MEY  GG L D +   L   L E +I 
Sbjct: 668 VMRESKHSNIVNFIDSYLAKG-------DLWIVMEYMEGGSLTDVVTHCL---LSEGQIG 717

Query: 136 NIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFA 195
            +  +  +G+  +H+    ++HRDIK +N+L+S  G  K+ DFG  C            A
Sbjct: 718 AVCRETLKGLQFLHSKG--VLHRDIKSDNILLSLKGNIKLTDFG-FC------------A 762

Query: 196 YVQHDVLKNTTA----QYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGE 251
            +  + LK TT      + +PE++      P   K DIW+LG+ + ++     P+     
Sbjct: 763 QINENNLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETP 819

Query: 252 LAILH-------SRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLED-----VSRM 299
           L  L+        + + P     SD L   +   L  +P +R    ++L+D     ++  
Sbjct: 820 LRALYLIATNGTPKLKEPE--ALSDTLTKFLDWCLKVDPSERATATELLDDPFITEIAED 877

Query: 300 QGIQCPVRNFYLLRAMEQQQQ 320
                P+     ++ +E+Q++
Sbjct: 878 NSSLSPLVKLARIKKLEEQEE 898

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 130/276 (47%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           +L  GGFA+ +  + +    F    VA   ++ +  + +   L +E+   K +++ +++V
Sbjct: 147 FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTRRKLLSEIQIHKSMKH-QNIV 202

Query: 87  SYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIA 146
            ++D              V++L+  C  G L++ +  R    L E E+     Q+   I 
Sbjct: 203 QFVDCFE-------DHINVYILLGMCPNGSLMELLKKR--KILTEPEVRFFTVQICGAIK 253

Query: 147 AMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTT 206
            MH+ +  +IHRD+K+ N+        K+ DFG +  V+    N +E  Y         T
Sbjct: 254 YMHSRR--VIHRDLKLGNIFFDENYNLKIGDFG-LAAVL---ANDRERKYTVCG-----T 302

Query: 207 AQYRSPE-MIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSR-----FQ 260
             Y +PE ++  + GH  +   DIW++GV ++ L     PF+   ++  ++SR     + 
Sbjct: 303 PNYIAPEVLLGKHSGHSYE--VDIWSIGVMIFALLIGKPPFQ-AKDVNTIYSRIKNSEYT 359

Query: 261 FPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDV 296
           FP     S   K LI+ +L+ +P  RP++ +++E V
Sbjct: 360 FPINKSISQEAKTLIQDILINDPIARPSINEIMEYV 395

>Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {ON}
            similar to Ashbya gossypii ACR281C
          Length = 1325

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 83/177 (46%), Gaps = 22/177 (12%)

Query: 116  GLIDFMN-TRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYK 174
            G ID  +   L+  + E+E   +  Q+T G+  +H     ++HRDIK ENV++ + G  K
Sbjct: 1157 GSIDLFDLIELKTNMTEYEAKLLFKQITSGVKHLH--DNGIVHRDIKDENVIVDNKGCVK 1214

Query: 175  VCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMI--DLYRGHPIDEKSDIWAL 232
            + DFGS   V R P           DV   T   Y +PE++  D Y G P     DIWA+
Sbjct: 1215 LIDFGSAAYVKRGP----------FDVFVGTI-DYAAPEVLEGDPYEGKP----QDIWAI 1259

Query: 233  GVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNV 289
            GV LY + Y   PF    E  IL    +     I S+    LI  +L  +  +RP V
Sbjct: 1260 GVLLYTIIYKENPFYNVDE--ILDGDLRINPSVIVSEECVALITMVLDRSLSKRPTV 1314

>Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}
            complement(18696..23039) [4344 nt, 1448 aa]
          Length = 1447

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 114/237 (48%), Gaps = 30/237 (12%)

Query: 65   SLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTR 124
            +++ LR EV  +K L ++ ++V Y+   A      NG Y +FL  EY AGG +   +  R
Sbjct: 1186 TVDALRLEVSTLKDL-DHLNIVQYLGFEAK-----NGIYSLFL--EYVAGGSVGSLI--R 1235

Query: 125  LQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGV 184
            +  R  +  I ++  QV QG++ +H+    ++HRD+K +N+L+   G  K+ DF    G+
Sbjct: 1236 MYGRFDDILIRHLTIQVLQGLSYLHSRG--ILHRDMKADNLLLDQDGVCKISDF----GI 1289

Query: 185  IRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTT 244
             R   +     Y   ++    T  + +PEM+D  +G+    K DIW+LG  + ++     
Sbjct: 1290 SRKSND----IYSNSEMTMKGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKR 1343

Query: 245  PFEKGGELAILHSRFQFPAQ--------PIYSDRLKGLIRRMLMENPDQRPNVCQVL 293
            P+     +A +    Q  +         P+ S+  K  +      +P++RP   ++L
Sbjct: 1344 PWSNFEVVAAMFKIGQAKSAPPIPEDTLPLISENAKEFLDCCFEIDPEKRPTADKLL 1400

>CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa] {ON}
            similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095w BCK1
          Length = 1447

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 74/284 (26%), Positives = 129/284 (45%), Gaps = 51/284 (17%)

Query: 31   GGFAQVY-SAEIQPADAFIDSNVACLKRVIVPD--------KPSLNTLRAEVDAMKLLRN 81
            G F  VY S  I   +      +  +K+V VP         K  +  L++EV  +K L +
Sbjct: 1160 GSFGAVYLSLNITTGE------MMAVKQVEVPKYGTQNELVKDMVEALKSEVATLKDL-D 1212

Query: 82   NKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQV 141
            + ++V Y+ S    + +        L +EY AGG +   +  RL  R  E  I ++ +QV
Sbjct: 1213 HLNIVQYLGSEIRGNIYS-------LFLEYVAGGSVGSLI--RLYGRFDEKLIRHLNTQV 1263

Query: 142  TQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDV 201
              G+  +H+    ++HRD+K +N+L+   G  K+ DF    G+ +  +N     Y   D+
Sbjct: 1264 LSGLKYLHS--KGILHRDMKADNLLLDEDGICKISDF----GISKKSKN----IYSNSDM 1313

Query: 202  LKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQF 261
                T  + +PEM+D  +G+    K DIW+LG  + ++     P+     L ++ + FQ 
Sbjct: 1314 TMRGTVFWMAPEMVDTKQGYSA--KVDIWSLGCVVLEMFAGKRPW---SNLEVVAAMFQI 1368

Query: 262  ----PAQPIYSDRL-------KGLIRRMLMENPDQRPNVCQVLE 294
                 A PI  D +       K  + +    +P++RP    +LE
Sbjct: 1369 GKSKSAPPIPDDTIQLISSKGKDFLSKCFEIDPEKRPTADDLLE 1412

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/201 (29%), Positives = 95/201 (47%), Gaps = 33/201 (16%)

Query: 104 EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
           E++L++EY  GG L D++ +R   +L E E ++   Q+ QG++  H     + HRD+K E
Sbjct: 141 ELYLVLEYVEGGELFDYLISR--GKLPEQEAVHYFKQIVQGVSYCHHFN--ICHRDLKPE 196

Query: 164 NVLISHTG-QYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTA---QYRSPEMI--DL 217
           N+L+       K+ DFG               A    D L  T+     Y SPE++    
Sbjct: 197 NLLLDKKNLSVKIADFGMA-------------ALETTDKLLETSCGSPHYASPEIVMGQK 243

Query: 218 YRGHPIDEKSDIWALGVFLYKLCYYTTPFE----KGGELAILHSRFQFPAQPIYSDRLKG 273
           Y G P    SD+W+ G+ L+ L     PF     K   L +   ++Q P     S+  K 
Sbjct: 244 YHGSP----SDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQN--ISNEAKD 297

Query: 274 LIRRMLMENPDQRPNVCQVLE 294
           LI ++L+ +P  R  + +VLE
Sbjct: 298 LIAKILIVDPAMRITIDEVLE 318

>Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON}
            (57057..60950) [3894 nt, 1298 aa]
          Length = 1297

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 83/183 (45%), Gaps = 22/183 (12%)

Query: 116  GLIDFMN-TRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYK 174
            G ID  +    +  + E E   I  QV   I  +H     ++HRDIK ENV++   G  K
Sbjct: 1129 GCIDLFDLIEFKTNMSEVETKLIFMQVVSSIKFLH--DQGIVHRDIKDENVIVDSQGFIK 1186

Query: 175  VCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMI--DLYRGHPIDEKSDIWAL 232
            + DFGS   V   P           DV   T   Y +PE++  + Y G P     DIWA+
Sbjct: 1187 LIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYVGKP----QDIWAI 1231

Query: 233  GVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQV 292
            G+ LY + +   PF    E  IL +  +F       +    LI+R+L  NP +RP + ++
Sbjct: 1232 GILLYTIIFKENPFYNIDE--ILEAELKFNTSTGACEDCVDLIKRILTRNPTKRPTIDEI 1289

Query: 293  LED 295
              D
Sbjct: 1290 YND 1292

>KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.496
           YHL007C
          Length = 798

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 70/281 (24%), Positives = 126/281 (44%), Gaps = 44/281 (15%)

Query: 27  YLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           Y       Q  S  +  A+    + +  +K++ +  +P    +  E+  MK  R+N +VV
Sbjct: 517 YANLTKIGQGASGGVYTANQVKSNELVAIKQMDLEKQPKKELILNEIIVMKESRHN-NVV 575

Query: 87  SYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIA 146
           ++I++H +K +       ++++MEY  GG L D +   L   L E +I  +  +  +G+ 
Sbjct: 576 NFINAHLSKGN-------LWIVMEYMEGGSLTDVVTHCL---LSEGQIGAVCRETLEGLK 625

Query: 147 AMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTT 206
            +H+    +IHRDIK +NVL+S  G  K+ DFG  C  I             +D+  N T
Sbjct: 626 FLHS--KGVIHRDIKSDNVLLSMKGDIKLTDFG-FCAQI-------------NDIDLNRT 669

Query: 207 AQ-----YRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILH----- 256
                  + +PE++      P   K DIW+LG+ + ++     P+     L  L+     
Sbjct: 670 TMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNEAPLKALYLIATN 726

Query: 257 --SRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLED 295
              + + P     SD     + R L   P++R +  ++L D
Sbjct: 727 GTPKLKEPEN--LSDVFSNFLDRCLRVEPEERASAIELLAD 765

>TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {ON}
           Anc_2.496 YHL007C
          Length = 915

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 113/237 (47%), Gaps = 43/237 (18%)

Query: 73  VDAMKLLRNNKH--VVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQ 130
           ++ + +++ +KH  +V++IDS+  K        +++++MEY  GG L D +   +   L 
Sbjct: 666 INEILVMKGSKHQNIVNFIDSYVLKG-------DLWVVMEYMEGGSLTDVVTHCI---LT 715

Query: 131 EFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQN 190
           E +I  +  +  +G+  +H+    +IHRDIK +N+L+S  G+ K+ DFG  C        
Sbjct: 716 EAQIGAVCRETLRGLQFLHS--KGVIHRDIKSDNILLSMNGEIKLTDFG-FC-------- 764

Query: 191 PQEFAYVQHDVLKNTTA----QYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPF 246
               A +    LK TT      + +PE++      P   K DIW+LG+ + ++     P+
Sbjct: 765 ----AQINEINLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 817

Query: 247 EKGGELAILH-------SRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDV 296
                L  L+        + + P   + S  LK  +   L  NPD R +  ++L DV
Sbjct: 818 LNETPLRALYLIATNGTPKLKEPE--VLSPELKSFLAWCLNVNPDTRASATELLRDV 872

>Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to
           Ashbya gossypii AFR724C
          Length = 440

 Score = 80.9 bits (198), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 131/276 (47%), Gaps = 30/276 (10%)

Query: 23  KVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNN 82
           +++  +  G F  VY A     +  +   V  L+     D+P ++ L  E+  +  LR+ 
Sbjct: 21  EILQCIGRGNFGDVYKARYLATNEIVAIKVVNLEDT---DEP-IDLLAQEIFFLSELRS- 75

Query: 83  KHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVT 142
            ++ +Y  +     S       ++++MEYC GG   + +    +++L E +   I+S+V 
Sbjct: 76  PYITNYKTAFLVDVS-------MWIVMEYCGGGSCAELLKYTPEHKLTEDQCAFIVSEVL 128

Query: 143 QGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVL 202
            G+  +H+ +   IHRDIK  N+L++  G  K+ DFG V G +   +    F        
Sbjct: 129 VGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSGQMMVTRKRDTFV------- 178

Query: 203 KNTTAQYRSPEMIDL-YRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHS---R 258
              T  + +PE+ID   +G+  +E +DIW+LG+ + +L     P +K   +  L +   R
Sbjct: 179 --GTPFWMAPEVIDRNKKGY--NEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPKR 234

Query: 259 FQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLE 294
                   +S   K  + + L+++P QRP   ++L+
Sbjct: 235 DPPKLDKRFSSHAKDFVAQCLIKDPSQRPTASELLK 270

>KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} similar
           to uniprot|P53739 Saccharomyces cerevisiae YNR047W
           Putative protein kinase that when overexpressed
           interferes with pheromone-induced growth arrest
           localizes to the cytoplasm potential Cdc28p substrate
           and to YCR091W uniprot|P25341 Saccharomyces cerevisiae
           YCR091W KIN82 Putative serine/threonine protein kinase,
           most similar to cyclic nucleotide-dependent protein
           kinase subfamily and the protein kinase C subfamily
          Length = 774

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 95/208 (45%), Gaps = 26/208 (12%)

Query: 97  SFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLI 156
           SF    Y ++L MEYC GG     + TR    + E +     S+VT  +  +H +    I
Sbjct: 445 SFQTEDY-LYLCMEYCMGGEFFRALQTRKTKCISEDDARFYSSEVTAALEYLHLMG--FI 501

Query: 157 HRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNT----------- 205
           +RD+K EN+L+  +G   + DF  +    +  +NPQ      H ++              
Sbjct: 502 YRDLKPENILLHQSGHIMLSDF-DLSVQAKDTKNPQVKGNASHSLVDTKICSDGFRTNSF 560

Query: 206 --TAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGEL-----AILHSR 258
             T +Y +PE+I   RG+      D W LG+ +Y++ +  TPF KG         IL + 
Sbjct: 561 VGTEEYIAPEVI---RGNGHTAAVDWWTLGILIYEMLFGFTPF-KGDNTNQTFSNILKNE 616

Query: 259 FQFPAQPIYSDRLKGLIRRMLMENPDQR 286
              P     S   K LIR++L++N ++R
Sbjct: 617 VVIPNNNETSRACKDLIRKLLIKNENKR 644

>Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {ON}
           YHL007C (STE20) - serine/threonine protein kinase
           [contig 55] FULL
          Length = 955

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 125/274 (45%), Gaps = 43/274 (15%)

Query: 31  GGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYID 90
           G    VY+A     +A +      +K++ +  +P    +  E+  MK  ++  ++V++ID
Sbjct: 676 GASGGVYTAYEVGTNASV-----AIKQMNLEKQPKKELIINEILVMKASKH-ANIVNFID 729

Query: 91  SHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHA 150
           S+  +        +++++MEY  GG L D +   +   L E +I  +  +  +G+  +H+
Sbjct: 730 SYLLRG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVSRETLKGLQFLHS 779

Query: 151 LQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTA--- 207
               +IHRDIK +NVL+S +G+ K+ DFG  C            A +    LK TT    
Sbjct: 780 --KGVIHRDIKSDNVLLSMSGEIKLTDFG-FC------------AQINEINLKRTTMVGT 824

Query: 208 -QYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILH-----SRFQF 261
             + +PE++      P   K DIW+LG+ + ++     P+     L  L+        + 
Sbjct: 825 PYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPEL 881

Query: 262 PAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLED 295
                 SD LK  +   L  NPD+R    Q+L D
Sbjct: 882 KDADSLSDDLKSFLGWCLHVNPDERATASQLLSD 915

>KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar to
           uniprot|P08458 Saccharomyces cerevisiae YDR523C SPS1
           dispensable for mitosis involved in middle/late stage of
           meiosis required for spore wall formation
           serine/threonine kinase homologous to Ste20p expressed
           in middle/late meiosis
          Length = 512

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 97/195 (49%), Gaps = 22/195 (11%)

Query: 105 VFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           ++++ME+C GG   D +    ++RL E ++  I+ +V  G+  +H+ +   IHRDIK  N
Sbjct: 110 MWIVMEFCGGGSCADLLKHLPEHRLSENKVAYIIREVLFGLDYLHSQKK--IHRDIKAAN 167

Query: 165 VLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPID 224
           +L++  G+ K+ DFG V G I        F           T  + +PE+I   + +  +
Sbjct: 168 ILLTDDGEVKLGDFG-VSGQIMATLKRTTFV---------GTPYWMAPEII-AKKDNGYN 216

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQ--PIYSDRLKG----LIRRM 278
           EK+DIW+LG+   +L     P+ K   + +L      P +  P    R  G     I   
Sbjct: 217 EKADIWSLGITAIELLTGQPPYAKHDPMKVL---VNIPLRKPPKLQGRFTGSARDFIALC 273

Query: 279 LMENPDQRPNVCQVL 293
           L+++PD RP+  ++L
Sbjct: 274 LIKDPDLRPSAAELL 288

>KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 993

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 99/196 (50%), Gaps = 22/196 (11%)

Query: 105 VFLLMEYCAGGGLIDFMNTRLQNRLQEFEILN------IMSQVTQGIAAMHALQPPLIHR 158
           ++ L+EY   G   DF++      ++++  LN        +Q+   I  +H  Q  +IHR
Sbjct: 237 LYFLLEYAPNG---DFLSV-----IKKYGSLNQDCSVYYSAQILDAIDYLH--QKGVIHR 286

Query: 159 DIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLY 218
           DIK EN+L+    + K+ DFG+   ++   +  Q +  ++       TA+Y SPE+++  
Sbjct: 287 DIKPENILLDKDMKVKLTDFGT-AKLVEKDETTQTYNLLERSKSFVGTAEYVSPELLN-- 343

Query: 219 RGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHS--RFQFPAQPIYSDRLKGLIR 276
             + +D K DIWA G  L+++     PF+   E        + Q+     +   ++ LI+
Sbjct: 344 -DNYVDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLIIRDLIK 402

Query: 277 RMLMENPDQRPNVCQV 292
           ++L++NP+QR +  QV
Sbjct: 403 QILVKNPEQRLDTLQV 418

>KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} similar to
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1433

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/236 (26%), Positives = 110/236 (46%), Gaps = 30/236 (12%)

Query: 66   LNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRL 125
            L  L++EV  +K L ++ ++V Y+        F N ++   L +EY AGG +   +  RL
Sbjct: 1193 LEALKSEVSTLKDL-DHVNIVQYL-------GFENKNHVYSLFLEYVAGGSVGSLI--RL 1242

Query: 126  QNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVI 185
              R  E  I  +  QV +G+A +H+    ++HRD+K +N+L+   G  K+ DF    G+ 
Sbjct: 1243 FGRFDEDLIRFLAVQVLRGLAYLHSKG--ILHRDMKADNLLLDVDGICKISDF----GIS 1296

Query: 186  RPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTP 245
            +   N     Y   D+    T  + +PEM+D  +G+    K DIW+LG  + ++     P
Sbjct: 1297 KKSNN----IYSNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRP 1350

Query: 246  FEKGGELAILHSRFQFPAQP--------IYSDRLKGLIRRMLMENPDQRPNVCQVL 293
            +     +A +    +F + P        + S   K  +      +P++RP    +L
Sbjct: 1351 WSNFEVVAAMFKIGKFKSAPPIPEDTQKLLSAEAKSFLDACFEIDPEKRPTADDLL 1406

>ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa]
           {ON} similar to uniprot|Q12236 YOL100W Saccharomyces
           cerevisiae YOL100W PKH2 Serine/threonine protein kinase
           involved in sphingolipid-mediated signaling pathway that
           controls endocytosis
          Length = 1111

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 68/283 (24%), Positives = 128/283 (45%), Gaps = 21/283 (7%)

Query: 14  VLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEV 73
           V+  G    K    L  G ++ V  A  +  D+     V  L +  +  +  +  +  E 
Sbjct: 162 VIKKGIKDFKFGDTLGDGSYSTVMVATAR--DSGKKYAVKVLSKEYLIRQKKVKYVNIEK 219

Query: 74  DAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFE 133
           +A++ L N++ ++    +   ++S       ++ L+EY   G  +  M  +    L E  
Sbjct: 220 NALQRLNNSRGIIRLYFTFQDEAS-------LYFLLEYAPNGDFLSIM--KKYGSLNEEC 270

Query: 134 ILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQE 193
                +Q+   I  +H  Q  +IHRDIK EN+L+    + K+ DFG+   +    Q   E
Sbjct: 271 TCYYSAQIIDAIKFLH--QRGIIHRDIKPENILLDKEMKVKLTDFGTAKLLDGKSQASGE 328

Query: 194 FAYVQHDVLKN--TTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGE 251
             Y  H   K+   TA+Y SPE+++    + +D + DIWA G  ++++     PF+   E
Sbjct: 329 -TYDLHTRSKSFVGTAEYVSPELLN---DNWVDYRCDIWAFGCIVFQMIAGKPPFKATNE 384

Query: 252 LAILHS--RFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQV 292
                   + Q+     +   ++ L++R+L+  PDQR ++ Q+
Sbjct: 385 YLTFQKVMKVQYAFTAGFPVVVRDLVKRILLRQPDQRLSIPQI 427

>SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] {ON}
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1274

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 85/183 (46%), Gaps = 22/183 (12%)

Query: 116  GLIDFMN-TRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYK 174
            G ID  +   L+  + E E   I  QV  GI  +H     ++HRDIK EN+++ + G  K
Sbjct: 1106 GSIDLFDLIELKTNMTEHEAKLIFKQVASGIKHLH--DNGIVHRDIKDENIIVDNKGFVK 1163

Query: 175  VCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMI--DLYRGHPIDEKSDIWAL 232
            + DFGS   V   P           DV   T   Y +PE++  D Y G P     DIWA+
Sbjct: 1164 LIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGDPYEGKP----QDIWAI 1208

Query: 233  GVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQV 292
            GV LY + +   PF    E  IL    +  +    S+    LIRR+L  +  +RP + ++
Sbjct: 1209 GVLLYTIIFKENPFYNIDE--ILDGDLRISSSVTVSEECIALIRRILNRSVPKRPTIEEI 1266

Query: 293  LED 295
              D
Sbjct: 1267 YND 1269

>Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {ON}
           YDR466W - Hypothetical ORF [contig 196] FULL
          Length = 621

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 70/273 (25%), Positives = 127/273 (46%), Gaps = 26/273 (9%)

Query: 28  LTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKH--- 84
           L  G ++ VY A  +       +   C K+ I+ +K  +  +  E D + +L    H   
Sbjct: 16  LGQGSYSTVYRAVERSNSGRNYAIKVCSKKHIIREK-KVKYVTIEKDLLNMLAKGGHLGI 74

Query: 85  VVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQG 144
           V  +   H  ++        ++ ++EY +GG L+  +  RL  RL E    +I +Q+   
Sbjct: 75  VKLFCTFHDIEN--------LYFVLEYVSGGELLALIQ-RL-GRLTEDLSRHITAQLVDT 124

Query: 145 IAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKN 204
           +  MH+    +IHRD+K ENVL+S  G+  + DFG+ C         ++F   +      
Sbjct: 125 VDYMHS--KGVIHRDLKPENVLLSQEGRVVITDFGAACTAA-----DRKFENTKRTASFV 177

Query: 205 TTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQ 264
            TA+Y SPE++           SDIWALG  +Y+L     PF    EL           +
Sbjct: 178 GTAEYVSPELL---LHSQCGFSSDIWALGCIIYQLNQGKPPFRGENELQTFEKIVALDYK 234

Query: 265 PIYSD--RLKGLIRRMLMENPDQRPNVCQVLED 295
            ++S+  ++  +++ +L+ +P +RP+  Q+ ++
Sbjct: 235 WLFSNSPQVVSIVQSILVTDPLKRPSAAQLKQN 267

>YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One of
            two (see also PSK1) PAS domain containing S/T protein
            kinases; regulates sugar flux and translation in response
            to an unknown metabolite by phosphorylating Ugp1p and
            Gsy2p (sugar flux) and Caf20p, Tif11p and Sro9p
            (translation)
          Length = 1101

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 58/183 (31%), Positives = 83/183 (45%), Gaps = 22/183 (12%)

Query: 116  GLIDFMNT-RLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYK 174
            G ID  +    +  + E E   +  QV   I  +H     ++HRDIK ENV++   G  K
Sbjct: 933  GSIDLFDVIEFKKDMVEHEAKLVFKQVVASIKHLH--DQGIVHRDIKDENVIVDSHGFVK 990

Query: 175  VCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMI--DLYRGHPIDEKSDIWAL 232
            + DFGS   +   P           DV    T  Y +PE++    Y+G P     DIWAL
Sbjct: 991  LIDFGSAAYIKSGP----------FDVFVG-TMDYAAPEVLGGSSYKGKP----QDIWAL 1035

Query: 233  GVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQV 292
            GV LY + Y   P+    E  IL    +F      S+    LI+R+L    D+RP + ++
Sbjct: 1036 GVLLYTIIYKENPYYNIDE--ILEGELRFDKSEHVSEECISLIKRILTREVDKRPTIDEI 1093

Query: 293  LED 295
             ED
Sbjct: 1094 YED 1096

>Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 80.9 bits (198), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 94/196 (47%), Gaps = 24/196 (12%)

Query: 105 VFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           ++++MEYC GG   D +     N L E ++  I+ QVT G+  +H  +   IHRDIK  N
Sbjct: 84  MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 141

Query: 165 VLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEM----IDLYRG 220
           +L++  G  K+ DFG V G +R       F           T  + +PE+    +D Y  
Sbjct: 142 ILLNEEGMVKLGDFG-VSGHLRSTMKRDTFV---------GTPYWMAPEVVCCEVDGY-- 189

Query: 221 HPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHS---RFQFPAQPIYSDRLKGLIRR 277
              +EK+DIW+LG+  Y+L     P  K   + ++ +   R     Q  +SD  K  +  
Sbjct: 190 ---NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGSFSDAAKEFVAG 246

Query: 278 MLMENPDQRPNVCQVL 293
            L++ P  RP+   +L
Sbjct: 247 CLVKVPADRPSAYDLL 262

>KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1381

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 88/197 (44%), Gaps = 35/197 (17%)

Query: 101  GSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDI 160
            GS ++F L+E+ +               + EFEI  +  QV  G+  +H     ++HRDI
Sbjct: 1213 GSIDLFDLIEFTSN--------------MTEFEIKLLFKQVVSGVKHLH--DQGIVHRDI 1256

Query: 161  KIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMI--DLY 218
            K EN+++ + G  K+ DFGS   V   P           DV   T   Y +PE++  + Y
Sbjct: 1257 KDENIIVDNKGFIKIIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGNPY 1305

Query: 219  RGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRM 278
             G P     DIWALG+ LY + +   PF    E  IL    +F      S     LI+ +
Sbjct: 1306 EGKP----QDIWALGILLYTIVFKENPFYNIDE--ILEGDLKFNDPENISQDCIELIKLI 1359

Query: 279  LMENPDQRPNVCQVLED 295
            L  N  +RP +  +  D
Sbjct: 1360 LNRNVFKRPTIDDIYND 1376

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 77/296 (26%), Positives = 131/296 (44%), Gaps = 40/296 (13%)

Query: 9   YNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNV-ACLKRVIVPDKPSLN 67
           +  G  L +GS     ++Y +S G  Q  + ++     F + N  A    ++ PD     
Sbjct: 20  WKLGETLGLGSTGKVQLAYNSSTG--QQAAIKVISKAVFNNDNANASDSALLTPDSLPYG 77

Query: 68  TLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQN 127
             R E+  MKLL N+ +V+   D     S+       +++++EY   G L + +  R   
Sbjct: 78  IER-EIIIMKLL-NHPNVLRLYDVWETDSN-------LYMVLEYAEKGELFNLLVER--G 126

Query: 128 RLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRP 187
            L E E +    Q+  GI+  HAL   ++HRD+K EN+L+ H    K+ DFG        
Sbjct: 127 PLPENEAIRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKYNIKIADFGMA------ 178

Query: 188 PQNPQEFAYVQHDVLKNTTA---QYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTT 244
                  A    D L  T+     Y +PE+I     H ++  +D+W+ G+ L+ L     
Sbjct: 179 -------ALETEDKLLETSCGSPHYAAPEIISGLPYHGLE--TDVWSCGIILFALLTGRL 229

Query: 245 PF-EKGGE-----LAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLE 294
           PF E+ G      L +   +F+ P     S   + LI ++L  +P +R    ++L+
Sbjct: 230 PFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILK 285

>CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31
          Length = 1336

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 88/197 (44%), Gaps = 35/197 (17%)

Query: 101  GSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDI 160
            GS ++F L+E+              +  + E E   +  QV  G+  +H     ++HRDI
Sbjct: 1168 GSIDLFDLIEF--------------KTNMTEIEAKLLFKQVVSGVKHLH--DQGIVHRDI 1211

Query: 161  KIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDL--Y 218
            K EN+++   G  K+ DFGS   V   P           DV   T   Y +PE++    Y
Sbjct: 1212 KDENIIVDSQGFVKIIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGSPY 1260

Query: 219  RGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRM 278
             G P     DIWA+G+ LY + +   PF    E  IL    +F +  + S++   LI ++
Sbjct: 1261 EGKP----QDIWAIGILLYTIVFKENPFYNIDE--ILEGELKFNSSELVSEQCTTLIAKI 1314

Query: 279  LMENPDQRPNVCQVLED 295
            L  N  +RP +  +  D
Sbjct: 1315 LNRNVQKRPTIDDIYND 1331

>KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1432

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 96/198 (48%), Gaps = 27/198 (13%)

Query: 104 EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
           ++FL++EY  GG L D++ ++   +L E+E ++   Q+ +G+A  H+    + HRD+K E
Sbjct: 189 DLFLVLEYVDGGELFDYLVSK--GKLPEWEAVHYFKQIIEGVAFCHSYN--ICHRDLKPE 244

Query: 164 NVLISHTGQ-YKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMI--DLYRG 220
           N+L+    +  K+ DFG     +  P    E +          +  Y SPE++    Y G
Sbjct: 245 NLLLDKKNKIIKIADFG--MAALELPNKLLETSC--------GSPHYASPEIVMGKPYHG 294

Query: 221 HPIDEKSDIWALGVFLYKLCYYTTPFEKGG----ELAILHSRFQFPAQPIYSDRLKGLIR 276
            P    SD+W+ G+ L+ L     PF         L +   RF+ P     S   + LI 
Sbjct: 295 GP----SDVWSCGIILFALLTGHLPFNDDNIRKLLLKVQSGRFRLPRN--ISLEAQDLIA 348

Query: 277 RMLMENPDQRPNVCQVLE 294
           ++L+ NP QR  +  +L+
Sbjct: 349 KILVVNPRQRIKISDILK 366

>Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W
           (REAL)
          Length = 716

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 89/195 (45%), Gaps = 18/195 (9%)

Query: 105 VFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           ++L MEYC GG     + TR   R+ E +     S+V   +  +H L    I+RD+K EN
Sbjct: 393 LYLCMEYCMGGEFFRALQTRKSKRITEEDAKFYASEVVAALEYLHLLG--FIYRDLKPEN 450

Query: 165 VLISHTGQYKVCDFG-SVCGVIRPPQNPQEFAYVQHDVLKN--------TTAQYRSPEMI 215
           +L+  +G   + DF  S+          ++  Y+   V  +         T +Y +PE+I
Sbjct: 451 ILLHQSGHVMLSDFDLSIQATGSRDPTMKDSTYLDTKVCSDGFRTNSFVGTEEYLAPEVI 510

Query: 216 DLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGE----LAILHSRFQFPAQPIYSDRL 271
              RG+      D W LG+ +Y++ +  TPF+          IL    +FP     S   
Sbjct: 511 ---RGNGHTAAVDWWTLGILVYEMLFGCTPFKGDNSNETFSKILTEDVKFPHDKEISKHC 567

Query: 272 KGLIRRMLMENPDQR 286
           K LI+R+L +N  +R
Sbjct: 568 KDLIKRLLNKNESKR 582

>Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W
           (REAL)
          Length = 1082

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 68/293 (23%), Positives = 131/293 (44%), Gaps = 33/293 (11%)

Query: 6   IPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPS 65
           I ++  GTV+  G++   +++  TS    + Y+A++             L +  +  +  
Sbjct: 178 IKDFKFGTVIGDGAYSTVILA--TSIDTKKKYAAKV-------------LNKEYLIRQKK 222

Query: 66  LNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRL 125
           +  +  E  A++ L N+  VV    +   +SS       ++ L+EY   G  +  M  + 
Sbjct: 223 VKYVSIEKTALQKLNNSHSVVRLFSTFQDESS-------LYFLLEYAPNGDFLSLM--KK 273

Query: 126 QNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS--VCG 183
              L E       +Q+   I  +H+    +IHRDIK EN+L+    + K+ DFG+  +  
Sbjct: 274 NGSLDENCACYYGAQIIDAIDYLHS--NGIIHRDIKPENILLDEEMRIKLTDFGTAKLLD 331

Query: 184 VIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYT 243
                 + Q++           TA+Y SPE+++       D + DIWA G  L+++    
Sbjct: 332 STVSSTSKQKYDLSTRSKSFVGTAEYVSPELLN---DSFTDYRCDIWAFGCILFQMIAGK 388

Query: 244 TPFEKGGELAILHS--RFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLE 294
            PF+   E        + Q+   P +   ++ L++++L++N DQR  + Q+ E
Sbjct: 389 PPFKATNEYLTFQKVMKVQYAFTPGFPLIIRDLVKKILIKNLDQRLTISQIKE 441

>KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} similar to
            uniprot|P53599 Saccharomyces cerevisiae YNR031C SSK2
            Suppressor of Sensor Kinase (SLN1) A MAP kinase kinase
            kinase activator of Pbs2p
          Length = 1551

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 76/298 (25%), Positives = 139/298 (46%), Gaps = 45/298 (15%)

Query: 26   SYLTSGGFAQVYSA-EIQPADAFIDSNVACLKRVIVPDKPSLN----TLRAEVDAMKLLR 80
            S++ SG F  VYSA  +   D      +  +K + + D  S+     +L+ E+  M++L 
Sbjct: 1263 SFIGSGSFGTVYSAVNLDTGD------ILAVKEIKIQDAKSMKQIFPSLKEEMRVMEIL- 1315

Query: 81   NNKHVVSY--IDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIM 138
            N+ ++V Y  ++ H  K         V + ME+C G  L   +      R+++  +  + 
Sbjct: 1316 NHPNIVQYYGVEVHRDK---------VNIFMEFCEGSSLASLLE---HGRIEDEMVTQVY 1363

Query: 139  S-QVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSV-----CGVIRPPQNPQ 192
            + Q+ +G+A +H  Q  ++HRDIK EN+L+   G  K  DFG+       G  R   +  
Sbjct: 1364 TLQLLEGLACLH--QSGVVHRDIKPENILLDRNGVIKYVDFGAAKLIAKNGSKRISLDAN 1421

Query: 193  EFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEK-GGE 251
              +    D++   T  Y +PE +   +GH      DIW+LG  + ++     P+     E
Sbjct: 1422 NKSTGGKDMIG--TPMYMAPETVT-GQGHGKFGSDDIWSLGCVVLEMVTGRRPWANLDNE 1478

Query: 252  LAILHSRF-----QFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLED--VSRMQGI 302
             AI++        QFP +   S   +  I R L+++ ++R    ++L D  +S+++ I
Sbjct: 1479 WAIMYHVAAGHLPQFPTKSEISSAGRKFISRCLIQDANKRATAMELLLDPWISQIRNI 1536

>Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100W
           (REAL)
          Length = 1080

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 107/227 (47%), Gaps = 24/227 (10%)

Query: 75  AMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEI 134
           A++ L N+  VV    +   +SS       ++ L+EY   G  +  M  +    L E   
Sbjct: 234 ALQKLNNSHSVVRLFSTFQDESS-------LYFLLEYAPNGDFLSLM--KKYGSLDENCA 284

Query: 135 LNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEF 194
               SQ+   I  +H     +IHRDIK EN+L+    + K+ DFG+   ++ P  N    
Sbjct: 285 CYYGSQIIDAIDHLHV--SGIIHRDIKPENILLDGEMRIKLTDFGT-AKLLEPTNNSS-- 339

Query: 195 AYVQHDVLKNT-----TAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKG 249
           +  ++D+   +     TA+Y SPE+++       D + DIWA G  L+++     PF+  
Sbjct: 340 SKSKYDLSTRSKSFVGTAEYVSPELLN---DSFTDYRCDIWAFGCILFQMIAGKPPFKAT 396

Query: 250 GELAILHS--RFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLE 294
            E        + Q+   P +   ++ L++++L++N DQR  + Q+ E
Sbjct: 397 NEYLTFQKVMKVQYAFTPGFPLIIRDLVKKILIKNLDQRLTINQIKE 443

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 96/200 (48%), Gaps = 33/200 (16%)

Query: 104 EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
           E++L++EY  GG L D++ +R   +L E E ++   Q+ QG+A  HA    + HRD+K E
Sbjct: 173 ELYLVLEYVDGGELFDYLVSR--GKLPEREAVHYFKQIIQGVAYCHAFN--ICHRDLKPE 228

Query: 164 NVLISHTGQ-YKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTA---QYRSPEMI--DL 217
           N+L+    +  K+ DFG               A    D L +T+     Y SPE++    
Sbjct: 229 NLLLDKKNKIIKIADFGMA-------------ALEVSDKLLSTSCGSPHYASPEIVMGKS 275

Query: 218 YRGHPIDEKSDIWALGVFLYKLCYYTTPFE----KGGELAILHSRFQFPAQPIYSDRLKG 273
           Y G P    +D+W+ G+ L+ L     PF     K   L +    +  P+    S   K 
Sbjct: 276 YHGSP----TDVWSCGIILFALLTGHLPFNHDNIKKLLLKVQSGVYHMPSD--LSPDAKD 329

Query: 274 LIRRMLMENPDQRPNVCQVL 293
           LI ++L+ +PD+R    ++L
Sbjct: 330 LISKILVVDPDKRLTTTEIL 349

>ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {ON}
           weakly similar to uniprot|Q03497 Saccharomyces
           cerevisiae YHL007C STE20 Signal transducing kinase of
           the PAK (p21-activated kinase) family involved in
           pheromone response and pseudohyphal/invasive growth
           pathways activated by Cdc42p binds Ste4p at a GBB motif
           present in noncatalytic domains of PAK kinases
          Length = 963

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 70/282 (24%), Positives = 130/282 (46%), Gaps = 47/282 (16%)

Query: 25  ISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKH 84
           ++ +  G    VY+A     +A +      +K++ +  +P    +  E+  MK  ++ ++
Sbjct: 658 LTKIGQGASGGVYTAYELGTNASV-----AIKQMNLEKQPKKELIINEIMVMKGSKH-RN 711

Query: 85  VVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQG 144
           +V++IDS+  K        +++++MEY  GG L D +   +   L E +I  +  +   G
Sbjct: 712 IVNFIDSYLLKG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLAG 761

Query: 145 IAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKN 204
           +  +H+    +IHRDIK +N+L+S TG+ K+ DFG  C            A +    LK 
Sbjct: 762 LQFLHSKG--VIHRDIKSDNILLSMTGEIKLTDFG-FC------------AQINEINLKR 806

Query: 205 TTA----QYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILH---- 256
           TT      + +PE++      P   K DIW+LG+ + ++     P+     L  L+    
Sbjct: 807 TTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIAT 863

Query: 257 ---SRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLED 295
               + + P      + L+  +   L   PDQR +  Q+L+D
Sbjct: 864 NGTPKLKEPDN--LGEELQNFLDWCLTVEPDQRASSSQLLKD 903

>TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1.24
           YDR523C
          Length = 516

 Score = 80.5 bits (197), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 92/187 (49%), Gaps = 16/187 (8%)

Query: 105 VFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           ++++MEYC GG   D +    +  L E +   I  +V +G+  +H  +   IHRDIK  N
Sbjct: 86  IWIVMEYCGGGSCADLIKYAYKRGLPENKASFITKEVLKGLRYLHEQKK--IHRDIKAAN 143

Query: 165 VLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPID 224
           +L++  G  K+ DFG V G I+       F           T  + +PE++        +
Sbjct: 144 ILLTDDGMVKLGDFG-VSGQIKATLKKDTFV---------GTPYWMAPEVVKKDESG-YN 192

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPI---YSDRLKGLIRRMLME 281
           EK+DIW+LG+ +Y+L     P  K   + ++ S  +  A  +   YS+  K  I   L++
Sbjct: 193 EKADIWSLGITVYELLKGCPPLAKYDPMKVMISVPKRRAPKLHGHYSEDAKSFISHCLIK 252

Query: 282 NPDQRPN 288
           +P+ RPN
Sbjct: 253 DPNARPN 259

>KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1223

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 86/183 (46%), Gaps = 22/183 (12%)

Query: 116  GLIDFMN-TRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYK 174
            G +D  +   L+  + E E   I  Q+  GI  +H     ++HRDIK ENV++   G  K
Sbjct: 1055 GSVDLFDLIELKTDMTEHEAKLIFKQIVSGIKHLH--DNGIVHRDIKDENVIVDSNGFVK 1112

Query: 175  VCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMI--DLYRGHPIDEKSDIWAL 232
            + DFGS   V   P           DV   T   Y +PE++  + Y G P     DIWA+
Sbjct: 1113 IIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYEGKP----QDIWAI 1157

Query: 233  GVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQV 292
            GV LY + +   PF    E  IL +  +  +    SD    LIR++L     +RP++ ++
Sbjct: 1158 GVLLYTIIFKENPFYNIDE--ILDADLRVDSNHRVSDECIALIRKILNRPISKRPSISKI 1215

Query: 293  LED 295
             +D
Sbjct: 1216 NDD 1218

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 94/199 (47%), Gaps = 31/199 (15%)

Query: 104 EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
           E++L++EY  GG L D++ +R   RL E E ++   Q+ QG++  HA    + HRD+K E
Sbjct: 190 ELYLVLEYVDGGELFDYLVSR--GRLCEREAVHYFKQIIQGVSYCHAFN--ICHRDLKPE 245

Query: 164 NVLIS-HTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTA--QYRSPEMI--DLY 218
           N+L+       K+ DFG                 V + +L+ +     Y SPE++    Y
Sbjct: 246 NLLLDKKNSTIKIADFGMAA------------LEVSNKLLQTSCGSPHYASPEIVMGKQY 293

Query: 219 RGHPIDEKSDIWALGVFLYKLCYYTTPFE----KGGELAILHSRFQFPAQPIYSDRLKGL 274
            G P    SD+W+ G+ L+ L     PF     K   L +   ++Q P     S   + L
Sbjct: 294 HGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKYQMPQN--LSKEAQDL 347

Query: 275 IRRMLMENPDQRPNVCQVL 293
           I ++L  NP +R    ++L
Sbjct: 348 IAKILTVNPAKRLTTEEIL 366

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 58/208 (27%), Positives = 97/208 (46%), Gaps = 49/208 (23%)

Query: 104 EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
           +V++  EYC G  L D +   LQ R+     + + +Q+   +   H+L    +HRD+K+E
Sbjct: 103 KVWMAQEYCPGKDLYDHV-LSLQ-RVPSSACIELFTQIVGAVYYAHSLN--CVHRDLKLE 158

Query: 164 NVLISHTGQYKVCDFG------------SVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRS 211
           N+L+   G  K+ DFG            ++CG                      T  Y +
Sbjct: 159 NILLDKNGNAKLTDFGFTRECMTKTSLETICG----------------------TTVYMA 196

Query: 212 PEMI--DLYRGHPIDEKSDIWALGVFLYKLCYYTTPF----EKGGELAILHSRFQFPAQP 265
           PE+I  + Y G  I    DIW+LGV LY +   + PF    E   E  I++    F    
Sbjct: 197 PELIKRESYDGFKI----DIWSLGVILYTMLNGSMPFDEDDETKTEWKIMNEMPVF-NDT 251

Query: 266 IYSDRLKGLIRRMLMENPDQRPNVCQVL 293
           I S+  K L+ ++L ++P++RP++ ++L
Sbjct: 252 ILSEDAKDLLIKLLSKDPNERPSMQEIL 279

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 98/202 (48%), Gaps = 24/202 (11%)

Query: 101 GSY----EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLI 156
           GSY     ++++MEYCAGG L   +      ++ E  I  IM ++   +  +H  +  +I
Sbjct: 80  GSYLRGTSLWIIMEYCAGGSLRSLLR---PGKIDEKYIGVIMRELLVALKVIH--KDNVI 134

Query: 157 HRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMID 216
           HRDIK  NVLI++ GQ K+CDFG    + +     Q  A          T  + +PE+I 
Sbjct: 135 HRDIKAANVLITNEGQVKLCDFGVAAQLNQTSLRRQTMA---------GTPYWMAPEVI- 184

Query: 217 LYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGEL----AILHSRFQFPAQPIYSDRLK 272
              G   D K DIW+LG+  Y++     P+     L     I+ S+     +  Y+ +LK
Sbjct: 185 -MEGVYYDTKVDIWSLGITAYEIATGNPPYCDVEALRAMQLIIKSKPPRLEERNYTPQLK 243

Query: 273 GLIRRMLMENPDQRPNVCQVLE 294
             I   L E+P +R +  ++L+
Sbjct: 244 EFIALCLDEDPQERLSAEELLK 265

>Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C
           (SPS1) - serine/threonine kinase homologous to Ste20p;
           expressed in middle/late meiosis [contig 123] FULL
          Length = 505

 Score = 80.5 bits (197), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 67/266 (25%), Positives = 119/266 (44%), Gaps = 29/266 (10%)

Query: 31  GGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYID 90
           G F  VY A  +     +   +  L+      +  ++ L  E+  +  LR    V +Y  
Sbjct: 45  GSFGDVYRAIDKETGEMVAVKIINLEET----QDDIDVLAQEIYFLSELRA-PFVTTYYK 99

Query: 91  SHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHA 150
           ++    S       ++++ME+C GG   D +    ++RL E ++  I+ +V  G+  +H+
Sbjct: 100 TYVEDVS-------MWIVMEFCGGGSCADLLKHLPEHRLPENKVAYIIREVLYGLEYLHS 152

Query: 151 LQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYR 210
            +   IHRD+K  N+L++  G+ K+ DFG V G I        F           T  + 
Sbjct: 153 QRK--IHRDVKAANILLTDEGEVKLGDFG-VSGQIMATLKRNTFV---------GTPYWM 200

Query: 211 SPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHS---RFQFPAQPIY 267
           +PE+I   R +  DEK+DIW+LG+   +L     P+ K   + +L +   R     Q  +
Sbjct: 201 APEIIA--RDNGYDEKADIWSLGITAMELLTGQPPYAKYDPMKVLMNIPLRKPPRLQGRF 258

Query: 268 SDRLKGLIRRMLMENPDQRPNVCQVL 293
           +   +  I   L ++P  RP    +L
Sbjct: 259 TSSARDFIALCLTKDPALRPTASDLL 284

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 102/200 (51%), Gaps = 31/200 (15%)

Query: 104 EVFLLMEYCAGGGLIDFMNTRLQ-NRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKI 162
           +V++ +EYC G  L D +   LQ  R+   E + + SQ+   +   H+L    +HRD+K+
Sbjct: 111 KVWMALEYCPGRELYDHV---LQMKRIPAEECIQLFSQIVGAVYYAHSLN--CVHRDLKL 165

Query: 163 ENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDL--YRG 220
           EN+L+   G  K+ DFG     +           V  + +  TT  Y +PE+ +   Y G
Sbjct: 166 ENILLDKDGNAKLTDFGFTRECMEK---------VNLETICGTTV-YMAPELTERKPYDG 215

Query: 221 HPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQ-FPAQPIYSDRL-----KGL 274
             I    DIW+LGV LY +   + PF++  E     ++++    +P Y+ +      + L
Sbjct: 216 FKI----DIWSLGVILYTMLSGSMPFDEDDEAK---TKWKIINEEPEYNSKFMTAEGEDL 268

Query: 275 IRRMLMENPDQRPNVCQVLE 294
           +R++L ++ + RP+V ++L+
Sbjct: 269 VRKLLQKDSNLRPSVREILQ 288

>NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141
          Length = 349

 Score = 79.0 bits (193), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 65/194 (33%), Positives = 93/194 (47%), Gaps = 23/194 (11%)

Query: 105 VFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           V+LLMEY   G L   +  R      +      + Q+   +  +H  Q  +IHRD+K EN
Sbjct: 164 VYLLMEYLVYGELYKLL--RSHGPFNDVIASRFVFQIADALNYLHDKQ--IIHRDLKPEN 219

Query: 165 VLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPID 224
           +LI      K+ DFG    +I P         V+   L  T   Y SPEMI   R    D
Sbjct: 220 ILIGFNNVIKLTDFG--WSIINPRG-------VKRKTLCGTI-DYLSPEMI---RSREYD 266

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKG-GELA---ILHSRFQFPAQPIYSDRLKGLIRRMLM 280
           +K D+WALGV  Y+L   + PFE+   EL    IL +  +FP     S  +K LI ++L 
Sbjct: 267 DKVDVWALGVLTYELIVGSPPFEEDTKELTYKRILKNDIKFPET--VSHDVKDLISKLLK 324

Query: 281 ENPDQRPNVCQVLE 294
            NP +R ++  V++
Sbjct: 325 YNPSERISMRDVMK 338

>Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 80.1 bits (196), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 94/196 (47%), Gaps = 24/196 (12%)

Query: 105 VFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           ++++MEYC GG   D +     N L E ++  I+ QVT G+  +H  +   IHRDIK  N
Sbjct: 84  MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 141

Query: 165 VLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEM----IDLYRG 220
           +L++  G  K+ DFG V G IR       F           T  + +PE+    +D Y  
Sbjct: 142 ILLNEEGMVKLGDFG-VSGHIRSTMKRDTFV---------GTPYWMAPEVVCCEVDGY-- 189

Query: 221 HPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHS---RFQFPAQPIYSDRLKGLIRR 277
              +EK+DIW+LG+  Y+L     P  K   + ++ +   R     Q  +S+  K  +  
Sbjct: 190 ---NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGSFSEAAKEFVAG 246

Query: 278 MLMENPDQRPNVCQVL 293
            L++ P  RP+   +L
Sbjct: 247 CLVKAPADRPSAYDLL 262

>Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W
           (REAL)
          Length = 1081

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 109/230 (47%), Gaps = 24/230 (10%)

Query: 72  EVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQE 131
           E  A++ L N+  VV    +   +SS       ++ L+EY   G  +  M  +    + E
Sbjct: 228 EKTALQKLNNSLSVVRLFSTFQDESS-------LYFLLEYAPNGDFLSLM--KKYGSIDE 278

Query: 132 FEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNP 191
                  +Q+   I  +H+    +IHRDIK EN+L+    + K+ DFG+   ++ P  N 
Sbjct: 279 NCACYYAAQIIDAIDYLHS--NGIIHRDIKPENILLDEEMRIKLTDFGT-AKLLSPTSN- 334

Query: 192 QEFAYVQHDVLKNT-----TAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPF 246
              +  ++D+   +     TA+Y SPE+++       D + DIWA G  L+++     PF
Sbjct: 335 -SVSKPKYDLSTRSKSFVGTAEYVSPELLN---DSFTDYRCDIWAFGCILFQMIAGKPPF 390

Query: 247 EKGGELAILHS--RFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLE 294
           +   E        + Q+   P +   ++ L++R+L++N DQR  + Q+ E
Sbjct: 391 KATNEYLTFQKVMKVQYAFTPGFPLVIRDLVKRILVKNLDQRLTINQIKE 440

>Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}
           (4910..5845,5849..7711) [2799 nt, 933 aa]
          Length = 932

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 60/182 (32%), Positives = 90/182 (49%), Gaps = 23/182 (12%)

Query: 117 LIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVC 176
           L DF+  +  +++ E E   I  Q+  GI  +H L   +IHRDIK EN++I   G  +V 
Sbjct: 766 LFDFIEKK--DKIDEVEQKLIFKQIVAGIKHIHGL--GIIHRDIKTENIIIDSEGCVQVI 821

Query: 177 DFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEK-SDIWALGVF 235
           DFGS       P   Q F         + T  Y SPE++   +G P + K  D+WALG+ 
Sbjct: 822 DFGSAAYATNGP--FQVF---------HGTIDYASPEVL---KGEPYEGKPQDVWALGIL 867

Query: 236 LYKLCYYTTPFEKGGELAILHSRFQF-PAQP-IYSDRLKGLIRRMLMENPDQRPNVCQVL 293
           LY + +  TPF    E  I+ +  +  PA     SD+ + LI +ML +    RP + ++ 
Sbjct: 868 LYIITFKQTPFNSVAE--IIENELEIDPAHSENVSDQCRVLIHKMLDKKAWARPKISEIY 925

Query: 294 ED 295
            D
Sbjct: 926 ND 927

>TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8.141
           YGL180W
          Length = 1154

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 78/306 (25%), Positives = 131/306 (42%), Gaps = 57/306 (18%)

Query: 31  GGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYID 90
           G FA VY       D      V  + +  + +K  L  L  E+  +K L N+KH+V+ ID
Sbjct: 141 GSFAVVYRG-YSNEDPNFKLAVKSVPKSKLKNKKILENLEIEISILKKL-NHKHIVNLID 198

Query: 91  SHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTR---------LQNRLQEFE-------- 133
               K+ F        L+MEYC+ G L   +  R         L    Q+F         
Sbjct: 199 CQRNKNDF-------LLIMEYCSLGDLTFLIKKRNELIINHPLLNQIFQKFPSPNPDCNG 251

Query: 134 -----ILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLIS-----HTGQYKVCDFGSVCG 183
                +LN + Q+   +  + +    LIHRDIK +N+L+S     +  Q      G +  
Sbjct: 252 LNIAFVLNYLQQLASALKFLRSRN--LIHRDIKPQNLLLSTPYTDYHDQQTFKKLGYIGI 309

Query: 184 VIRPPQNPQEFAYVQHDVLKNTTAQ--------YRSPEMIDLYRGHPIDEKSDIWALGVF 235
              P     +F + +   L NT+          Y +PE+++ Y+ +  + K+D+W++G  
Sbjct: 310 SCLPILKIADFGFAR--FLPNTSLAETLCGSPLYMAPEILN-YQKY--NAKADLWSVGTV 364

Query: 236 LYKLCYYTTPFEKGGELAIL------HSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNV 289
           LY++ Y   PF+    L +L      +    FP+     D +K LI R+L  +P +R + 
Sbjct: 365 LYEMVYGKPPFKANNHLELLKKIKRTNDNIPFPSYIEIDDDMKFLISRLLKFDPIKRMSF 424

Query: 290 CQVLED 295
            +  E+
Sbjct: 425 QEFFEN 430

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 96/201 (47%), Gaps = 33/201 (16%)

Query: 104 EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
           E++L++EY  GG L D++ ++   +L E E ++   Q+ Q +A  H     + HRD+K E
Sbjct: 148 ELYLVLEYVEGGELFDYLVSK--GKLPESEAIHYFKQIVQAVAYCHGFN--ICHRDLKPE 203

Query: 164 NVLISHTGQ-YKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTA---QYRSPEMI--DL 217
           N+L+    +  K+ DFG               A    D L  T+     Y SPE++    
Sbjct: 204 NLLLDKKKRSIKIADFGMA-------------ALETSDKLLETSCGSPHYASPEIVLGRK 250

Query: 218 YRGHPIDEKSDIWALGVFLYKLCYYTTPFE----KGGELAILHSRFQFPAQPIYSDRLKG 273
           Y G P    SD+W+ G+ L+ L     PF     K   L +   ++Q P     S   K 
Sbjct: 251 YHGSP----SDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQW--LSVEAKD 304

Query: 274 LIRRMLMENPDQRPNVCQVLE 294
           LI R+L+ +P++R  + Q+L+
Sbjct: 305 LISRILVVDPNRRITIDQILQ 325

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 73/290 (25%), Positives = 132/290 (45%), Gaps = 58/290 (20%)

Query: 17  VGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVP--DKPSLNTLRA--- 71
           VG++  K++  +  G F +VY A  +P            ++V++   DK   N +R    
Sbjct: 34  VGNY--KIMKQIGEGSFGKVYLASHKPTH----------RKVVLKTSDKNDPNVVREVFY 81

Query: 72  --EVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRL 129
             + D + + R  + +V+                +V++ +EYC G  L + +      R+
Sbjct: 82  HRQFDYLYITRLYEVIVT--------------ETKVWMALEYCPGKELYEHL--LALKRI 125

Query: 130 QEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQ 189
              E   + +Q+   I   H+L    +HRD+K+EN+L+   G  K+ DFG     +    
Sbjct: 126 SLDECSRLFAQIVGAIYYAHSLN--CVHRDLKLENILLDKKGNAKLTDFGFTRECV---- 179

Query: 190 NPQEFAYVQHDVLKNTTAQYRSPEMIDL--YRGHPIDEKSDIWALGVFLYKLCYYTTPFE 247
                +  Q D +  TT  Y +PE+ +   Y G  I    DIWALGV LY +   + PF+
Sbjct: 180 -----SKSQLDTICGTTV-YMAPELTERKSYDGFKI----DIWALGVILYTMINGSMPFD 229

Query: 248 KGGE----LAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVL 293
           +  E      I++   +     +  D  K LI ++L ++P++RP++ ++L
Sbjct: 230 EDDEAKTKWKIVNEMPEINEDLVSPD-AKDLIEQLLAKDPNERPSIEKIL 278

>Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {ON}
           YDR523C (REAL)
          Length = 490

 Score = 79.7 bits (195), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 95/200 (47%), Gaps = 32/200 (16%)

Query: 105 VFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           ++++MEYC GG   D +     N L E ++  I+ QVT G+  +H  +   IHRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 165 VLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEM----IDLYRG 220
           +L++  G  K+ DFG V G IR       F           T  + +PE+    +D Y  
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIRSTFKRDTFV---------GTPYWMAPEVVCCEVDGY-- 194

Query: 221 HPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHS-------RFQFPAQPIYSDRLKG 273
              +EK+DIW+LG+  Y+L     P  K   + ++ +       + Q P    +S+  K 
Sbjct: 195 ---NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP----FSEAAKE 247

Query: 274 LIRRMLMENPDQRPNVCQVL 293
            +   L++ P  RP+   +L
Sbjct: 248 FVAGCLVKTPADRPSAYDLL 267

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 56/208 (26%), Positives = 106/208 (50%), Gaps = 36/208 (17%)

Query: 100 NGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRD 159
           N  Y + +++EY +GG    ++  +   RL+E     + +Q+  G+  MH+    L+HRD
Sbjct: 119 NSKY-IGIVLEYASGGEFYRYIQKK--RRLKEHAACRLFAQLISGVHYMHSKG--LVHRD 173

Query: 160 IKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQ--YRSPEMIDL 217
           +K+EN+L+       + DFG V           EF + +++++K +     Y +PE++  
Sbjct: 174 LKLENLLLDKNENLLITDFGFV----------NEFNH-KNELMKTSCGSPCYAAPELVVT 222

Query: 218 YRGHPIDEKSDIWALGVFLYKLCYYTTPFE------KGGELAILH-----SRFQFPA--Q 264
            + +    K+DIW+ GV +Y +     P++      +G ++A L+     +  +FP    
Sbjct: 223 TKPYEA-RKADIWSCGVIMYAMLAGYLPWDDDSENPEGDDIAKLYHYITKTPLKFPEYIN 281

Query: 265 PIYSDRLKGLIRRMLMENPDQRPNVCQV 292
           P+  D    L+RR+L+ NP +R N+ QV
Sbjct: 282 PVPRD----LLRRILVSNPKKRLNLRQV 305

>KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2.479
           YKL101W
          Length = 1448

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 57/197 (28%), Positives = 95/197 (48%), Gaps = 27/197 (13%)

Query: 104 EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
           E+FL++EY  GG L D++ +R   +L E E ++   Q+ +G++  H+    + HRD+K E
Sbjct: 193 ELFLVLEYVDGGELFDYLVSR--GKLSEREAVHYFKQIIEGVSYCHSFN--ICHRDLKPE 248

Query: 164 NVLIS-HTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMI--DLYRG 220
           N+L+       K+ DFG     +     P +       V    +  Y SPE++    Y G
Sbjct: 249 NLLLDKKINTIKIADFGMAALEL-----PNKLL-----VTSCGSPHYASPEIVMGKSYHG 298

Query: 221 HPIDEKSDIWALGVFLYKLCYYTTPFE----KGGELAILHSRFQFPAQPIYSDRLKGLIR 276
            P    SD+W+ G+ L+ L     PF     K   L +   +FQ P     S   + LI 
Sbjct: 299 SP----SDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKFQMPQN--ISLEAEDLIS 352

Query: 277 RMLMENPDQRPNVCQVL 293
           R+L+ +P++R  +  +L
Sbjct: 353 RILVVDPEKRIQINDIL 369

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 57/210 (27%), Positives = 102/210 (48%), Gaps = 26/210 (12%)

Query: 102 SYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIK 161
           S   ++L EY +GG L+D++       L+E         V   +  +HA    ++HRD+K
Sbjct: 197 SNHFYMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGVASALQYLHANN--IVHRDLK 252

Query: 162 IENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGH 221
           IEN++IS +G+ K+ DFG +  V    +    F           +  + +PE++   + +
Sbjct: 253 IENIMISTSGEIKIIDFG-LSNVFDTRKQLHTFC---------GSLYFAAPELL---KAN 299

Query: 222 P-IDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRF-----QFPAQPIYSDRLKGLI 275
           P I  + DIW+ GV LY L     PF+     ++LH +      ++P     S  +  L+
Sbjct: 300 PYIGPEVDIWSFGVVLYVLVCGKVPFDDENS-SVLHEKIKQGKVEYPNH--LSIEVISLL 356

Query: 276 RRMLMENPDQRPNVCQVLEDVSRMQGIQCP 305
            +ML+ +P +R N+ +V+E    ++G   P
Sbjct: 357 SKMLVVDPLKRANLTKVIEHPWMIRGYDFP 386

>TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.496
           YHL007C
          Length = 973

 Score = 80.5 bits (197), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 73/292 (25%), Positives = 134/292 (45%), Gaps = 44/292 (15%)

Query: 13  TVLTVG--SHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLR 70
           T+++ G  S H K +  +  G    V++A     D+  ++ +  +K++ +  +P    + 
Sbjct: 666 TIVSEGDPSKHYKDLVKIGQGASGGVFTAH----DSRDENRLVAIKQMNLQKQPKKELII 721

Query: 71  AEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQ 130
            E+  MK  R+ +++V++IDS+  K        +++++MEY  GG L D +   +   L 
Sbjct: 722 NEIIVMKGSRH-ENIVNFIDSYLMKG-------DLWVVMEYMEGGSLTDVVTHCI---LT 770

Query: 131 EFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQN 190
           E +I  +  +   G+A +H+    +IHRDIK +N+L+S  G  K+ DFG  C        
Sbjct: 771 EGQIGTVCKETLGGLAFLHSKG--VIHRDIKSDNILLSMNGDIKLTDFG-FC-------- 819

Query: 191 PQEFAYVQHDVLKNTTA----QYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPF 246
               A +    LK TT      + +PE++      P   K DIW+LG+ + ++     P+
Sbjct: 820 ----AQINEVHLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 872

Query: 247 EKGGELAILH-----SRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVL 293
                L  L+        Q        + LK  +   L  NP++R    ++L
Sbjct: 873 LNETPLRALYLIATNGTPQLKDPENLGEILKKFLDWCLTVNPEERATALELL 924

>YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}
           PKH2Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh1p
          Length = 1081

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 109/230 (47%), Gaps = 24/230 (10%)

Query: 72  EVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQE 131
           E  A++ L N+  VV    +   +SS       ++ L+EY   G  +  M  +    L E
Sbjct: 227 EKTALQKLNNSPSVVRLFSTFQDESS-------LYFLLEYAPNGDFLSLM--KKYGSLDE 277

Query: 132 FEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNP 191
                  +Q+   I  +H+    +IHRDIK EN+L+    + K+ DFG+   ++ P  N 
Sbjct: 278 TCARYYAAQIIDAIDYLHS--NGIIHRDIKPENILLDGEMKIKLTDFGT-AKLLNPTNN- 333

Query: 192 QEFAYVQHDVLKNT-----TAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPF 246
              +  ++D+   +     TA+Y SPE+++       D + DIWA G  L+++     PF
Sbjct: 334 -SVSKPEYDLSTRSKSFVGTAEYVSPELLN---DSFTDYRCDIWAFGCILFQMIAGKPPF 389

Query: 247 EKGGELAILHS--RFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLE 294
           +   E        + Q+   P +   ++ L++++L++N D+R  + Q+ E
Sbjct: 390 KATNEYLTFQKVMKVQYAFTPGFPLIIRDLVKKILVKNLDRRLTISQIKE 439

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 62/194 (31%), Positives = 91/194 (46%), Gaps = 24/194 (12%)

Query: 101 GSY----EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLI 156
           GSY     ++++MEYCAGG L   +      ++ E  I  IM +V   +  +H  +  +I
Sbjct: 87  GSYLKDTSLWIIMEYCAGGSLRSLLR---PGKIDEKYIGVIMREVLVALKCIH--KDNVI 141

Query: 157 HRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMID 216
           HRDIK  NVLI++ G  K+CDFG    V +     Q  A          T  + +PE+I 
Sbjct: 142 HRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTMA---------GTPYWMAPEVI- 191

Query: 217 LYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGEL----AILHSRFQFPAQPIYSDRLK 272
              G   D K DIW+LG+  Y++     P+ +   L     I+ S+        YS  LK
Sbjct: 192 -MEGVYYDTKVDIWSLGITTYEIATGNPPYCEVEALRAMQLIIKSKPPRLEGRSYSPSLK 250

Query: 273 GLIRRMLMENPDQR 286
             I   L E+P +R
Sbjct: 251 EFIALCLDEDPKER 264

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 80.5 bits (197), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 62/225 (27%), Positives = 105/225 (46%), Gaps = 31/225 (13%)

Query: 69  LRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNR 128
           +R E+  +  L+   ++  Y  S+   +       +++++MEYCAGG L   +   +   
Sbjct: 59  IRKEIQFLSSLKQTPNITHYYGSYLIDT-------KLWVIMEYCAGGSLRTLLRPGI--- 108

Query: 129 LQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPP 188
           ++E  I  IM ++   + ++H  +  +IHRDIK  N+LI++ G  K+CDFG    + +  
Sbjct: 109 IEEKYIGVIMREILVALISIH--RDNVIHRDIKAANILIANNGSVKLCDFGVAAQLSQSM 166

Query: 189 QNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEK 248
              Q  A          T  + +PE+I    G   D K DIW+LG+  Y++     P+  
Sbjct: 167 LKRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPY-- 213

Query: 249 GGELAILHSRFQFPAQP------IYSDRLKGLIRRMLMENPDQRP 287
               AI   +    ++P       YS  LK  I   L E+P +RP
Sbjct: 214 CHMEAIRAMQMITKSKPPRLEGREYSQPLKEFIALCLDEDPKERP 258

>Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W
           (REAL)
          Length = 1076

 Score = 80.5 bits (197), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 103/229 (44%), Gaps = 27/229 (11%)

Query: 62  DKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFM 121
           D   +  ++ E+  +  L+   ++  Y  S+   +S       +++LMEYCAGG L   +
Sbjct: 59  DSDEVEDVQREIQFLASLKQMPNITRYYGSYLKDTS-------LWILMEYCAGGSLRSLL 111

Query: 122 NTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSV 181
                 ++ E  I  IM ++   +  +H  +  +IHRDIK  NVLI++ G  K+CDFG  
Sbjct: 112 R---PGKIDEKYIGVIMRELLVALKCIH--KDNVIHRDIKAANVLITNEGSVKLCDFGVA 166

Query: 182 CGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCY 241
             V +     Q  A          T  + +PE+I    G   D K DIW+LG+  Y++  
Sbjct: 167 AQVNQTSLRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIAT 215

Query: 242 YTTPFEKGGEL----AILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQR 286
              P+     L     I+ S+        YS  LK  I   L E+P +R
Sbjct: 216 GNPPYCDVEALRAMQLIIKSKPPRLEGRSYSSSLKEFIALCLDEDPKER 264

>AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL100W
           (PKH2) and YDR490C (PKH1)
          Length = 1033

 Score = 80.1 bits (196), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 94/191 (49%), Gaps = 12/191 (6%)

Query: 105 VFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           ++ L+EY   G  +  M  +    L E       +Q+   I  +H  +  +IHRD+K EN
Sbjct: 276 LYFLLEYAPNGDFLSVM--KRFGTLSEECTKYYGAQILDAIHHLH--KQGIIHRDVKPEN 331

Query: 165 VLISHTGQYKVCDFGSVCGVIRPPQN-PQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPI 223
           +L+  T + K+ DFG+   + R  +N P +        +   TA+Y SPE+++    + +
Sbjct: 332 ILLDKTMKIKLTDFGTAKLIGREDENKPYDLNTRSKSFV--GTAEYVSPELLN---DNYV 386

Query: 224 DEKSDIWALGVFLYKLCYYTTPFEKGGELAILHS--RFQFPAQPIYSDRLKGLIRRMLME 281
           D + DIWA G  L+++     PF+   E        R Q+     +   L+ LI+++L++
Sbjct: 387 DSRCDIWAFGCILFQMVAGKPPFKATNEYLTFQKVMRVQYAFTAGFPMILRDLIKQLLVK 446

Query: 282 NPDQRPNVCQV 292
            P+QR  + Q+
Sbjct: 447 KPEQRLTILQI 457

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score = 80.5 bits (197), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 99/200 (49%), Gaps = 31/200 (15%)

Query: 104 EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
           E++L++EY  GG L D++ +R   +L E E ++   Q+ +G++  H+    + HRD+K E
Sbjct: 188 ELYLVLEYVDGGELFDYLVSR--GKLPEREAIHYFKQIVEGVSYCHSFN--ICHRDLKPE 243

Query: 164 NVLISHTG-QYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTA--QYRSPEMI--DLY 218
           N+L+     + K+ DFG     +  P          + +LK +     Y SPE++    Y
Sbjct: 244 NLLLDKKNKKIKIADFG--MAALELP----------NKLLKTSCGSPHYASPEIVMGRPY 291

Query: 219 RGHPIDEKSDIWALGVFLYKLCYYTTPFE----KGGELAILHSRFQFPAQPIYSDRLKGL 274
            G P    SD+W+ G+ L+ L     PF     K   L +   ++Q P     S   + L
Sbjct: 292 HGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPMN--LSLEARNL 345

Query: 275 IRRMLMENPDQRPNVCQVLE 294
           I ++L+ +P++R    ++LE
Sbjct: 346 ISKILVIDPEKRITTQEILE 365

>Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON}
           similar to Ashbya gossypii ADR167W
          Length = 896

 Score = 80.1 bits (196), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 95/209 (45%), Gaps = 28/209 (13%)

Query: 97  SFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLI 156
           SF    Y ++L MEYC GG     + TR    + E +     S+VT  +  +H +    I
Sbjct: 548 SFQTEDY-LYLCMEYCMGGEFFRALQTRKTKCISEDDARFYASEVTAALEYLHLMG--FI 604

Query: 157 HRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNT----------- 205
           +RD+K EN+L+  +G   + DF  +    + P+NPQ     Q  ++              
Sbjct: 605 YRDLKPENILLHQSGHIMLSDF-DLSVQAKGPRNPQVKGNAQSSLVDTKICSDGFRTNSF 663

Query: 206 --TAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELA------ILHS 257
             T +Y +PE+I   RG+      D W LG+  Y++ +  TPF+  GE        IL  
Sbjct: 664 VGTEEYIAPEVI---RGNGHTASVDWWTLGILTYEMLFGFTPFK--GENTNQTFSNILKV 718

Query: 258 RFQFPAQPIYSDRLKGLIRRMLMENPDQR 286
              FP     S   K LI+++L+++  +R
Sbjct: 719 EATFPNNNEISRTCKDLIKKLLIKSETKR 747

>NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa] {ON}
            
          Length = 1515

 Score = 80.5 bits (197), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 109/237 (45%), Gaps = 30/237 (12%)

Query: 65   SLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTR 124
            ++  LR+EV  +K L ++ ++V Y+        F N      L +EY AGG +   +  R
Sbjct: 1260 TVEALRSEVSTLKDL-DHLNIVQYL-------GFENKDNIYSLFLEYVAGGSVGSLI--R 1309

Query: 125  LQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGV 184
            +  R  E  I ++ +QV +G+A +H+    ++HRD+K +N+L+   G  K+ DF    G+
Sbjct: 1310 MYGRFDEPLIRHLNTQVLRGLAYLHSRG--ILHRDMKADNLLLDQDGVCKISDF----GI 1363

Query: 185  IRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTT 244
             R  ++     Y   D+    T  + +PEM+D  +G+    K DIW+LG  + ++     
Sbjct: 1364 SRKSKD----IYSNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKR 1417

Query: 245  PFEK----GGELAILHSRFQFP----AQPIYSDRLKGLIRRMLMENPDQRPNVCQVL 293
            P+           I  S+   P      P+ S   +  +      +PD RP    +L
Sbjct: 1418 PWSNYEVVAAMFKIGKSKSAPPIPPDTLPLISQNGRDFLDACFEIDPDNRPTADNLL 1474

>Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {ON}
           YDR490C (PKH1) - Ser/Thr protein kinase [contig 184]
           FULL
          Length = 984

 Score = 80.1 bits (196), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 95/190 (50%), Gaps = 10/190 (5%)

Query: 105 VFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           ++ L+EY   G  +  +  +  +  QE  +    +Q+   I  +H     ++HRDIK EN
Sbjct: 232 LYFLLEYAPNGDFLSVIK-KFGSLSQECAVY-YSAQILDAIDYLH--HKGIVHRDIKPEN 287

Query: 165 VLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPID 224
           +L+    + K+ DFG+   ++   +  Q F  ++       TA+Y SPE+++    + +D
Sbjct: 288 ILLDKDMKVKLTDFGT-ARILEKDETTQTFNLLERSKSFVGTAEYVSPELLN---DNYVD 343

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKGGELAILHS--RFQFPAQPIYSDRLKGLIRRMLMEN 282
            K DIWA G  L+++     PF+   E        + Q+     +   ++ LI+++L+++
Sbjct: 344 YKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLVIRDLIKKILVKS 403

Query: 283 PDQRPNVCQV 292
           P+QR +  Q+
Sbjct: 404 PEQRLDASQI 413

>Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 80.1 bits (196), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 71/268 (26%), Positives = 121/268 (45%), Gaps = 33/268 (12%)

Query: 31  GGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYID 90
           G +  VY A  +  D      V  +K ++  +   LN + AE+  +K L N+ ++V Y  
Sbjct: 34  GSYGVVYKAINKHTD-----QVVAIKEIVYENDEELNDIMAEISLLKNL-NHHNIVKY-- 85

Query: 91  SHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHA 150
                  F   SYE+++L+EYCA G L   + +R    L E E    ++Q   G+  +H 
Sbjct: 86  -----HGFIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKTYVTQTLLGLKYLHG 139

Query: 151 LQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYR 210
               +IHRDIK  N+L+S     K+ DFG V  ++               +    T  + 
Sbjct: 140 --EGVIHRDIKAANILLSADNTVKLADFG-VSTIVNSSA-----------LTLAGTLNWM 185

Query: 211 SPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQP--IYS 268
           +PE++   RG      SDIW+LG  + ++     P+    +  I ++       P   +S
Sbjct: 186 APEILG-NRGAS--TLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFS 242

Query: 269 DRLKGLIRRMLMENPDQRPNVCQVLEDV 296
           + LK  + +  ++N  +RP   Q+L+ V
Sbjct: 243 ESLKDFLSKCFVKNMYKRPTADQLLKHV 270

>NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_1.271
          Length = 1555

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/240 (25%), Positives = 114/240 (47%), Gaps = 36/240 (15%)

Query: 65   SLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTR 124
            +++ +++EV  +K L ++ ++V Y+        F N      L +EY AGG +   +  R
Sbjct: 1300 TVDAIKSEVSTLKDL-DHLNIVQYL-------GFENKDNIYSLFLEYVAGGSVGSLI--R 1349

Query: 125  LQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGV 184
            +  R  E  I ++  QV +G+A +HA    ++HRD+K +N+L+   G  K+ DF    G+
Sbjct: 1350 IYGRFDEPLIRHLNIQVLRGLAYLHARG--ILHRDMKADNLLLDQDGVCKISDF----GI 1403

Query: 185  IRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTT 244
             R  ++     Y   D+    T  + +PEM+D  +G+    K DIW+LG  + ++     
Sbjct: 1404 SRKSKD----IYSNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKR 1457

Query: 245  PFEKGGELAILHSRFQF----PAQPIYSDRL-------KGLIRRMLMENPDQRPNVCQVL 293
            P+       ++ + F+      A PI  D L       +  +      +PD+RP   ++L
Sbjct: 1458 PW---SNFEVVAAMFKIGKSKSAPPIPEDTLPLISAEGREFLDACFEIDPDKRPTADELL 1514

>TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.668
           YPL150W
          Length = 988

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/209 (27%), Positives = 98/209 (46%), Gaps = 49/209 (23%)

Query: 104 EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
           +V++ +EYC G  L + +  RL  R+   E   + +Q++  +   H+L    +HRD+K+E
Sbjct: 102 KVWMALEYCPGKELYEHL-LRLH-RIPVDECSRLFAQISGAMYYAHSLN--CVHRDLKLE 157

Query: 164 NVLISHTGQYKVCDFG------------SVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRS 211
           N+L+   G  K+ DFG            ++CG                      T  Y +
Sbjct: 158 NILLDKVGNAKLTDFGFTRECASKNILETICG----------------------TTVYMA 195

Query: 212 PEMI--DLYRGHPIDEKSDIWALGVFLYKLCYYTTPFE----KGGELAILHSRFQFPAQP 265
           PE+I  + Y G  I    D+W+LGV LY L     PF+    K  E  I++    F +  
Sbjct: 196 PELIKRERYDGFKI----DVWSLGVILYTLLNGFMPFDEEQQKNTEWKIVNEMPSFDSTL 251

Query: 266 IYSDRLKGLIRRMLMENPDQRPNVCQVLE 294
           +  D +  L+ ++L ++P  RP++ +VLE
Sbjct: 252 LGPDAV-DLLSKLLAKDPIDRPSMKEVLE 279

>KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}
           Anc_6.371 YCR091W
          Length = 833

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/212 (28%), Positives = 93/212 (43%), Gaps = 25/212 (11%)

Query: 105 VFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           V+L MEYC GG     + TR    + E +     S+VT  +  +H L    I+RD+K EN
Sbjct: 509 VYLCMEYCMGGEFFRALQTRKAKSISEDDARFYASEVTAALEYLHLLG--FIYRDLKPEN 566

Query: 165 VLISHTGQYKVCDFG---SVCGVIRPPQN-PQEFAYVQHDVLKN--------TTAQYRSP 212
           +L+  +G   + DF          +P +    + + V   V            T +Y +P
Sbjct: 567 ILLHKSGHIMLSDFDLSVQANDAAKPVKRVATQSSMVDTKVFSEGFRTNSFVGTEEYIAP 626

Query: 213 EMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGE------LAILHSRFQFPAQPI 266
           E+I   RG+      D W LG+ +Y++ +  TPF+  GE        IL +   FP    
Sbjct: 627 EVI---RGNGHTAAVDWWTLGILIYEMLFGCTPFK--GENTNETFCNILKNEVTFPEHHE 681

Query: 267 YSDRLKGLIRRMLMENPDQRPNVCQVLEDVSR 298
            S   K LIR++L +N  +R        D+ R
Sbjct: 682 ISRHCKDLIRKLLSKNESKRLGSKMGAADIKR 713

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON}
           Anc_5.591 YDR466W
          Length = 1117

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 65/232 (28%), Positives = 106/232 (45%), Gaps = 36/232 (15%)

Query: 72  EVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQE 131
           E+  MKLLR+  +V+S  D     S+       +++++EY   G L + +  +    L E
Sbjct: 84  EIIIMKLLRH-ANVLSLYDVWETNSN-------LYMILEYAEKGELFNLLVEK--GPLPE 133

Query: 132 FEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNP 191
            E +    Q+  GI+  HAL   ++HRD+K EN+L+ H    K+ DFG            
Sbjct: 134 KEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGMA---------- 181

Query: 192 QEFAYVQHDVLKNTTA---QYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPF-E 247
              A    D L  T+     Y +PE++     H  +  SD+W+ GV L+ L     PF E
Sbjct: 182 ---ALETEDKLLETSCGSPHYAAPEIVSGIPYHGFE--SDVWSCGVILFALLTGRLPFDE 236

Query: 248 KGGE-----LAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLE 294
           + G      L +   +F+ P     S   + LI R+L  +P +R    ++L+
Sbjct: 237 EDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILK 288

>KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.371
           YCR091W
          Length = 786

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 100/232 (43%), Gaps = 37/232 (15%)

Query: 97  SFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLI 156
           SF    Y ++L MEYC GG     + TR    + E +     S+VT  +  +H L    I
Sbjct: 434 SFQTEDY-LYLCMEYCMGGEFFRALQTRKSKCISEGDARFYASEVTAALEYLHLLG--FI 490

Query: 157 HRDIKIENVLISHTGQYKVCDF---------GSVCG--VIRPPQNPQEFAYVQHDVLKNT 205
           +RD+K EN+L+  +G   + DF         G V    +I PP +       + + + +T
Sbjct: 491 YRDLKPENILLHKSGHIMLSDFDLSVQANDSGKVKTPMIITPPSSSSSGKRSRSNTMIDT 550

Query: 206 --------------TAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGE 251
                         T +Y +PE+I   RG+      D W LG+ +Y++ +  TPF KG  
Sbjct: 551 KVFSDGFRTNSFVGTEEYIAPEVI---RGNGHTAAVDWWTLGILIYEMLFGFTPF-KGSN 606

Query: 252 -----LAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSR 298
                  IL +   FP     S   K LI+++L +N  +R        D+ R
Sbjct: 607 TNETFCNILKNEVTFPNNNDVSRNCKDLIKKLLCKNEQKRLGSKMGAADIKR 658

>SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1062

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 55/218 (25%), Positives = 102/218 (46%), Gaps = 26/218 (11%)

Query: 102 SYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIK 161
           S   ++L EY +GG L+D++       L+E         +   +  +H     ++HRD+K
Sbjct: 175 SNHFYMLFEYVSGGQLLDYIIQ--HGSLRERHARKFARGIASALQYLHMNN--IVHRDLK 230

Query: 162 IENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGH 221
           IEN++IS +G+ K+ DFG +  +  P +    F           +  + +PE++   + H
Sbjct: 231 IENIMISTSGEIKIIDFG-LSNMYDPKKQLHTFC---------GSLYFAAPELL---KAH 277

Query: 222 P-IDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRF-----QFPAQPIYSDRLKGLI 275
           P I  + D+W+ GV LY L     PF+     ++LH +      ++P     S  +  L+
Sbjct: 278 PYIGPEVDVWSFGVVLYVLVCGKVPFDDENA-SVLHEKIKQGKVEYPQH--LSIEVISLL 334

Query: 276 RRMLMENPDQRPNVCQVLEDVSRMQGIQCPVRNFYLLR 313
            +ML+ +P +R  + QV+      +G   P  ++   R
Sbjct: 335 SKMLVVDPSKRATLKQVVSHQWMQRGYDFPAPSYLPYR 372

>KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {ON}
           Anc_2.496 YHL007C
          Length = 885

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 73/274 (26%), Positives = 128/274 (46%), Gaps = 43/274 (15%)

Query: 31  GGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYID 90
           G    VY+A     D   +++VA +K++    +P    +  E+  MK  R+ +++V++ID
Sbjct: 574 GASGGVYTA----TDVNTEASVA-IKKMNFEKQPKKELIVNEILVMKASRH-ENIVNFID 627

Query: 91  SHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHA 150
           S+     F NG+  ++++MEY  GG L D +   +   L E +I  +  +   G+  +H+
Sbjct: 628 SY-----FLNGN--LWVIMEYMKGGSLTDVVTHCI---LTEQQISTVTRETLNGLRFLHS 677

Query: 151 LQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTA--- 207
               +IHRDIK +NVL+S +G  K+ DFG  C            A +    LK TT    
Sbjct: 678 --KGVIHRDIKSDNVLLSLSGDIKLTDFG-FC------------AQINEINLKRTTMVGT 722

Query: 208 -QYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILH-----SRFQF 261
             + +PE++      P   K DIW+LG+ + ++     P+     L  L+        + 
Sbjct: 723 PYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPEL 779

Query: 262 PAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLED 295
                 S+ LK  +   L  +P +R +  ++L D
Sbjct: 780 KDPDSLSECLKAFLDWCLKVDPHERASATELLND 813

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 97/202 (48%), Gaps = 24/202 (11%)

Query: 101 GSY----EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLI 156
           GSY    +++++MEYCAGG L   +      ++ E  I  IM ++    A MH  +  +I
Sbjct: 83  GSYLNDTKLWVIMEYCAGGSLRTLLR---PGKIGEQYIGVIMRELL--TALMHIHKDGVI 137

Query: 157 HRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMID 216
           HRDIK  NVLI++ G  K+CDFG    + +     Q  A          T  + +PE+I 
Sbjct: 138 HRDIKAANVLITNDGHIKLCDFGVAAQLSQTKIRRQTMA---------GTPYWMAPEVI- 187

Query: 217 LYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGEL----AILHSRFQFPAQPIYSDRLK 272
              G   D K DIW+LG+  Y++     P+ +   L     I  S+        +S  LK
Sbjct: 188 -MEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLEGRQHSSALK 246

Query: 273 GLIRRMLMENPDQRPNVCQVLE 294
            +I   L E+P +RP+   +L+
Sbjct: 247 EIIALCLDEDPKERPSAEDLLK 268

>SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 400

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 92/205 (44%), Gaps = 47/205 (22%)

Query: 105 VFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           V+LLMEY   G L  + + R+     +      ++Q+   +  MH     ++HRDIK EN
Sbjct: 213 VYLLMEYLVNGEL--YRHLRVNGPFNDILASYYVNQMADALNYMHDRN--VLHRDIKPEN 268

Query: 165 VLISHTGQYKVCDFG------------SVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSP 212
           +LI      K+ DFG            ++CG                      T  Y SP
Sbjct: 269 ILIGFQNTLKLTDFGWSVISTTGAKRKTLCG----------------------TLDYLSP 306

Query: 213 EMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGG-ELA---ILHSRFQFPAQPIYS 268
           E++  YR +  DEK D+WALGV  Y+L   T PFE+   EL    I+    +FP Q   S
Sbjct: 307 ELVK-YREY--DEKVDVWALGVLAYELLVGTPPFEEASKELTYKRIVRRDLRFPDQ--MS 361

Query: 269 DRLKGLIRRMLMENPDQRPNVCQVL 293
              + LI R+L  +P  R ++  VL
Sbjct: 362 IDARDLIGRLLENDPSTRISLKDVL 386

>Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar to
           Ashbya gossypii ACR133C
          Length = 855

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 101/201 (50%), Gaps = 33/201 (16%)

Query: 104 EVFLLMEYCAGGGLIDFMNTRLQN-RLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKI 162
           +V++ +EYC G  L D++   LQ  R+   E   + +Q+   +   H+LQ   +HRD+K+
Sbjct: 102 KVWMALEYCPGNELYDYL---LQKQRIPLDETSKLFAQIVGAVFYAHSLQ--CVHRDLKL 156

Query: 163 ENVLISHTGQYKVCDFGSV--CGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMI--DLY 218
           EN+L+   G   + DFG    C               Q + +  TT  Y +PE+I  + Y
Sbjct: 157 ENILLDKQGYAMLTDFGFTRECAT-----------KTQLETICGTTV-YMAPELIKRESY 204

Query: 219 RGHPIDEKSDIWALGVFLYKLCYYTTPF-EKGGELAILHSRFQFPAQPI---YSD-RLKG 273
            G+ +    D W+LG+ LY + +   PF E+   L  L    + P  PI   Y++   K 
Sbjct: 205 DGYKV----DTWSLGIILYTMLHGFMPFDEEDPTLTGLKIMNEMP--PIVDAYTNVHAKD 258

Query: 274 LIRRMLMENPDQRPNVCQVLE 294
           LI ++L + P +RP++ +VLE
Sbjct: 259 LILKLLRKTPSERPSLNKVLE 279

>YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}
           CDC15Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase;
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p; required for spindle
           disassembly after meiosis II
          Length = 974

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 72/268 (26%), Positives = 121/268 (45%), Gaps = 33/268 (12%)

Query: 31  GGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYID 90
           G +  VY A  +  D      V  +K V+  +   LN + AE+  +K L +N ++V Y  
Sbjct: 34  GSYGVVYKAINKHTD-----QVVAIKEVVYENDEELNDIMAEISLLKNLNHN-NIVKY-- 85

Query: 91  SHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHA 150
                  F   SYE+++L+EYCA G L   + +R    L E E    ++Q   G+  +H 
Sbjct: 86  -----HGFIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKTYVTQTLLGLKYLHG 139

Query: 151 LQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYR 210
               +IHRDIK  N+L+S     K+ DFG V  ++               +    T  + 
Sbjct: 140 --EGVIHRDIKAANILLSADNTVKLADFG-VSTIVNSSA-----------LTLAGTLNWM 185

Query: 211 SPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQP--IYS 268
           +PE++   RG      SDIW+LG  + ++     P+    +  I ++       P   +S
Sbjct: 186 APEILG-NRGAS--TLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFS 242

Query: 269 DRLKGLIRRMLMENPDQRPNVCQVLEDV 296
           + LK  + +  ++N  +RP   Q+L+ V
Sbjct: 243 EPLKDFLSKCFVKNMYKRPTADQLLKHV 270

>KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1.271
            YJL095W
          Length = 1398

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/240 (25%), Positives = 112/240 (46%), Gaps = 36/240 (15%)

Query: 65   SLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTR 124
            ++  LR+EV  +K L ++ ++V Y+        F N      L +EY AGG +   +  R
Sbjct: 1142 TVEALRSEVSTLKDL-DHLNIVQYL-------GFENKDNIYSLFLEYVAGGSVGSLI--R 1191

Query: 125  LQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGV 184
            +  R  E  I ++  QV +G++ +H+    ++HRD+K +N+L+   G  K+ DF    G+
Sbjct: 1192 MYGRFDEAMIRHLTIQVLRGLSYLHSRG--ILHRDMKADNLLLDQDGVCKISDF----GI 1245

Query: 185  IRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTT 244
             R   +     Y   D+    T  + +PEM+D  +G+    K DIW+LG  + ++     
Sbjct: 1246 SRKSND----IYSNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKR 1299

Query: 245  PFEKGGELAILHSRFQF----PAQPIYSDRL-------KGLIRRMLMENPDQRPNVCQVL 293
            P+     L ++ + F+      A PI  D L       +  +      +P+ RP   ++L
Sbjct: 1300 PW---SNLEVVAAMFKIGKSKSAPPIPEDTLPLISQDGRQFLDSCFEIDPESRPTADKLL 1356

>ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} similar
           to uniprot|P34244 Saccharomyces cerevisiae YKL101W HSL1
           Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints associates with the
           assembled septin filament required along with Hsl7p for
           bud neck recruitment phosphorylation and degradation of
           Swe1p
          Length = 1616

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 95/199 (47%), Gaps = 31/199 (15%)

Query: 104 EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
           E++L++EY  GG L D++ +R   +L E E ++   Q+ QG++  H+    + HRD+K E
Sbjct: 216 ELYLVLEYVDGGELFDYLVSR--GKLGEREAVHYFKQIVQGVSYCHSFN--ICHRDLKPE 271

Query: 164 NVLISHTGQ-YKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTA--QYRSPEMI--DLY 218
           N+L+    +  K+ DFG                 V + +L+ +     Y SPE++    Y
Sbjct: 272 NLLLDKKNKSIKIADFGMAA------------LEVSNKLLQTSCGSPHYASPEIVMGRPY 319

Query: 219 RGHPIDEKSDIWALGVFLYKLCYYTTPFE----KGGELAILHSRFQFPAQPIYSDRLKGL 274
            G P    SD+W+ G+ L+ L     PF     K   L +   +F  P     S   K L
Sbjct: 320 HGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQSGKFHMPQN--LSAEAKDL 373

Query: 275 IRRMLMENPDQRPNVCQVL 293
           + ++L+ NP +R    ++L
Sbjct: 374 MSKILVVNPFKRIATEEIL 392

>NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2.479
           YKL101W
          Length = 1515

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 95/197 (48%), Gaps = 27/197 (13%)

Query: 104 EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
           E++L++EY  GG L D++ +R   +L E E ++   Q+ QG++  H+    + HRD+K E
Sbjct: 226 ELYLILEYVDGGELFDYLVSR--GKLPEAEAIHYFKQIIQGVSYCHSFN--ICHRDLKPE 281

Query: 164 NVL-ISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMI--DLYRG 220
           N+L        K+ DFG +  +  P +  Q      H         Y SPE++    Y G
Sbjct: 282 NLLIDKKKKSIKIADFG-MAALELPKKLLQTSCGSPH---------YASPEIVMGKSYHG 331

Query: 221 HPIDEKSDIWALGVFLYKLCYYTTPFE----KGGELAILHSRFQFPAQPIYSDRLKGLIR 276
            P    SD+W+ G+ L+ L     PF     K   L +   ++Q P     SD  K LI 
Sbjct: 332 GP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGKYQMPKN--LSDEAKDLIS 385

Query: 277 RMLMENPDQRPNVCQVL 293
           R+L+ +P +R    ++L
Sbjct: 386 RILVVSPSKRLTTVEIL 402

>Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON}
           (25064..28447) [3384 nt, 1128 aa]
          Length = 1127

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 94/197 (47%), Gaps = 30/197 (15%)

Query: 101 GSY----EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLI 156
           GSY     ++++MEYCAGG L   +   +   + E  I  IM ++   +  +H  +  +I
Sbjct: 108 GSYLQDTNLWIIMEYCAGGSLRTLLRPGM---IDEKYIGVIMRELLTALQCIH--KDNVI 162

Query: 157 HRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMID 216
           HRDIK  NVLI++ G+ K+CDFG    + +     Q  A          T  + +PE+I 
Sbjct: 163 HRDIKAANVLITNEGKVKLCDFGVAAQLNQTSLRRQTMA---------GTPYWMAPEVI- 212

Query: 217 LYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHS-RFQFPAQPI------YSD 269
              G   D K DIW+LG+  Y++     P+    E+  L + +    ++P       YS 
Sbjct: 213 -MEGVYYDTKVDIWSLGITAYEIATGNPPY---CEIEALRAMQLITKSKPARLEGRQYSS 268

Query: 270 RLKGLIRRMLMENPDQR 286
            LK  I   L E+P +R
Sbjct: 269 GLKEFIALCLDEDPKER 285

>Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W
           (REAL)
          Length = 1073

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/229 (27%), Positives = 103/229 (44%), Gaps = 27/229 (11%)

Query: 62  DKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFM 121
           D   +  ++ E+  +  L+   ++  Y  S+   +S       ++++MEYCAGG L   +
Sbjct: 59  DSDEVEDVQREIQFLASLKQISNITRYYGSYLKDTS-------LWIIMEYCAGGSLRSLL 111

Query: 122 NTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSV 181
                 ++ E  I  IM ++   +  +H  +  +IHRDIK  NVLI++ G  K+CDFG  
Sbjct: 112 R---PGKIDEKYIGVIMRELLVALKCIH--KDNVIHRDIKAANVLITNEGNVKLCDFGVA 166

Query: 182 CGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCY 241
             V +     Q  A          T  + +PE+I    G   D K DIW+LG+  Y++  
Sbjct: 167 AQVNQTSLRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIAT 215

Query: 242 YTTPFEKGGEL----AILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQR 286
              P+     L     I+ S+        YS  LK  I   L E+P +R
Sbjct: 216 GNPPYCDVEALRAMQLIIKSKPPRLEGRSYSPSLKEFIALCLDEDPKER 264

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/199 (27%), Positives = 98/199 (49%), Gaps = 31/199 (15%)

Query: 104 EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
           E++L++EY  GG L D++ ++   +L E E ++   Q+ +G++  H+    + HRD+K E
Sbjct: 188 ELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEGVSFCHSFN--ICHRDLKPE 243

Query: 164 NVLISHTG-QYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTA--QYRSPEMI--DLY 218
           N+L+     + K+ DFG     +  P          + +LK +     Y SPE++    Y
Sbjct: 244 NLLLDKKNRKIKIADFG--MAALELP----------NKLLKTSCGSPHYASPEIVMGRPY 291

Query: 219 RGHPIDEKSDIWALGVFLYKLCYYTTPFE----KGGELAILHSRFQFPAQPIYSDRLKGL 274
            G P    SD+W+ G+ L+ L     PF     K   L +   ++Q P     S   + L
Sbjct: 292 HGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPMN--LSAEARDL 345

Query: 275 IRRMLMENPDQRPNVCQVL 293
           I ++L+ NP++R    ++L
Sbjct: 346 ISKILVINPEKRITTQEIL 364

>TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1057

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/228 (24%), Positives = 109/228 (47%), Gaps = 26/228 (11%)

Query: 72  EVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQE 131
           E +A++ L N++ +V    +   +SS       ++ L+EY   G  +  M  +    L E
Sbjct: 215 EKNALQRLNNSRGIVKLYFTFQDESS-------LYFLLEYAPNGDFLSIM--KKYGSLNE 265

Query: 132 FEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNP 191
                  +Q+   I  +H+    ++HRDIK EN+L+    + K+ DFG+   ++ P  N 
Sbjct: 266 DCACYYSAQIIDAIDFLHS--KGIVHRDIKPENILLDKDFKVKLTDFGT-AKILEPKPNT 322

Query: 192 QEFAYVQHDVLKNT-----TAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPF 246
            +     +D+L  +     TA+Y SPE+++    + +D + DIWA G  L+++     PF
Sbjct: 323 TD----SYDLLSRSKSFVGTAEYVSPELLN---DNYVDYRCDIWAFGCILFQMIAGKPPF 375

Query: 247 EKGGELAILHS--RFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQV 292
           +   E        + Q+     +   ++ L++ +L++ P QR  + Q+
Sbjct: 376 KATNEYLTFQKVMKVQYAFTAGFPLVVRDLVKGILIKQPAQRLTIPQI 423

>NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]
           {ON} Anc_3.92
          Length = 1113

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/226 (25%), Positives = 105/226 (46%), Gaps = 26/226 (11%)

Query: 75  AMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEI 134
           A++ L N++ ++    +   ++S       ++ L+EY   G  +  M  +    L E   
Sbjct: 221 ALQRLNNSRSIIRLFFTFQDEAS-------LYFLLEYAPNGDFLSVM--KKYGSLNEECA 271

Query: 135 LNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEF 194
               +Q+   I  MH     +IHRDIK EN+L+    + K+ DFG+   +        + 
Sbjct: 272 CYYGAQILDAIGFMHTRG--IIHRDIKPENILMDKDMKVKITDFGTAKILDEKTNGNNKT 329

Query: 195 AYVQHDVLKNT-----TAQYRSPEMI-DLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEK 248
           +Y   ++L  +     TA+Y SPE++ D Y     D + DIWA G  LY++     PF+ 
Sbjct: 330 SY---ELLTRSKSFVGTAEYVSPELLNDNYS----DSRCDIWAFGCILYQMIAGKPPFKA 382

Query: 249 GGELAILHS--RFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQV 292
             E        + Q+     +   ++ LI+R+L++ P+QR  + Q+
Sbjct: 383 TNEYLTFQKVMKVQYAFTAGFPTIIRDLIKRILLKVPEQRLTIGQI 428

>AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR523C
           (SPS1)
          Length = 440

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 66/275 (24%), Positives = 130/275 (47%), Gaps = 28/275 (10%)

Query: 23  KVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNN 82
           +++  +  G F  VY A    ++  +   V  L+     D+P ++ L  E+  +  LR+ 
Sbjct: 21  EILQCIGRGNFGDVYKARDLTSNEIVAIKVVNLEDT---DEP-IDLLAQEIFFLSELRS- 75

Query: 83  KHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVT 142
            ++ +Y  +     S       ++++MEYC GG   + +    ++++ E +   I+S+V 
Sbjct: 76  PYITNYKTAFLVDVS-------MWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEVL 128

Query: 143 QGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVL 202
            G+  +H+ +   IHRDIK  N+L++  G  K+ DFG V G +   +    F        
Sbjct: 129 IGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSGQMMVTRKRDTFV------- 178

Query: 203 KNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHS---RF 259
              T  + +PE+ID  +    +E +DIW+LG+ + +L     P +K   +  L +   R 
Sbjct: 179 --GTPFWMAPEVIDRNK-QGYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPKRD 235

Query: 260 QFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLE 294
                  +S   +  + + L+++P QRP   ++L+
Sbjct: 236 PPKLDKRFSSHARDFVAQCLIKDPSQRPTAAELLK 270

>Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}
           complement(4365..7655) [3291 nt, 1097 aa]
          Length = 1096

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/255 (23%), Positives = 122/255 (47%), Gaps = 36/255 (14%)

Query: 52  VACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEY 111
           V  L +  +  +  +  +  E +A++ L N++ +V    +   ++S       ++ L+EY
Sbjct: 239 VKVLSKEYLIKQKKVKYVNIEKNALQKLNNSRGIVRLFFTFQDEAS-------LYFLLEY 291

Query: 112 CAGGGLIDFMNTRLQNRLQEFEILN------IMSQVTQGIAAMHALQPPLIHRDIKIENV 165
              G   DF++      +++F  +N        +Q+   I  +H+    +IHRDIK EN+
Sbjct: 292 APNG---DFLSL-----IKKFGSMNEDCASYYSAQIIDAIHFVHSRG--IIHRDIKPENI 341

Query: 166 LISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNT-----TAQYRSPEMI-DLYR 219
           L+    + K+ DFG+   ++ P  +     +  +D+L  +     TA+Y SPE++ D Y 
Sbjct: 342 LLDSEMKVKLTDFGT-AKILEPKSSSSSSKHETYDLLTRSKSFVGTAEYVSPELLNDSY- 399

Query: 220 GHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHS--RFQFPAQPIYSDRLKGLIRR 277
               D + DIWA G  ++++     PF+   E        + Q+     +   ++ L++R
Sbjct: 400 ---ADSRCDIWAFGCIVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLVIRDLVKR 456

Query: 278 MLMENPDQRPNVCQV 292
           +L++ P+QR  + Q+
Sbjct: 457 ILIKAPEQRLTISQI 471

>Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar to
           Ashbya gossypii ACR119W
          Length = 920

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 104/208 (50%), Gaps = 37/208 (17%)

Query: 100 NGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRD 159
           N  Y + ++++Y +GG    ++  +   RL+E     + +Q+  G+  MH     L HRD
Sbjct: 139 NSKY-IGIVLQYASGGEFYKYIQKK--RRLKEPPACRLFAQLISGVYYMH--HKGLAHRD 193

Query: 160 IKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQ--YRSPEMIDL 217
           +K+EN+L+       + DFG V           EF   ++D++K +     Y +PE++  
Sbjct: 194 LKLENLLLDEHENLMITDFGFV----------NEFH--KNDLMKTSCGSPCYAAPELVVT 241

Query: 218 YRGHPIDEKSDIWALGVFLYKLCYYTTPFE------KGGELAILH-----SRFQFPA--Q 264
            R +    K+D+W+ GV LY +     P++      +G ++A L+     S  +FP   +
Sbjct: 242 ARPYEA-RKADVWSCGVILYAMLAGYLPWDDDPENPEGDDIAKLYHYITKSALKFPEYIK 300

Query: 265 PIYSDRLKGLIRRMLMENPDQRPNVCQV 292
           P+  D    L+RR+L+ NPD R +V ++
Sbjct: 301 PLPRD----LLRRILVSNPDTRLSVMEI 324

>KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {ON}
           Anc_8.654 YPL141C
          Length = 644

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 77/290 (26%), Positives = 134/290 (46%), Gaps = 57/290 (19%)

Query: 24  VISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRN-N 82
           V S L  G F +V     +P     D NV   +R   P + ++  +R +     ++RN +
Sbjct: 52  VGSTLGEGEFGKVKMGWTRPV---TDGNVGPSQRT--PRQVAIKLIRRDT----IVRNSD 102

Query: 83  KHVVSYIDSHAAKS-SFPN---------GSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEF 132
           K    Y + +A K  + PN          S  + +++EY +GG    ++  + + RL+E 
Sbjct: 103 KETKIYREINALKHLTHPNIIVLEEILQNSKYIGIVLEYASGGEFYKYI--QRKRRLKEV 160

Query: 133 EILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQ 192
               + SQ+  G+  MH+    L+HRD+K+EN+L+       + DFG V           
Sbjct: 161 NASRLFSQLVSGVHYMHSKG--LVHRDLKLENLLLDKNENLMITDFGFV----------N 208

Query: 193 EFAYVQHDVLKNTTAQ---YRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFE-- 247
           EF+    +VL  T+     Y +PE++ + R   +  K DIW+ GV LY +     P++  
Sbjct: 209 EFS--NENVLMKTSCGSPCYAAPELV-VSREAYVGVKVDIWSCGVILYAMLAGYLPWDDD 265

Query: 248 ----KGGELAILHSR-----FQFP--AQPIYSDRLKGLIRRMLMENPDQR 286
                G +++ L+S       +FP    P+  D    L+RR+L+ +P +R
Sbjct: 266 PSNPNGDDISKLYSYITATPLKFPDYVNPLPRD----LLRRILVADPRRR 311

>NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON}
           Anc_3.92
          Length = 1116

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 104/219 (47%), Gaps = 27/219 (12%)

Query: 75  AMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEI 134
           A++ L N++ ++    +   ++S       ++ L+EY   G L+  M  +    L E   
Sbjct: 225 ALQRLNNSRSIIRLFFTFQDEAS-------LYFLLEYAPNGDLLSLM--KKFGSLNEECC 275

Query: 135 LNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEF 194
               +Q+   I  MH+    +IHRDIK EN+L+    + K+ DFG+   +   P      
Sbjct: 276 CYYGAQIIDAIKFMHS--KGIIHRDIKPENILLDKDMKVKITDFGTAKILDNKPPG---- 329

Query: 195 AYVQHDVLKNT-----TAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKG 249
               +D+L  +     TA+Y SPE+++    +  D +SDIWA G  ++++     PF+  
Sbjct: 330 --TSYDLLTRSKSFVGTAEYVSPELLN---DNYTDARSDIWAFGCIVFQMIAGKPPFKAT 384

Query: 250 GELAILHS--RFQFPAQPIYSDRLKGLIRRMLMENPDQR 286
            E        + Q+     +   ++ L++R+L++ P+QR
Sbjct: 385 NEYLTFQKVMKVQYAFTAGFPTVVRDLVKRILIKAPEQR 423

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 109/219 (49%), Gaps = 32/219 (14%)

Query: 85  VVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQG 144
           ++S+ +  A    + N S E++L++EY  GG L D++ ++   +L E E ++   Q+ +G
Sbjct: 170 LISHTNVMALFEVWENKS-ELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEG 226

Query: 145 IAAMHALQPPLIHRDIKIENVLISHTG-QYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLK 203
           ++  H+    + HRD+K EN+L+     + K+ DFG     +  P          + +LK
Sbjct: 227 VSYCHSFN--ICHRDLKPENLLLDKKNRRIKIADFG--MAALELP----------NKLLK 272

Query: 204 NTTA--QYRSPEMI--DLYRGHPIDEKSDIWALGVFLYKLCYYTTPFE----KGGELAIL 255
            +     Y SPE++    Y G P    SD+W+ G+ L+ L     PF     K   L + 
Sbjct: 273 TSCGSPHYASPEIVMGRPYHGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQ 328

Query: 256 HSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLE 294
             ++Q P+    S   + LI ++L+ +P++R    ++L+
Sbjct: 329 SGKYQMPSN--LSSEARDLISKILVIDPEKRITTQEILK 365

>TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]
           {ON} Anc_1.52 YDR507C
          Length = 1153

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 65/232 (28%), Positives = 104/232 (44%), Gaps = 36/232 (15%)

Query: 72  EVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQE 131
           E+  MKLL N+ +V+   D     S+       +++++EY   G L + +  R    L E
Sbjct: 82  EIIIMKLL-NHPNVLRLYDVWETNSN-------LYMVLEYAQKGELFNLLVER--GPLPE 131

Query: 132 FEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNP 191
            E +    Q+  GI+  HAL   ++HRD+K EN+L+ H    K+ DFG            
Sbjct: 132 KEAIRFFRQIVIGISYCHAL--GIVHRDLKPENLLLDHKFNIKIADFGMA---------- 179

Query: 192 QEFAYVQHDVLKNTTA---QYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPF-E 247
              A    D L  T+     Y +PE++     H     SD+W+ GV L+ L     PF +
Sbjct: 180 ---ALETEDKLLETSCGSPHYAAPEIVSGIPYHGF--ASDVWSCGVILFALLTGRLPFDD 234

Query: 248 KGGE-----LAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLE 294
           + G      L +   R++ P     S   + LI R+L  +P+QR     +L+
Sbjct: 235 EDGNIRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILK 286

>Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C
           (REAL)
          Length = 974

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 70/266 (26%), Positives = 120/266 (45%), Gaps = 33/266 (12%)

Query: 31  GGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYID 90
           G +  VY A  +  D      V  +K ++      LN + AE+  +K L N+ ++V Y  
Sbjct: 34  GSYGVVYKAINKHTD-----QVVAIKEIVYESDEELNDIMAEISLLKNL-NHDNIVKY-- 85

Query: 91  SHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHA 150
                  F   SYE+++L+EYCA G L   + +R    L E E  + ++Q   G+  +H 
Sbjct: 86  -----HGFIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKSYVTQTLLGLKYLHG 139

Query: 151 LQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYR 210
               +IHRDIK  N+L+S     K+ DFG V  ++               +    T  + 
Sbjct: 140 --EGVIHRDIKAANILLSADNTVKLADFG-VSTIVNSSA-----------LTLAGTLNWM 185

Query: 211 SPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQFPAQP--IYS 268
           +PE++   RG      SDIW+LG  + ++     P+    +  I ++       P   +S
Sbjct: 186 APEILG-NRGAS--TLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFS 242

Query: 269 DRLKGLIRRMLMENPDQRPNVCQVLE 294
           + LK  + +  ++N  +RP   Q+L+
Sbjct: 243 ESLKDFLSKCFVKNMYKRPTADQLLK 268

>KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1.271
            YJL095W
          Length = 1580

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 71/261 (27%), Positives = 121/261 (46%), Gaps = 44/261 (16%)

Query: 52   VACLKRVIVP-----DKPSLNT---LRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSY 103
            +  +K+V VP     D+  L+T   LR+EV  +K L ++ ++V Y+        F N   
Sbjct: 1300 MMAVKQVEVPKYSAQDQNILDTVEALRSEVSTLKDL-DHLNIVQYL-------GFENDHD 1351

Query: 104  EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
               L +EY  GG +   +  RL  R  E  I  +  QV +G+A +H+    ++HRD+K +
Sbjct: 1352 IYSLFLEYVGGGSVGSLI--RLYGRFDEALIRFLTVQVLEGLAYLHSKG--ILHRDMKAD 1407

Query: 164  NVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPI 223
            N+L+   G  K+ DF    G+ R  ++     Y   D+    T  + +PEM+D  +G+  
Sbjct: 1408 NLLLDLDGVCKISDF----GISRKSKD----IYSNSDMTMRGTVFWMAPEMVDTKQGY-- 1457

Query: 224  DEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQF----PAQPIYSDRL-------K 272
              K DIW+LG  + ++     P+     L ++ + F+      A PI  D L       +
Sbjct: 1458 SAKVDIWSLGCVVLEMFAGKRPW---SNLEVVAAMFKIGKNKSAPPIPEDTLPLISQDGR 1514

Query: 273  GLIRRMLMENPDQRPNVCQVL 293
              +      +PD RP   ++L
Sbjct: 1515 QFLNACFEIDPDLRPTADKLL 1535

>SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar to
           uniprot|Q751V1 Ashbya gossypii AFR724C AFR724Cp and some
           similarites with YDR523C uniprot|P08458 Saccharomyces
           cerevisiae YDR523C SPS1 dispensable for mitosis involved
           in middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 564

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 117/248 (47%), Gaps = 31/248 (12%)

Query: 62  DKPSLNTLRAEV-------DAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEV--FLLMEYC 112
           DK + NT+  +V       D + LL    + ++ + S    + F     +V  +++MEYC
Sbjct: 53  DKSTGNTVAIKVVNLEETDDEIDLLAQEIYFLAELHSPYITNYFSTFVEDVSMWIVMEYC 112

Query: 113 AGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQ 172
            GG   D +    +  L E ++  I  ++ +G+  +H+ +   IHRDIK  N+L++  G+
Sbjct: 113 GGGSCSDLLKCLPRGTLTEEKVAFITREILRGLEYLHSQRK--IHRDIKAANILLTDDGK 170

Query: 173 YKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWAL 232
            K+ DFG V G +   +    F           T  + +PE+I        +EK+DIW+L
Sbjct: 171 VKLGDFG-VSGQMMATRRRDTFV---------GTPFWMAPEVIARSE-QGYNEKADIWSL 219

Query: 233 GVFLYKLCYYTTPFEKGGELAILHSRFQFPAQ--PIYSDRLKGLIRRM----LMENPDQR 286
           G+ +++L     P  +   + +L S    P++  P   DR    IR      L ++P +R
Sbjct: 220 GITVFELLKGQPPLSQHDPMKVLMS---IPSRRPPKLEDRYSHAIREFVSLCLNKDPAKR 276

Query: 287 PNVCQVLE 294
           P   ++L+
Sbjct: 277 PTASELLK 284

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR507C
           (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 106/232 (45%), Gaps = 36/232 (15%)

Query: 72  EVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNRLQE 131
           E+  MKLL N+ +V+   D           + ++++++EY   G L + +  R    L E
Sbjct: 78  EIIIMKLL-NHPNVLRLYDVWET-------AQDLYMVLEYVEKGELFNLLVQR--GPLPE 127

Query: 132 FEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNP 191
            E +    Q+  GI+  HAL   ++HRD+K EN+L+ H    K+ DFG            
Sbjct: 128 NEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKLADFGMA---------- 175

Query: 192 QEFAYVQHDVLKNTTA---QYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPF-E 247
              A    D L  T+     Y +PE++     H  +  SD+W+ GV LY L     PF E
Sbjct: 176 ---ALESKDKLLETSCGSPHYAAPEIVSGLPYHGFE--SDVWSCGVILYALLTGRLPFDE 230

Query: 248 KGGE-----LAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLE 294
           + G      L +   +++ P +   S   + LI ++L   P+QR    ++L+
Sbjct: 231 EDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILK 282

>ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1204

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/214 (25%), Positives = 103/214 (48%), Gaps = 26/214 (12%)

Query: 102 SYEVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIK 161
           S   ++L EY +GG L+D++       L+E         +   +  +HA    ++HRD+K
Sbjct: 236 SNHFYMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIASALQYLHANN--IVHRDLK 291

Query: 162 IENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGH 221
           IEN++IS +G+ K+ DFG +  +  P      F           +  + +PE++   +  
Sbjct: 292 IENIMISTSGEIKIIDFG-LSNMFDPRTQLHTFC---------GSLYFAAPELL---KAS 338

Query: 222 P-IDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRFQ-----FPAQPIYSDRLKGLI 275
           P +  + D+W+ GV LY L     PF+     ++LH + +     +P     S  +  L+
Sbjct: 339 PYVGPEVDVWSFGVVLYVLVCGKVPFDDENS-SVLHEKIKQGKVDYPQH--LSIEVISLL 395

Query: 276 RRMLMENPDQRPNVCQVLEDVSRMQGIQCPVRNF 309
            +ML+ +P +R ++ QV+E    ++G   P  ++
Sbjct: 396 SKMLVVDPRKRASLKQVVEHHWMIRGYDFPAPSY 429

>TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5.406
           YHR102W
          Length = 1036

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 98/205 (47%), Gaps = 35/205 (17%)

Query: 98  FPN-----GSY----EVFLLMEYCAGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAM 148
           FPN     GSY     ++++M+YCAGG +   +      ++ E  I  IM ++   +  +
Sbjct: 102 FPNIIRYFGSYLKDTNLWIIMDYCAGGSIRTLLR---PGKIDEKYIGIIMREILIALQYI 158

Query: 149 HALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQ 208
           H  +  +IHRDIK  NVL+++ G+ K+CDFG    + +     Q  A          T  
Sbjct: 159 H--KDNVIHRDIKAANVLVTNEGKVKLCDFGVAAQLNQTKLRRQTMA---------GTPY 207

Query: 209 YRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHS-RFQFPAQPI- 266
           + +PE+I    G   D K+DIW+LG+  Y++     P+    E+  L + +    ++P  
Sbjct: 208 WMAPEVI--MEGAYYDTKADIWSLGITAYEIATGNPPY---CEIEALRAMQLITKSKPAR 262

Query: 267 -----YSDRLKGLIRRMLMENPDQR 286
                YS  LK  I   L E+P +R
Sbjct: 263 LEGRSYSTSLKEFIALCLDEDPKER 287

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 64,029,453
Number of extensions: 2677708
Number of successful extensions: 13603
Number of sequences better than 10.0: 1911
Number of HSP's gapped: 12193
Number of HSP's successfully gapped: 1970
Length of query: 661
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 545
Effective length of database: 40,180,143
Effective search space: 21898177935
Effective search space used: 21898177935
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)