Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0F044908.323ON51051022140.0
KAFR0B057208.323ON48448812891e-174
Smik_4.3898.323ON52549212821e-172
KLTH0G12298g8.323ON50050010371e-136
KNAG0I008908.323ON50850510161e-132
AGL195C8.323ON55446910001e-129
Kwal_56.239168.323ON4994909951e-129
ZYRO0F10384g8.323ON5582419441e-121
YDR145W (TAF12)8.323ON5392318791e-111
Kpol_543.638.323ON5852248771e-111
Suva_2.3068.323ON5412228551e-108
NCAS0B035708.323ON5192078201e-103
SAKL0H15554g8.323ON5362118091e-101
Ecym_42548.323ON5292008041e-100
CAGL0E01397g8.323ON5752188041e-100
TPHA0A015608.323ON5402037954e-99
Skud_4.4048.323ON5351987929e-99
NDAI0J010208.323ON6381947852e-96
KLLA0D16368g8.323ON5111897682e-95
TBLA0A039408.323ON7522187573e-91
TBLA0H012808.323ON4051134103e-44
TBLA0E044904.297ON14352721.2
Skud_13.4268.805ON18797712.5
NDAI0B042802.165ON73845713.9
Kpol_1016.55.435ON812177714.8
Skud_15.2015.630ON28857695.8
KLTH0D15554g4.297ON12368657.1
Kwal_47.171404.297ON12340657.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0F04490
         (510 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0F04490 Chr6 (841584..843116) [1533 bp, 510 aa] {ON} Anc_8.3...   857   0.0  
KAFR0B05720 Chr2 (1180414..1181868) [1455 bp, 484 aa] {ON} Anc_8...   501   e-174
Smik_4.389 Chr4 (707521..709098) [1578 bp, 525 aa] {ON} YDR145W ...   498   e-172
KLTH0G12298g Chr7 complement(1045663..1047165) [1503 bp, 500 aa]...   404   e-136
KNAG0I00890 Chr9 complement(166573..168099) [1527 bp, 508 aa] {O...   395   e-132
AGL195C Chr7 complement(331850..333514) [1665 bp, 554 aa] {ON} S...   389   e-129
Kwal_56.23916 s56 (774901..776400) [1500 bp, 499 aa] {ON} YDR145...   387   e-129
ZYRO0F10384g Chr6 (841520..843196) [1677 bp, 558 aa] {ON} some s...   368   e-121
YDR145W Chr4 (746738..748357) [1620 bp, 539 aa] {ON}  TAF12Subun...   343   e-111
Kpol_543.63 s543 (145534..147291) [1758 bp, 585 aa] {ON} (145534...   342   e-111
Suva_2.306 Chr2 (542035..542808,542959..543810) [1626 bp, 541 aa...   333   e-108
NCAS0B03570 Chr2 (633284..634843) [1560 bp, 519 aa] {ON} Anc_8.3...   320   e-103
SAKL0H15554g Chr8 complement(1354739..1356349) [1611 bp, 536 aa]...   316   e-101
Ecym_4254 Chr4 (527580..529169) [1590 bp, 529 aa] {ON} similar t...   314   e-100
CAGL0E01397g Chr5 complement(129962..131689) [1728 bp, 575 aa] {...   314   e-100
TPHA0A01560 Chr1 complement(311613..313235) [1623 bp, 540 aa] {O...   310   4e-99
Skud_4.404 Chr4 (718381..719988) [1608 bp, 535 aa] {ON} YDR145W ...   309   9e-99
NDAI0J01020 Chr10 complement(231968..233884) [1917 bp, 638 aa] {...   306   2e-96
KLLA0D16368g Chr4 (1376929..1378464) [1536 bp, 511 aa] {ON} simi...   300   2e-95
TBLA0A03940 Chr1 (984062..986320) [2259 bp, 752 aa] {ON} Anc_8.3...   296   3e-91
TBLA0H01280 Chr8 complement(287810..289027) [1218 bp, 405 aa] {O...   162   3e-44
TBLA0E04490 Chr5 (1146095..1146526) [432 bp, 143 aa] {ON} Anc_4....    32   1.2  
Skud_13.426 Chr13 (751977..752540) [564 bp, 187 aa] {ON} YMR255W...    32   2.5  
NDAI0B04280 Chr2 (1074653..1076869) [2217 bp, 738 aa] {ON} Anc_2...    32   3.9  
Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON} (10036.....    32   4.8  
Skud_15.201 Chr15 (360205..361071) [867 bp, 288 aa] {ON} YOR036W...    31   5.8  
KLTH0D15554g Chr4 (1284597..1284968) [372 bp, 123 aa] {ON} simil...    30   7.1  
Kwal_47.17140 s47 complement(269893..270264) [372 bp, 123 aa] {O...    30   7.1  

>TDEL0F04490 Chr6 (841584..843116) [1533 bp, 510 aa] {ON} Anc_8.323
           YDR145W
          Length = 510

 Score =  857 bits (2214), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/510 (84%), Positives = 429/510 (84%)

Query: 1   MSYDGDTANSTAEGSASQGIGGQQRQLLELTTKFRALVNEAKSVGENTPRGKELLIKASK 60
           MSYDGDTANSTAEGSASQGIGGQQRQLLELTTKFRALVNEAKSVGENTPRGKELLIKASK
Sbjct: 1   MSYDGDTANSTAEGSASQGIGGQQRQLLELTTKFRALVNEAKSVGENTPRGKELLIKASK 60

Query: 61  IKAIYDNYNXXXXXXXXXFVQGRNGGTPGANPXXXXXXXXXXXXXXXXXXXXXXXXXXXX 120
           IKAIYDNYN         FVQGRNGGTPGANP                            
Sbjct: 61  IKAIYDNYNRQRQQAAQAFVQGRNGGTPGANPASSGSTGSVGAVNAAGSSSSGSSQQSRS 120

Query: 121 XXXQLANIIKQVLTPEQNQQFEALSQNFQARANSIRDKHTFLKQHIERLNQEVSKQTDAS 180
              QLANIIKQVLTPEQNQQFEALSQNFQARANSIRDKHTFLKQHIERLNQEVSKQTDAS
Sbjct: 121 SGSQLANIIKQVLTPEQNQQFEALSQNFQARANSIRDKHTFLKQHIERLNQEVSKQTDAS 180

Query: 181 AKKQLEEKKTELANNLKMLNMEYGALQQEFQNGKKKFYVECARHNPAXXXXXXXXXXXXX 240
           AKKQLEEKKTELANNLKMLNMEYGALQQEFQNGKKKFYVECARHNPA             
Sbjct: 181 AKKQLEEKKTELANNLKMLNMEYGALQQEFQNGKKKFYVECARHNPALQRLLQRSTQQQR 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXXXKAQQGTPANITTQKLPQQNQVRSQSTSSNTGS 300
                                       KAQQGTPANITTQKLPQQNQVRSQSTSSNTGS
Sbjct: 241 MAQQQQVQPSEGSPAGEAGSPGAAGNSAKAQQGTPANITTQKLPQQNQVRSQSTSSNTGS 300

Query: 301 RAQSQVTNVNAAASMAYNNGANKSAIFKQSDPLVPISETVTAKTPSPVTYKTNRPTLTGG 360
           RAQSQVTNVNAAASMAYNNGANKSAIFKQSDPLVPISETVTAKTPSPVTYKTNRPTLTGG
Sbjct: 301 RAQSQVTNVNAAASMAYNNGANKSAIFKQSDPLVPISETVTAKTPSPVTYKTNRPTLTGG 360

Query: 361 TAMNAAALNTPTMTKLPPYEVDTERVMSKRKLRELVKTVGIDEGDGETVIDGDVESLLLD 420
           TAMNAAALNTPTMTKLPPYEVDTERVMSKRKLRELVKTVGIDEGDGETVIDGDVESLLLD
Sbjct: 361 TAMNAAALNTPTMTKLPPYEVDTERVMSKRKLRELVKTVGIDEGDGETVIDGDVESLLLD 420

Query: 421 LADDFVSNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPKP 480
           LADDFVSNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPKP
Sbjct: 421 LADDFVSNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPKP 480

Query: 481 SYNQKMQAINSDKATSAKNASSGKSLSQSK 510
           SYNQKMQAINSDKATSAKNASSGKSLSQSK
Sbjct: 481 SYNQKMQAINSDKATSAKNASSGKSLSQSK 510

>KAFR0B05720 Chr2 (1180414..1181868) [1455 bp, 484 aa] {ON}
           Anc_8.323 YDR145W
          Length = 484

 Score =  501 bits (1289), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 270/488 (55%), Positives = 330/488 (67%), Gaps = 42/488 (8%)

Query: 12  AEGSASQGIGGQQRQLLELTTKFRALVNEAKSVGENTPRGKELLIKASKIKAIYDNYNXX 71
           ++ SA++GI   Q+QL+EL+ +F++LV EAK VGE TP GKEL+++ASK+KA+YDNYN  
Sbjct: 14  SDPSANRGIT-LQKQLMELSARFKSLVQEAKKVGETTPEGKELIMQASKLKALYDNYN-- 70

Query: 72  XXXXXXXFVQGRNGGTPGANPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLANIIKQ 131
                    + +      A                                 Q A +I+Q
Sbjct: 71  ---------KQKQEAMAQAQARNNNANTANVNSSSSANSTEANTSGRSGSSAQFATLIRQ 121

Query: 132 VLTPEQNQQFEALSQNFQARANSIRDKHTFLKQHIERLNQEVSKQTDASAKKQLEEKKTE 191
            LTPEQNQQ++ L QNFQ RAN+I+DKHTFLKQ+I+RL QE+ KQTDA+AKKQL+EK+ E
Sbjct: 122 ALTPEQNQQYDKLVQNFQTRANNIKDKHTFLKQNIDRLVQEIEKQTDAAAKKQLDEKRIE 181

Query: 192 LANNLKMLNMEYGALQQEFQNGKKKFYVECARHNPAXXXXXXXXXXXXXXXXXXXXXXXX 251
           L  NLK +++EY  LQQ++ NGKK FY+ECA+ NP                         
Sbjct: 182 LMTNLKAISVEYTNLQQQYNNGKKAFYIECAKKNP----------------------DLQ 219

Query: 252 XXXXXXXXXXXXXXXXXKAQQGTPANITTQKLPQQNQVRSQSTSSNTGS------RAQSQ 305
                             AQQ  P     Q  PQ  Q  + S SS+  +      R+QSQ
Sbjct: 220 RLLQKSTQRVQQQAASPNAQQQPPVKTEAQPQPQPQQQATPSQSSSNANLAASKPRSQSQ 279

Query: 306 VTNVNAAASMAYNNGANKSAIFKQSDPLVPISETVTAKTPSPVTYKTNRPTLTGGTAMNA 365
           +TNVNAAAS +  + +NKS IFKQSDP VPISE++++KTP PV Y+ NRPT++GG+AMNA
Sbjct: 280 ITNVNAAASNS--SSSNKSVIFKQSDPAVPISESISSKTPIPVPYRVNRPTISGGSAMNA 337

Query: 366 AALNTPTMTKLPPYEVDTERVMSKRKLRELVKTVGIDEGDGETVIDGDVESLLLDLADDF 425
           AALNTP MTKLPPYE+DTERVMSKRKLRELVKT+GIDEGDGETVIDGDVE LLLDLADDF
Sbjct: 338 AALNTPIMTKLPPYELDTERVMSKRKLRELVKTIGIDEGDGETVIDGDVEELLLDLADDF 397

Query: 426 VSNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPKPSYNQK 485
           V+NVT FAC+LAKHRKSDNL+T+DIQLHLERNWNIRIPGYSADEIRSTRKWNP  SYNQK
Sbjct: 398 VTNVTSFACKLAKHRKSDNLETKDIQLHLERNWNIRIPGYSADEIRSTRKWNPTQSYNQK 457

Query: 486 MQAINSDK 493
           +Q+IN DK
Sbjct: 458 LQSINIDK 465

>Smik_4.389 Chr4 (707521..709098) [1578 bp, 525 aa] {ON} YDR145W
           (REAL)
          Length = 525

 Score =  498 bits (1282), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 256/492 (52%), Positives = 317/492 (64%), Gaps = 5/492 (1%)

Query: 7   TANSTAEGSASQGIGGQQRQLLELTTKFRALVNEAKSVGENTPRGKELLIKASKIKAIYD 66
           T N++A  +A Q +  Q RQL E+T KF AL+ EA++VGE TPRGKEL+ +A+KIK +YD
Sbjct: 18  TGNASAATAAQQNMVLQPRQLQEMTAKFTALLTEARNVGETTPRGKELMFQAAKIKQVYD 77

Query: 67  --NYNXXXXXXXXXFVQGRNGGTPGANPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQ 124
               N         +     G T   +                                +
Sbjct: 78  ALTLNKRRQQAAQAYRNASMGNTNSNSNNPVTMSTEKTSNSSQQHQQQHQQQQTRNNSNK 137

Query: 125 LANIIKQVLTPEQNQQFEALSQNFQARANSIRDKHTFLKQHIERLNQEVSKQTDASAKKQ 184
            +++IKQVLTPE+NQ++E L QNFQAR  SI++K TFLKQ+I+RL QE++KQT+  AK+Q
Sbjct: 138 FSSMIKQVLTPEENQEYEKLWQNFQARHTSIKEKETFLKQNIDRLEQEINKQTEEGAKQQ 197

Query: 185 LEEKKTELANNLKMLNMEYGALQQEFQNGKKKFYVECARHNPAXXX--XXXXXXXXXXXX 242
           L+EKK EL N+ K+L +EY  L   +QN KK FYVECARHNPA                 
Sbjct: 198 LQEKKNELLNDWKVLKIEYTKLFNSYQNSKKTFYVECARHNPALHKFLQESTQQQRVQQQ 257

Query: 243 XXXXXXXXXXXXXXXXXXXXXXXXXXKAQQGTPANITTQKLPQQNQVRSQSTSSNTGSRA 302
                                           P       LP  N  R    +  T  ++
Sbjct: 258 RVQQQQHQGQTPTNTSTNSTEISSTTALDASKPQQQQQNTLPGTNTPRGNGNAPQT-EQS 316

Query: 303 QSQVTNVNAAASMAYNNGANKSAIFKQSDPLVPISETVTAKTPSPVTYKTNRPTLTGGTA 362
           +++VTNVNA ASM  N  ++KSAIFKQ++P +PISE ++AK P+PV Y++NRPT+TGG+A
Sbjct: 317 KAKVTNVNATASMMNNVSSSKSAIFKQTEPAIPISENISAKAPAPVAYRSNRPTITGGSA 376

Query: 363 MNAAALNTPTMTKLPPYEVDTERVMSKRKLRELVKTVGIDEGDGETVIDGDVESLLLDLA 422
           MNA+ALNTP  TKLPPYE+DT+RVMSKRKLRELVKTVGIDEGDGETVIDGDVE LLLDLA
Sbjct: 377 MNASALNTPAATKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIDGDVEELLLDLA 436

Query: 423 DDFVSNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPKPSY 482
           DDFV+NVT F+CRLAKHR+SDNL+ RDIQLHLERNWNIRIPGYSADEIRSTRKWNP  SY
Sbjct: 437 DDFVTNVTAFSCRLAKHRRSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSY 496

Query: 483 NQKMQAINSDKA 494
           NQK+Q+I SDK 
Sbjct: 497 NQKLQSITSDKV 508

>KLTH0G12298g Chr7 complement(1045663..1047165) [1503 bp, 500 aa]
           {ON} similar to uniprot|Q03761 Saccharomyces cerevisiae
           YDR145W
          Length = 500

 Score =  404 bits (1037), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 233/500 (46%), Positives = 290/500 (58%), Gaps = 31/500 (6%)

Query: 1   MSYDGDTANSTAEGSASQGIGGQQ---RQLLELTTKFRALVNEAKSVGENTPRGKELLIK 57
           MS + ++      G+  QG   Q+     L ++  KF    NEAK VG  TP+G+ELL +
Sbjct: 1   MSSNPNSGQPAQSGNNQQGTPAQRLTPESLQQMAYKFSQCFNEAKRVGLQTPQGQELLKQ 60

Query: 58  ASKIKAIYDNYNXXXXXXXXXFVQGRNGGTPGANPXXXXXXXXXXXXXXXXXXXXXXXXX 117
           AS+IKA+YD Y          F QG      G N                          
Sbjct: 61  ASRIKAMYDAY-RQRQQSAQGFEQGGATSNTGDN---------------TAGTPTNARSP 104

Query: 118 XXXXXXQLANIIKQVLTPEQNQQFEALSQNFQARANSIRDKHTFLKQHIERLNQEVSK-Q 176
                  +++ I+ +LTP+QN+ +  L Q        I+ ++T+LK+ IE L+ E+ K Q
Sbjct: 105 NGTPNNNMSSNIQNLLTPQQNEAYGRLIQTSNENGEKIKGEYTYLKKQIEILDGEIKKRQ 164

Query: 177 TDASAKKQLEEKKTELANNLKMLNMEYGALQQEFQNGKKKFYVECARHNPAXXXXXXXXX 236
            D +  KQLE  KTE+ N L+  +  Y AL Q+ +  KKKFY+ECA  NP          
Sbjct: 165 GDPATVKQLETNKTEILNKLRGFSASYLALNQKLREDKKKFYIECAATNPNLKRFLQAST 224

Query: 237 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAQQGTPANITTQKLPQQNQVRSQSTSS 296
                                             Q G P+ +      QQ         S
Sbjct: 225 QQQRANSTASQNASPLPAATGANQASSPIQ----QTGAPSQV------QQQTATPSQPRS 274

Query: 297 NTGSRAQSQVTNVNAAASMAYN-NGANKSAIFKQSDPLVPISETVTAKTPSPVTYKTNRP 355
              SR+ +QVT+VNAAA +A N   A + AIFKQ +P VP+SET+T + P+PV +++NRP
Sbjct: 275 GVNSRSPTQVTSVNAAAHLANNATSAARQAIFKQPNPSVPVSETITQRMPTPVVHRSNRP 334

Query: 356 TLTGGTAMNAAALNTPTMTKLPPYEVDTERVMSKRKLRELVKTVGIDEGDGETVIDGDVE 415
           T+TGG+AMNAAAL TP MTKLPPYEVD ERVMSKRKLRELVK+VGIDEGDGET IDGDVE
Sbjct: 335 TITGGSAMNAAALTTPVMTKLPPYEVDNERVMSKRKLRELVKSVGIDEGDGETTIDGDVE 394

Query: 416 SLLLDLADDFVSNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYSADEIRSTRK 475
            LLLDLADDF++NVT FACRLAKHRKSDNLD RDIQLHLERNWNIRIPGY+ADE+RSTRK
Sbjct: 395 ELLLDLADDFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRK 454

Query: 476 WNPKPSYNQKMQAINSDKAT 495
           WNP  SYNQK+Q INS K T
Sbjct: 455 WNPTTSYNQKLQGINSAKVT 474

>KNAG0I00890 Chr9 complement(166573..168099) [1527 bp, 508 aa] {ON}
           Anc_8.323 YDR145W
          Length = 508

 Score =  395 bits (1016), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 225/505 (44%), Positives = 299/505 (59%), Gaps = 26/505 (5%)

Query: 7   TANSTAEGSASQGIGGQQRQLLELTTKFRALVNEAKSVGENTPRGKELLIKASKIKAIYD 66
           T  S A GSAS      Q+QL+EL  +F+  V EAK VGE T  GK+LL++A+KIKA+YD
Sbjct: 14  TPASPAAGSASTP----QQQLVELAQRFKLFVGEAKRVGETTEAGKQLLVRAAKIKAVYD 69

Query: 67  NYNXXXXXXXXXFVQGRNGGTPGANPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLA 126
           +             Q    G  G                                  QLA
Sbjct: 70  SVRGASAGAAAQSQQRTADGATG-------------NVATAPAAAGGGGGAGNTAATQLA 116

Query: 127 NIIKQVLTPEQNQQFEALSQNFQARANSIRDKHTFLKQHIERLNQEVSKQTDASAKKQLE 186
             ++Q LTPEQ QQ++ ++ NFQ +A SIRDKH +LKQ+I++L  E++KQ D SAK+QL 
Sbjct: 117 MAMRQALTPEQVQQYDKIATNFQNKAKSIRDKHNYLKQNIDKLTAEINKQQDRSAKQQLA 176

Query: 187 EKKTELANNLKMLNMEYGALQQEFQNGKKKFYVECARHNPA-------XXXXXXXXXXXX 239
           EK+ EL  +++ L +E+ +L+  FQ  +K FYVECA+ NP                    
Sbjct: 177 EKRNELLRSVRQLTVEHNSLKVNFQLSRKNFYVECAKLNPKLQQILQRTAQQAQSSQQAQ 236

Query: 240 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAQQGTPANITTQKLPQ-QNQVRSQSTSSNT 298
                                        +AQ   P + +  +LPQ Q   R+QS S+++
Sbjct: 237 VQAQAQAQAQSQSPAAQSQSQSQPPVVPQQAQTPVPQSQSQTQLPQSQPPQRTQSNSNSS 296

Query: 299 GSRAQSQVTNVNAAASMAYNNGANKSAIFKQSDPLVPISETVTAKTPSPVTYKTNRPTLT 358
           G+ +       +A  ++  N+ A K  IFK+S+P VPI E++    P+ V YK NRPT+T
Sbjct: 297 GNNSNVTGHPPSATPTVPANHPA-KHKIFKESEPSVPIPESIDTVQPAQVAYKVNRPTIT 355

Query: 359 GGTAMNAAALNTPTMTKLPPYEVDTERVMSKRKLRELVKTVGIDEGDGETVIDGDVESLL 418
           GG+ MNA ALNTP   K+P YE DT+RV+SKRKLRELV+TVG+DEGDGETV+DGDVE LL
Sbjct: 356 GGSGMNAPALNTPVNVKIPVYEADTDRVLSKRKLRELVRTVGVDEGDGETVMDGDVEQLL 415

Query: 419 LDLADDFVSNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYSADEIRSTRKWNP 478
           LDLADDFVS+VT FACRLAKHR SD+L+ RD+QLHLERNWNIR+PGY+ DEIRSTRKWN 
Sbjct: 416 LDLADDFVSDVTAFACRLAKHRGSDSLEARDVQLHLERNWNIRLPGYATDEIRSTRKWNG 475

Query: 479 KPSYNQKMQAINSDKATSAKNASSG 503
             +Y+QK+ AI  D+  +A +A+ G
Sbjct: 476 TSAYHQKLNAIAQDRTAAAGSATGG 500

>AGL195C Chr7 complement(331850..333514) [1665 bp, 554 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR145W
           (TAF12)
          Length = 554

 Score =  389 bits (1000), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 217/469 (46%), Positives = 277/469 (59%), Gaps = 23/469 (4%)

Query: 27  LLELTTKFRALVNEAKSVGENTPRGKELLIKASKIKAIYDNYNXXXXXXXXXFVQGRNGG 86
           + +L  KFR LV+EA+ VG  TP G ELL KAS IKAIY+ Y+           Q RN  
Sbjct: 80  MRQLAYKFRTLVSEAQQVGVRTPEGLELLKKASNIKAIYETYHRQQAQQA---FQVRNPA 136

Query: 87  TPGANPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLANIIKQVLTPEQNQQFEALSQ 146
             G                                   +A+ IK +LTP+Q + +E L+Q
Sbjct: 137 PAG-----------------QLAAAGTGQATAPRPTSSVASNIKMLLTPQQREAYEKLTQ 179

Query: 147 NFQARANSIRDKHTFLKQHIERLNQEV-SKQTDASAKKQLEEKKTELANNLKMLNMEYGA 205
            F     +I  ++ FLK++IE L+ E+ ++Q +    KQLE KK EL   L  LN ++ A
Sbjct: 180 TFNESVKNITGEYEFLKKNIEVLDTEIKNRQGEPMTVKQLETKKNELLTKLTGLNTQFQA 239

Query: 206 LQQEFQNGKKKFYVECARHNPAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 265
           L ++FQ  KKKFY+ECA  N                                        
Sbjct: 240 LPKKFQEDKKKFYIECAATNVNLKKFLQATSQQQRASAGNTGTTNSPANTQLGANIGAAS 299

Query: 266 XXXKAQQGTPANITTQKLPQQNQVRSQSTSSNTGSRAQSQVTNVNAAASMAYNNGANKSA 325
               A        ++   PQ  + + Q  +S   +R  +QVT VNAAA+   N+G  +  
Sbjct: 300 AATPAAANAAPTGSSAATPQSQRQQMQRPNSG-ANRYPAQVTPVNAAANQN-NSGTARPV 357

Query: 326 IFKQSDPLVPISETVTAKTPSPVTYKTNRPTLTGGTAMNAAALNTPTMTKLPPYEVDTER 385
           IFKQ +P +PI E +T  T + V+Y++NRPT+T G+AMNA+AL  P MTKLPPYEVD+ER
Sbjct: 358 IFKQPNPSIPIPENITPLTTTSVSYRSNRPTITSGSAMNASALTMPVMTKLPPYEVDSER 417

Query: 386 VMSKRKLRELVKTVGIDEGDGETVIDGDVESLLLDLADDFVSNVTGFACRLAKHRKSDNL 445
           VMSKRKLRELVKTVGID+GDGET +DGDVE LLLDLADDF++NVT FACRLAKHRKSDNL
Sbjct: 418 VMSKRKLRELVKTVGIDDGDGETTVDGDVEELLLDLADDFITNVTSFACRLAKHRKSDNL 477

Query: 446 DTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPKPSYNQKMQAINSDKA 494
           D RDIQLHLERNWNIRIPGY+ADEIRST+KWNP P+Y+QK+Q I+S +A
Sbjct: 478 DVRDIQLHLERNWNIRIPGYAADEIRSTKKWNPTPAYSQKLQGISSARA 526

>Kwal_56.23916 s56 (774901..776400) [1500 bp, 499 aa] {ON} YDR145W
           (TAF12) - TFIID subunit [contig 171] FULL
          Length = 499

 Score =  387 bits (995), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 230/490 (46%), Positives = 287/490 (58%), Gaps = 30/490 (6%)

Query: 8   ANSTAEGSASQGIGGQQRQLLELTTKFRALVNEAKSVGENTPRGKELLIKASKIKAIYDN 67
            N+  +GS +Q    +  Q  ++  KF    NEAK +G  TP+G+ELL +AS IKA+YD 
Sbjct: 13  GNNNVQGSPAQRFTPESMQ--QMAYKFTQCFNEAKRIGLQTPQGQELLKQASHIKAVYDA 70

Query: 68  YNXXXXXXXXXFVQGRNGGTPGANPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLAN 127
           Y            QG +   PGA                                  +++
Sbjct: 71  YRQRQQA-----AQGFDQNAPGA-----------SSAGSTSGSPATARAPNGTATNTISS 114

Query: 128 IIKQVLTPEQNQQFEALSQNFQARANSIRDKHTFLKQHIERLNQEVSK-QTDASAKKQLE 186
            I+ +LTP+QN+ +  L Q+       I+ ++T+LK+ IE L+ E+ K + D +  KQLE
Sbjct: 115 NIQNLLTPQQNEAYGRLIQSSNENGEKIKGEYTYLKRQIEILDGEIKKREGDPATVKQLE 174

Query: 187 EKKTELANNLKMLNMEYGALQQEFQNGKKKFYVECARHNPAXXXXXXXXXXXXXXXXXXX 246
             K E+ N LK  +  Y AL Q+ +  KKKFY+ECA  NP                    
Sbjct: 175 ANKAEILNKLKGFSASYVALNQKLREDKKKFYIECAATNP-----NLKRFLQASTQQQRA 229

Query: 247 XXXXXXXXXXXXXXXXXXXXXXKAQQGTPANITTQKLPQQNQVRSQSTSSNTGSRAQSQV 306
                                  AQQ        Q  P QN    Q T S   SR+ +QV
Sbjct: 230 NSATSQNASPLPTNSNGNQTSSPAQQ----QAAVQVPPPQNGTPGQ-TRSAASSRSPTQV 284

Query: 307 TNVNAAASMAYN-NGANKSAIFKQSDPLVPISETVTAKTPSPVTYKTNRPTLTGGTAMNA 365
           T+VNAAA +A N   A + AIFKQ +P VP+SET+T K P+ +  ++NRPT+TGG+AMNA
Sbjct: 285 TSVNAAAHLANNATSAARRAIFKQPNPSVPVSETITQKMPTLMVNRSNRPTITGGSAMNA 344

Query: 366 AALNTPTMTKLPPYEVDTERVMSKRKLRELVKTVGIDEGDGETVIDGDVESLLLDLADDF 425
           AAL TP MTKLPPYEVD ERVMSKRKLRELVK+VGIDEGDGET IDGDVE LLLDLADDF
Sbjct: 345 AALTTPVMTKLPPYEVDNERVMSKRKLRELVKSVGIDEGDGETTIDGDVEELLLDLADDF 404

Query: 426 VSNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPKPSYNQK 485
           ++NVT FACRLAKHRKSDNLD RDIQLHLERNWNIRIPGY+ADE+RSTRKWNP  SYNQK
Sbjct: 405 ITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTASYNQK 464

Query: 486 MQAINSDKAT 495
           +Q INS + +
Sbjct: 465 LQGINSARVS 474

>ZYRO0F10384g Chr6 (841520..843196) [1677 bp, 558 aa] {ON} some
           similarities with uniprot|Q03761 Saccharomyces
           cerevisiae YDR145W
          Length = 558

 Score =  368 bits (944), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 196/241 (81%), Positives = 211/241 (87%), Gaps = 8/241 (3%)

Query: 275 PANITTQKLPQQNQVRSQSTSSNTGSRAQSQVTNVNAAASMAYNNGANKSAIFKQSDPLV 334
           P +ITTQKLPQQ Q RSQ +SS+     +SQVTNVNA ASMA NN ANKSAIFKQSDPLV
Sbjct: 321 PTSITTQKLPQQTQPRSQPSSSSVN---KSQVTNVNATASMANNNAANKSAIFKQSDPLV 377

Query: 335 PISETVTAKTPSPVTYKTNRPTLTGGTAMNAAALNTPTMTKLPPYEVDTERVMSKRKLRE 394
           PISE VT K PSPV YK+NRPTLTGG AMNA+ LNTP +TKLPPYEVDTERVMSKRKLRE
Sbjct: 378 PISENVTVKAPSPVAYKSNRPTLTGGAAMNASPLNTPAITKLPPYEVDTERVMSKRKLRE 437

Query: 395 LVKTVGIDEGDGETVIDGDVESLLLDLADDFVSNVTGFACRLAKHRKSDNLDTRDIQLHL 454
           LVKTVGID+GDGETVIDGDVE LLLDLADDFV+NVTGFACRLAKHRKSDNLDTRDIQLHL
Sbjct: 438 LVKTVGIDDGDGETVIDGDVEELLLDLADDFVTNVTGFACRLAKHRKSDNLDTRDIQLHL 497

Query: 455 ERNWNIRIPGYSADEIRSTRKWNPKPSYNQKMQAINSDKATSAKNA-----SSGKSLSQS 509
           ERNWNIRIPGYSADEIRSTRKWNP  SYNQKMQ+IN+DK  +A+N+     +S KSLSQS
Sbjct: 498 ERNWNIRIPGYSADEIRSTRKWNPSQSYNQKMQSINTDKTNTARNSAAVGGASNKSLSQS 557

Query: 510 K 510
           K
Sbjct: 558 K 558

 Score =  216 bits (551), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 118/212 (55%), Positives = 139/212 (65%), Gaps = 2/212 (0%)

Query: 18  QGIGGQQRQLLELTTKFRALVNEAKSVGENTPRGKELLIKASKIKAIYDNYNXXXXXXXX 77
           QG   Q RQLLEL TKF+ LV E+K+VGENT RGKELL++ASKIKA+Y NY+        
Sbjct: 30  QGALLQHRQLLELRTKFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNYSRQRQQAAQ 89

Query: 78  XFVQGRNGGTPGANPXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXQLANIIKQVLTP 135
            + Q RNG   G +                                  QLANIIKQVLTP
Sbjct: 90  AYEQARNGAAAGGSTPQSAGSGVSTVPAGSQSTGGSSSSGGQSTGGGSQLANIIKQVLTP 149

Query: 136 EQNQQFEALSQNFQARANSIRDKHTFLKQHIERLNQEVSKQTDASAKKQLEEKKTELANN 195
           EQNQQ++ L Q FQ R N+IRDKH FL+QH+E LNQE++K+T+ +AKKQLE+KK EL  N
Sbjct: 150 EQNQQYDNLLQTFQTRTNNIRDKHNFLEQHLEGLNQEINKKTEPAAKKQLEDKKMELLTN 209

Query: 196 LKMLNMEYGALQQEFQNGKKKFYVECARHNPA 227
           LK LNMEY  L+QEF NGKKKFYVECARHNPA
Sbjct: 210 LKSLNMEYSVLRQEFTNGKKKFYVECARHNPA 241

>YDR145W Chr4 (746738..748357) [1620 bp, 539 aa] {ON}  TAF12Subunit
           (61/68 kDa) of TFIID and SAGA complexes, involved in RNA
           polymerase II transcription initiation and in chromatin
           modification, similar to histone H2A
          Length = 539

 Score =  343 bits (879), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 163/231 (70%), Positives = 191/231 (82%), Gaps = 6/231 (2%)

Query: 269 KAQQGTPANITTQKLPQQNQVRSQSTSSNTGSRAQSQVTNVNAAASMAYNNGANKSAIFK 328
           K+QQ     IT    P+ N   SQ+  S      +++VTNVNA ASM  N  ++KSAIFK
Sbjct: 303 KSQQQQQNTITATNNPRGNVNTSQTEQS------KAKVTNVNATASMLNNISSSKSAIFK 356

Query: 329 QSDPLVPISETVTAKTPSPVTYKTNRPTLTGGTAMNAAALNTPTMTKLPPYEVDTERVMS 388
           Q++P +PISE ++ KTP+PV Y++NRPT+TGG+AMNA+ALNTP  TKLPPYE+DT+RVMS
Sbjct: 357 QTEPAIPISENISTKTPAPVAYRSNRPTITGGSAMNASALNTPATTKLPPYEMDTQRVMS 416

Query: 389 KRKLRELVKTVGIDEGDGETVIDGDVESLLLDLADDFVSNVTGFACRLAKHRKSDNLDTR 448
           KRKLRELVKTVGIDEGDGETVIDGDVE LLLDLADDFV+NVT F+CRLAKHRKSDNL+ R
Sbjct: 417 KRKLRELVKTVGIDEGDGETVIDGDVEELLLDLADDFVTNVTAFSCRLAKHRKSDNLEAR 476

Query: 449 DIQLHLERNWNIRIPGYSADEIRSTRKWNPKPSYNQKMQAINSDKATSAKN 499
           DIQLHLERNWNIRIPGYSADEIRSTRKWNP  +YNQK+Q+I SDK  +AKN
Sbjct: 477 DIQLHLERNWNIRIPGYSADEIRSTRKWNPSQNYNQKLQSITSDKVAAAKN 527

 Score =  139 bits (349), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 63/104 (60%), Positives = 82/104 (78%)

Query: 124 QLANIIKQVLTPEQNQQFEALSQNFQARANSIRDKHTFLKQHIERLNQEVSKQTDASAKK 183
           + +N+IKQVLTPE+NQ++E L QNFQ R  SI++K T+LKQ+I+RL QE++KQTD   K+
Sbjct: 131 KFSNMIKQVLTPEENQEYEKLWQNFQVRHTSIKEKETYLKQNIDRLEQEINKQTDEGPKQ 190

Query: 184 QLEEKKTELANNLKMLNMEYGALQQEFQNGKKKFYVECARHNPA 227
           QL+EKK EL N+ K+L +EY  L   +QN KK FYVECARHNPA
Sbjct: 191 QLQEKKIELLNDWKVLKIEYTKLFNNYQNSKKTFYVECARHNPA 234

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 29/51 (56%), Positives = 38/51 (74%)

Query: 16 ASQGIGGQQRQLLELTTKFRALVNEAKSVGENTPRGKELLIKASKIKAIYD 66
          A Q +  Q RQL E+  KFR L+ EA++VGE TPRGKEL+ +A+KIK +YD
Sbjct: 27 AQQNMVLQPRQLQEMAAKFRTLLTEARNVGETTPRGKELMFQAAKIKQVYD 77

>Kpol_543.63 s543 (145534..147291) [1758 bp, 585 aa] {ON}
           (145534..147291) [1758 nt, 586 aa]
          Length = 585

 Score =  342 bits (877), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 163/224 (72%), Positives = 190/224 (84%), Gaps = 5/224 (2%)

Query: 282 KLPQQ---NQVRSQSTSSNTGSRAQSQVTNVNAAASMAYNNGANKSAIFKQSDPLVPISE 338
           +LPQ+     ++SQ  S+ + +R  SQVTNVNA AS A  N  +KSAIFKQSDP VPISE
Sbjct: 352 QLPQEQGTGSIQSQPNSATSANR--SQVTNVNATASSANKNIQSKSAIFKQSDPSVPISE 409

Query: 339 TVTAKTPSPVTYKTNRPTLTGGTAMNAAALNTPTMTKLPPYEVDTERVMSKRKLRELVKT 398
           ++T K P  V+Y +NRP+LTGGTAMNA+ LNTPT+TKLPPYE+DTERVMSKRKLREL+K+
Sbjct: 410 SITVKAPEAVSYISNRPSLTGGTAMNASVLNTPTITKLPPYEIDTERVMSKRKLRELIKS 469

Query: 399 VGIDEGDGETVIDGDVESLLLDLADDFVSNVTGFACRLAKHRKSDNLDTRDIQLHLERNW 458
           VGIDEGDGETVIDGDVE LLLDLADDFV+NVT FACRLAKHRKSD+L+ RDIQLHLERNW
Sbjct: 470 VGIDEGDGETVIDGDVEELLLDLADDFVTNVTSFACRLAKHRKSDSLEARDIQLHLERNW 529

Query: 459 NIRIPGYSADEIRSTRKWNPKPSYNQKMQAINSDKATSAKNASS 502
           NIRIPGYS DEIRSTRKW P  SY+QKMQ+IN++K+  AKN+ S
Sbjct: 530 NIRIPGYSGDEIRSTRKWIPTQSYSQKMQSINNEKSNIAKNSGS 573

 Score =  190 bits (483), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 113/232 (48%), Positives = 144/232 (62%), Gaps = 6/232 (2%)

Query: 1   MSYDGDTANSTAEGSASQGIGGQQRQLLELTTKFRALVNEAKSVGENTPRGKELLIKASK 60
           MS  GD    ++  S+ Q +  QQ+QLLELTTKF+ LVNEAK VG+NT RGKELLI+AS 
Sbjct: 1   MSSQGDGQTPSSASSSQQKLALQQKQLLELTTKFKELVNEAKRVGQNTQRGKELLIQASN 60

Query: 61  IKAIYDNYNXXXXXXXXXFVQGRNG------GTPGANPXXXXXXXXXXXXXXXXXXXXXX 114
           +KA+YDNYN           Q + G      GT                           
Sbjct: 61  LKAVYDNYNKQRQALINQQQQQQAGSSQTPAGTTNNADAASSSSAPAAAGASGANGTRKT 120

Query: 115 XXXXXXXXXQLANIIKQVLTPEQNQQFEALSQNFQARANSIRDKHTFLKQHIERLNQEVS 174
                    QLA++IKQVLTPE+NQQ++ L QNFQ+RA+SI+D+HTFLKQHI+RL+QE++
Sbjct: 121 AVANASGGSQLADLIKQVLTPEENQQYDKLLQNFQSRASSIKDQHTFLKQHIDRLSQEIN 180

Query: 175 KQTDASAKKQLEEKKTELANNLKMLNMEYGALQQEFQNGKKKFYVECARHNP 226
           +QTD +AKKQLE  + EL  NL+ LN EY  L ++ +N KK FYVECAR NP
Sbjct: 181 QQTDEAAKKQLEVNRAELLTNLRTLNTEYSNLYEDIKNKKKAFYVECARQNP 232

>Suva_2.306 Chr2 (542035..542808,542959..543810) [1626 bp, 541 aa]
           {ON} YDR145W (REAL)
          Length = 541

 Score =  333 bits (855), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 163/222 (73%), Positives = 187/222 (84%), Gaps = 1/222 (0%)

Query: 283 LPQQNQVRSQSTSSNTG-SRAQSQVTNVNAAASMAYNNGANKSAIFKQSDPLVPISETVT 341
           +P  N  R+   +  T  S+ +SQVTNVNA ASM  N  ++KSAIFKQ++P +PISE ++
Sbjct: 312 IPSANTPRANVKAPQTDQSKTKSQVTNVNATASMMSNASSSKSAIFKQTEPAIPISENIS 371

Query: 342 AKTPSPVTYKTNRPTLTGGTAMNAAALNTPTMTKLPPYEVDTERVMSKRKLRELVKTVGI 401
            K P+PV Y++NRPT+TGG+AMNA ALNTP  TKLPPYE+DT+RVMSKRKLRELVKTVGI
Sbjct: 372 TKAPAPVPYRSNRPTITGGSAMNATALNTPVTTKLPPYEMDTQRVMSKRKLRELVKTVGI 431

Query: 402 DEGDGETVIDGDVESLLLDLADDFVSNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIR 461
           DEGDGETVIDGDVE LLLDLADDFV+NVT FACRLAKHRKSDNL+ RDIQLHLERNWNIR
Sbjct: 432 DEGDGETVIDGDVEELLLDLADDFVTNVTAFACRLAKHRKSDNLEARDIQLHLERNWNIR 491

Query: 462 IPGYSADEIRSTRKWNPKPSYNQKMQAINSDKATSAKNASSG 503
           IPGYSADEIRSTRKWNP  SYNQK+Q INSDK  +AKN +S 
Sbjct: 492 IPGYSADEIRSTRKWNPSQSYNQKLQNINSDKVATAKNNNSS 533

 Score =  197 bits (500), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 106/212 (50%), Positives = 136/212 (64%), Gaps = 8/212 (3%)

Query: 18  QGIGGQQRQLLELTTKFRALVNEAKSVGENTPRGKELLIKASKIKAIYDNYNXXXXXXXX 77
           Q +  QQ+QLLE+T KF+ALV+EA++VGE TPRGKEL+ +A+KIK++YD +N        
Sbjct: 29  QNMMLQQKQLLEMTVKFKALVSEARNVGETTPRGKELMFQAAKIKSVYDAFNRRRQQAAQ 88

Query: 78  XFVQGRNGGT-PGA-NPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLANIIKQVLTP 135
            +     G T P A NP                               + +N+IKQVLT 
Sbjct: 89  AYKNASVGNTTPNAGNPVSLPTEKPPSLSQQQQQQQARSNSN------KFSNMIKQVLTS 142

Query: 136 EQNQQFEALSQNFQARANSIRDKHTFLKQHIERLNQEVSKQTDASAKKQLEEKKTELANN 195
           E+NQQ+E L QNFQ RA S+++K TFLKQ+I+RL QEV+KQTD + KKQLE+KK EL NN
Sbjct: 143 EENQQYEKLWQNFQVRATSMKEKDTFLKQNIDRLVQEVNKQTDEATKKQLEDKKNELLNN 202

Query: 196 LKMLNMEYGALQQEFQNGKKKFYVECARHNPA 227
            K+L +EY  L + FQN KK FYVECARHNPA
Sbjct: 203 RKVLGIEYNNLLKGFQNSKKTFYVECARHNPA 234

>NCAS0B03570 Chr2 (633284..634843) [1560 bp, 519 aa] {ON} Anc_8.323
           YDR145W
          Length = 519

 Score =  320 bits (820), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 152/207 (73%), Positives = 182/207 (87%), Gaps = 4/207 (1%)

Query: 303 QSQVTNVNAAASMAYNNGANKSAIFKQSDPLVPISETVTAKTPSPVTYKTNRPTLTGGTA 362
           +SQVTNVNAAASM+ ++ ++K  IFKQSDP+VP+S+T++ K P  V Y++NRPT+TGG+A
Sbjct: 312 KSQVTNVNAAASMSDSSNSSKQTIFKQSDPMVPVSDTISTKQPIAVPYRSNRPTMTGGSA 371

Query: 363 MNAAALNTPTMTKLPPYEVDTERVMSKRKLRELVKTVGIDEGDGETVIDGDVESLLLDLA 422
           M+A+ALNTP MTKLPPYE+DTERVMSKRKLRELVK++GIDEGDGETVIDGDVE LLLD+A
Sbjct: 372 MSASALNTPVMTKLPPYELDTERVMSKRKLRELVKSIGIDEGDGETVIDGDVEELLLDMA 431

Query: 423 DDFVSNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPKPSY 482
           DDF++NVT FACRLAKHRKSDNL+ RDIQLHLERNW+IRIPGYSADEIRS RKWNP  +Y
Sbjct: 432 DDFITNVTSFACRLAKHRKSDNLEARDIQLHLERNWDIRIPGYSADEIRSIRKWNPAQTY 491

Query: 483 NQKMQAINSDKATSAKNASSGKSLSQS 509
           NQK+Q IN+DK     NA+SG S + S
Sbjct: 492 NQKLQQINNDK----NNAASGNSTTAS 514

 Score =  189 bits (481), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 130/210 (61%), Gaps = 4/210 (1%)

Query: 18  QGIGGQQRQLLELTTKFRALVNEAKSVGENTPRGKELLIKASKIKAIYDNYNXXXXXXXX 77
           + I  Q  Q+ ELT KF+ALVNEAK VGENT RGKELLI+ASK+KA+YDNYN        
Sbjct: 17  RNIILQPNQIRELTAKFKALVNEAKEVGENTQRGKELLIQASKLKAMYDNYNRQRQQQLQ 76

Query: 78  XFVQGRNGGTPGANPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLANIIKQVLTPEQ 137
                 N      NP                               QLANI++QVLT EQ
Sbjct: 77  QQQAVNNKV---QNPSNNDNVTTNNSFASPSSPPTSGSTISNSSSTQLANIMRQVLTDEQ 133

Query: 138 NQQFEALSQNFQARANSIRDKHTFLKQHIERLNQEVSKQTD-ASAKKQLEEKKTELANNL 196
           N  F+ L Q F++RA++++DKHTFLKQ+IERL QE++KQ D  +A+KQLEEK+ EL  NL
Sbjct: 134 NANFDKLDQTFRSRASALKDKHTFLKQNIERLTQEINKQADNVNARKQLEEKRGELLRNL 193

Query: 197 KMLNMEYGALQQEFQNGKKKFYVECARHNP 226
           K + ME+  L Q++QNGKK FY+ECA+ NP
Sbjct: 194 KAITMEHNTLYQKYQNGKKAFYIECAKTNP 223

>SAKL0H15554g Chr8 complement(1354739..1356349) [1611 bp, 536 aa]
           {ON} some similarities with uniprot|Q03761 Saccharomyces
           cerevisiae YDR145W
          Length = 536

 Score =  316 bits (809), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 156/211 (73%), Positives = 179/211 (84%), Gaps = 1/211 (0%)

Query: 285 QQNQVRSQSTSSNTGSRAQSQVTNVNAAASMAYNNGAN-KSAIFKQSDPLVPISETVTAK 343
           QQ Q +    +S + SR+ +QVT+VNAAA +A NN A  + AIFKQ +P +P+SE VT K
Sbjct: 286 QQQQKKPTQGNSTSTSRSPTQVTSVNAAALLANNNTAAARQAIFKQPNPSLPVSENVTPK 345

Query: 344 TPSPVTYKTNRPTLTGGTAMNAAALNTPTMTKLPPYEVDTERVMSKRKLRELVKTVGIDE 403
            P+ V Y++NRPT+TGG+AMNAAALNTP MTKLPPYEVD+ERVMSKRKLRELVK+VG+DE
Sbjct: 346 NPTAVAYRSNRPTITGGSAMNAAALNTPVMTKLPPYEVDSERVMSKRKLRELVKSVGVDE 405

Query: 404 GDGETVIDGDVESLLLDLADDFVSNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIP 463
           GDGET IDGDVE LLLDLADDF+SNVTGFACRLAKHRKSDNLD RDIQLHLERNWNIRIP
Sbjct: 406 GDGETTIDGDVEELLLDLADDFISNVTGFACRLAKHRKSDNLDVRDIQLHLERNWNIRIP 465

Query: 464 GYSADEIRSTRKWNPKPSYNQKMQAINSDKA 494
           GYSADEIRSTRKWN   +Y QK+Q IN+ KA
Sbjct: 466 GYSADEIRSTRKWNSTTNYTQKLQGINAAKA 496

 Score =  104 bits (259), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 99/199 (49%), Gaps = 13/199 (6%)

Query: 29  ELTTKFRALVNEAKSVGENTPRGKELLIKASKIKAIYDNYNXXXXXXXXXFVQGRNGGTP 88
           +L  +F AL  EA  +G NT  G+ELL +A+KIKAIYD YN         F Q  N    
Sbjct: 32  QLALRFTALFKEATRIGVNTSEGEELLKQAAKIKAIYDAYNKQKQQAAQAFGQTNN---- 87

Query: 89  GANPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLANIIKQVLTPEQNQQFEALSQNF 148
                                                ++ I+ +LTPEQ++ +  L++ F
Sbjct: 88  --------RPPAPAAGNPPQVAQNTQQRQNSNSANNPSSNIRTLLTPEQSEAYNKLTKTF 139

Query: 149 QARANSIRDKHTFLKQHIERLNQEV-SKQTDASAKKQLEEKKTELANNLKMLNMEYGALQ 207
              A +IR +  +L+++IE L+ E+ +++++  A ++LE  K EL   L+ L+  + AL 
Sbjct: 140 GDSAKNIRGESEYLRKNIEVLDTEIKNRESEPLAVERLESTKAELVTKLRGLDASFQALP 199

Query: 208 QEFQNGKKKFYVECARHNP 226
           Q+F   KKKFY+ECA  NP
Sbjct: 200 QKFHEAKKKFYIECAASNP 218

>Ecym_4254 Chr4 (527580..529169) [1590 bp, 529 aa] {ON} similar to
           Ashbya gossypii AGL195C
          Length = 529

 Score =  314 bits (804), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 147/200 (73%), Positives = 171/200 (85%), Gaps = 2/200 (1%)

Query: 296 SNTG-SRAQSQVTNVNAAASMAYNNGANKSAIFKQSDPLVPISETVTAKTPSPVTYKTNR 354
           SN+G SR+ +QVT VNAAA+   +NGA +  IFKQ +P +PI E+V+  + + V+Y++NR
Sbjct: 299 SNSGISRSPTQVTPVNAAANQ-NSNGAARPVIFKQPNPSIPIPESVSPISTTSVSYRSNR 357

Query: 355 PTLTGGTAMNAAALNTPTMTKLPPYEVDTERVMSKRKLRELVKTVGIDEGDGETVIDGDV 414
           PT+TGG+AMNAAAL TP MTKLPPYEVD+ERVMSKRKLRELVK+VGID+GDGET IDGDV
Sbjct: 358 PTITGGSAMNAAALTTPVMTKLPPYEVDSERVMSKRKLRELVKSVGIDDGDGETTIDGDV 417

Query: 415 ESLLLDLADDFVSNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYSADEIRSTR 474
           E LLLDLADDF++NVT FACRLAKHRKSDNLD RDIQLHLERNWNIR PGYSADEIRST+
Sbjct: 418 EELLLDLADDFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRTPGYSADEIRSTK 477

Query: 475 KWNPKPSYNQKMQAINSDKA 494
           KWN  P+Y QKMQ I S KA
Sbjct: 478 KWNSTPAYGQKMQVITSAKA 497

 Score =  111 bits (278), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 74/212 (34%), Positives = 105/212 (49%), Gaps = 14/212 (6%)

Query: 27  LLELTTKFRALVNEAKSVGENTPRGKELLIKASKIKAIYDNYNXXXXXXXXXFVQGRNGG 86
           L +L  KF  LV+EA+ VG  TP G ELL KASK+KAIY+ YN         F + RN  
Sbjct: 20  LQQLAYKFTTLVDEAQRVGVQTPEGLELLKKASKVKAIYETYNRQRQQAQQAF-RVRNTA 78

Query: 87  TPGANPXXXXXXXXXXXXXXXXXXXXXXXXXXXXX------------XXQLANIIKQVLT 134
             GA P                                            +A+ IK +L 
Sbjct: 79  QTGAQPQQQLPAGQPQPQQQQQQQPPPQPQPQQPQQPQQQQLKQQRPASSVASNIKMLLN 138

Query: 135 PEQNQQFEALSQNFQARANSIRDKHTFLKQHIERLNQEV-SKQTDASAKKQLEEKKTELA 193
           P+Q + +E L+Q F   A +I+ ++ FLK++IE L+ E+ ++Q++    +QLE KK EL 
Sbjct: 139 PQQREAYERLTQTFNESAKNIKGEYEFLKKNIEVLDTEIKNRQSEPITVRQLESKKNELL 198

Query: 194 NNLKMLNMEYGALQQEFQNGKKKFYVECARHN 225
             L  LN ++  L ++FQ  KKKFY+ECA  N
Sbjct: 199 MKLTSLNTQFQTLPKKFQEDKKKFYIECAATN 230

>CAGL0E01397g Chr5 complement(129962..131689) [1728 bp, 575 aa] {ON}
           similar to uniprot|Q03761 Saccharomyces cerevisiae
           YDR145w TAF61
          Length = 575

 Score =  314 bits (804), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 179/218 (82%), Gaps = 5/218 (2%)

Query: 292 QSTSSNTGSRA--QSQVTNVNAAASMAYNNGANKSAIFKQSDPLVPISETVTAKTPSPVT 349
           Q T S  G  A  QS VT VNAAAS A ++   KS+IFK SDP VPI++TV+ K P P+ 
Sbjct: 350 QQTPSGRGQTASQQSPVTGVNAAASSAGSSTVTKSSIFKPSDPTVPIADTVSVKPPEPIA 409

Query: 350 YKTNRPTLTGGTAMNAAALNTPTMTKLPPYEVDTERVMSKRKLRELVKTVGIDEGDGETV 409
           +++NRPT++ G+AMNAAALNTP MT LPPYE+DT+RVMSKRKLRELVK++GIDEGDGETV
Sbjct: 410 FRSNRPTISDGSAMNAAALNTPVMTTLPPYEIDTDRVMSKRKLRELVKSIGIDEGDGETV 469

Query: 410 IDGDVESLLLDLADDFVSNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYSADE 469
           IDGDVE LLLDLADDFV+NVTGFACRLAKHRKSDNL+  DIQLHLERNWNIRIPGYSADE
Sbjct: 470 IDGDVEELLLDLADDFVTNVTGFACRLAKHRKSDNLEPTDIQLHLERNWNIRIPGYSADE 529

Query: 470 IRSTRKWNPKPSYNQKMQAINSDK---ATSAKNASSGK 504
           IRS  KWN  P+Y QK+ +IN+DK   +T++ NA S K
Sbjct: 530 IRSVHKWNASPAYAQKLTSINADKQAISTASANAVSNK 567

 Score =  206 bits (525), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 136/220 (61%), Gaps = 7/220 (3%)

Query: 15  SASQGIGG-------QQRQLLELTTKFRALVNEAKSVGENTPRGKELLIKASKIKAIYDN 67
           SA  G GG       QQ+Q+ ELT +F+ LV EAK VGE TPRGKELL++A+K+KA+Y+N
Sbjct: 16  SAPSGSGGPPSKSAIQQKQIQELTARFKQLVTEAKKVGETTPRGKELLLQAAKLKAVYEN 75

Query: 68  YNXXXXXXXXXFVQGRNGGTPGANPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLAN 127
           Y              + G    A                                 QLAN
Sbjct: 76  YTRRQQALARAQQLQQQGSNTNAAASSGSSTTGTTGTANSSGSASTSGNNSSNSSAQLAN 135

Query: 128 IIKQVLTPEQNQQFEALSQNFQARANSIRDKHTFLKQHIERLNQEVSKQTDASAKKQLEE 187
           IIKQVLTPEQNQQ+E L QNFQ RA++I+DKHTF+KQ+I+RL  E++KQTD  AKKQL E
Sbjct: 136 IIKQVLTPEQNQQYEQLLQNFQVRASAIKDKHTFIKQNIDRLVVEINKQTDEEAKKQLNE 195

Query: 188 KKTELANNLKMLNMEYGALQQEFQNGKKKFYVECARHNPA 227
           KKTEL  N+K + +E+ ALQQE QNGKK FY+ECAR NPA
Sbjct: 196 KKTELLRNIKAIRLEHQALQQELQNGKKNFYLECARQNPA 235

>TPHA0A01560 Chr1 complement(311613..313235) [1623 bp, 540 aa] {ON}
           Anc_8.323 YDR145W
          Length = 540

 Score =  310 bits (795), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 169/203 (83%), Gaps = 7/203 (3%)

Query: 306 VTNVNAAASMAYNNGANKSAIFKQSDPLVPISETVTAKTPSPVTYKTNRPTLTGGTAMNA 365
           +TNVNAAAS    N   KS IFKQSDP VPIS+ VT +    + YK+NRP+LTGG AM+A
Sbjct: 334 ITNVNAAASANVKNNQAKSVIFKQSDPTVPISDNVTLEPTELIPYKSNRPSLTGGAAMSA 393

Query: 366 AALNTPTMTKLPPYEVDTERVMSKRKLRELVKTVGIDEGDGETVIDGDVESLLLDLADDF 425
           AALN P +T LPPYE+DTERVM+KRKLREL+K VGIDEGDGETVIDGDVE LLLDLADDF
Sbjct: 394 AALNVPPLTTLPPYEIDTERVMAKRKLRELIKNVGIDEGDGETVIDGDVEELLLDLADDF 453

Query: 426 VSNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPKPSYNQK 485
           V+NVT FACRLAKHRKS+NL++RDIQLHLERNWNIRIPGYS DEIRSTRKW P  +++QK
Sbjct: 454 VTNVTSFACRLAKHRKSENLESRDIQLHLERNWNIRIPGYSGDEIRSTRKWLPTQAFSQK 513

Query: 486 MQAINSDKA-------TSAKNAS 501
           +Q+IN+DK+       T+AKN+S
Sbjct: 514 LQSINNDKSNPSNTSKTTAKNSS 536

 Score =  116 bits (291), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 79/107 (73%), Gaps = 3/107 (2%)

Query: 124 QLANIIKQVLTPEQNQQFEALSQNFQARANSIRDKHTFLKQHIERLNQEV---SKQTDAS 180
           Q+ANIIKQ+LT EQNQQ++ L +NF A+  SI+DKH FLKQ+I++L QE+   S   D +
Sbjct: 147 QIANIIKQILTAEQNQQYDNLVKNFLAKRTSIKDKHAFLKQNIDKLTQEINNNSNNNDVN 206

Query: 181 AKKQLEEKKTELANNLKMLNMEYGALQQEFQNGKKKFYVECARHNPA 227
            KK LE K+ EL  NLK L++E+  + +EF+N KK FYVECA+ NPA
Sbjct: 207 VKKNLEIKRNELITNLKQLSLEFSKIHEEFKNDKKTFYVECAKQNPA 253

 Score = 87.8 bits (216), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 51/61 (83%)

Query: 8  ANSTAEGSASQGIGGQQRQLLELTTKFRALVNEAKSVGENTPRGKELLIKASKIKAIYDN 67
          AN+T   SA   +  QQ+QL+ELT KF+ LVNEAK+VGENTPRGKELLI+ASK+KAIY+N
Sbjct: 11 ANATPASSAQAKLALQQKQLIELTNKFKQLVNEAKAVGENTPRGKELLIQASKLKAIYEN 70

Query: 68 Y 68
          +
Sbjct: 71 F 71

>Skud_4.404 Chr4 (718381..719988) [1608 bp, 535 aa] {ON} YDR145W
           (REAL)
          Length = 535

 Score =  309 bits (792), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 177/198 (89%)

Query: 301 RAQSQVTNVNAAASMAYNNGANKSAIFKQSDPLVPISETVTAKTPSPVTYKTNRPTLTGG 360
           +++++VTNVNA ASM  N  ANKSAIFKQ++P +PISE ++ K P+PV Y++NRPT+TGG
Sbjct: 325 QSKAKVTNVNATASMMSNVSANKSAIFKQTEPAIPISENISTKAPAPVAYRSNRPTVTGG 384

Query: 361 TAMNAAALNTPTMTKLPPYEVDTERVMSKRKLRELVKTVGIDEGDGETVIDGDVESLLLD 420
           +AMNA+ALNTP  TKLPPYE+DT+RVMSKRKLRELVKTVGIDEGDGETVIDGDVE LLLD
Sbjct: 385 SAMNASALNTPVTTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIDGDVEDLLLD 444

Query: 421 LADDFVSNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPKP 480
           LADDFV+NVT FACRLAKHRKSDNL+ RDIQLHLERNWNIRIPGYSADEIRSTRKWNP  
Sbjct: 445 LADDFVTNVTAFACRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQ 504

Query: 481 SYNQKMQAINSDKATSAK 498
           SYNQK+Q I SDK  +AK
Sbjct: 505 SYNQKLQNITSDKVAAAK 522

 Score =  185 bits (470), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 97/216 (44%), Positives = 129/216 (59%), Gaps = 3/216 (1%)

Query: 14  GSASQGIGGQQRQLLELTTKFRALVNEAKSVGENTPRGKELLIKASKIKAIYD--NYNXX 71
            +A Q +  Q RQL E+T KFRAL+ EA++VGE TPRGKEL+ +A+KIK +YD    N  
Sbjct: 25  AAAQQNLTLQPRQLQEMTAKFRALLIEARNVGETTPRGKELMFQAAKIKQVYDALTLNKR 84

Query: 72  XXXXXXXFVQGRNGGTPGANPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLANIIKQ 131
                  + +  + G    NP                               + +N+IKQ
Sbjct: 85  RQQAAQAY-KNASMGNANPNPSNLASLPTDKAPNPSQQQQQQQQQQARNNSNKFSNMIKQ 143

Query: 132 VLTPEQNQQFEALSQNFQARANSIRDKHTFLKQHIERLNQEVSKQTDASAKKQLEEKKTE 191
           VLTPE+NQ++E L QNFQ R  SI+++  FLKQ+++RL QE++KQTD   K+QLEEKK E
Sbjct: 144 VLTPEENQEYEKLWQNFQVRHTSIKEREAFLKQNVDRLEQEINKQTDEGTKQQLEEKKNE 203

Query: 192 LANNLKMLNMEYGALQQEFQNGKKKFYVECARHNPA 227
           L N+ K+L +EY  L   +QN KK FYVECARHNPA
Sbjct: 204 LLNDWKVLKIEYTKLFNSYQNSKKTFYVECARHNPA 239

>NDAI0J01020 Chr10 complement(231968..233884) [1917 bp, 638 aa] {ON}
           Anc_8.323 YDR145W
          Length = 638

 Score =  306 bits (785), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 170/194 (87%), Gaps = 1/194 (0%)

Query: 300 SRAQSQVTNVNAAASMAYNNGANKSAIFKQSDPLVPISETVTAKTPSPVTYKTNRPTLTG 359
           +++QS VTNVNAAAS +  + +NKS +FK ++P+V IS+T++ K P  V Y++NRP+LTG
Sbjct: 414 TKSQS-VTNVNAAASASSVHPSNKSIMFKPAEPIVNISDTISTKQPISVPYRSNRPSLTG 472

Query: 360 GTAMNAAALNTPTMTKLPPYEVDTERVMSKRKLRELVKTVGIDEGDGETVIDGDVESLLL 419
           G+AMNA+AL TP  TKLPPYE+DTERVMSKRKLRELVK++G+DEGDGETVIDGDVE LLL
Sbjct: 473 GSAMNASALTTPVATKLPPYEIDTERVMSKRKLRELVKSIGVDEGDGETVIDGDVEELLL 532

Query: 420 DLADDFVSNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPK 479
           DLADDFV+NVT FACRLAKHR SD+L+ RDIQLHLE+NWNIRIPGYSADEIRS RKW+P 
Sbjct: 533 DLADDFVTNVTSFACRLAKHRNSDSLEPRDIQLHLEKNWNIRIPGYSADEIRSIRKWHPI 592

Query: 480 PSYNQKMQAINSDK 493
            +YNQK+Q IN+DK
Sbjct: 593 QNYNQKLQHINNDK 606

 Score =  127 bits (320), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 83/105 (79%), Gaps = 1/105 (0%)

Query: 124 QLANIIKQVLTPEQNQQFEALSQNFQARANSIRDKHTFLKQHIERLNQEVSK-QTDASAK 182
           QLA+I+KQVLTPEQNQ+++ L   FQ RA +I++KH+F+KQ+IERL+QE++K   D + K
Sbjct: 162 QLASIMKQVLTPEQNQEYDKLVSTFQTRAAAIKEKHSFVKQNIERLSQELNKPNLDPNLK 221

Query: 183 KQLEEKKTELANNLKMLNMEYGALQQEFQNGKKKFYVECARHNPA 227
            QLE KKTEL N ++ + +E+  L Q+FQ G+K FYVECA++NPA
Sbjct: 222 TQLENKKTELFNTIRAITVEHNTLHQQFQTGQKTFYVECAKNNPA 266

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/65 (56%), Positives = 48/65 (73%), Gaps = 4/65 (6%)

Query: 9  NSTAEGSASQG---IGGQQRQLLELTTKFRALVNEAKSVG-ENTPRGKELLIKASKIKAI 64
          N++   +  QG   I  Q  Q++EL+ KF+ALVNEAK +G +N+ RGKELLI+ASKIKAI
Sbjct: 20 NASTVPAGHQGGPPITLQPNQVIELSNKFKALVNEAKQLGGDNSQRGKELLIQASKIKAI 79

Query: 65 YDNYN 69
          YD YN
Sbjct: 80 YDTYN 84

>KLLA0D16368g Chr4 (1376929..1378464) [1536 bp, 511 aa] {ON} similar
           to uniprot|Q03761 Saccharomyces cerevisiae YDR145W,
          Length = 511

 Score =  300 bits (768), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 159/189 (84%), Gaps = 1/189 (0%)

Query: 305 QVTNVNAAASMAYNNGANKSAIFKQSDPLVPISETVTAKTPSPVTYKTNRPTLTGGTAMN 364
           QVT VNAAA+    +   +  IFKQ +P +PISE VTA     V+Y++NRPT+TGG+ MN
Sbjct: 315 QVTTVNAAANQTAQSNT-RPPIFKQPNPSIPISENVTASPTVSVSYRSNRPTITGGSGMN 373

Query: 365 AAALNTPTMTKLPPYEVDTERVMSKRKLRELVKTVGIDEGDGETVIDGDVESLLLDLADD 424
           A AL TP MTKLPPYEVDTERVMSKRKLRELVKTVGIDEGDGET IDGDVE LLLDLADD
Sbjct: 374 APALTTPVMTKLPPYEVDTERVMSKRKLRELVKTVGIDEGDGETTIDGDVEELLLDLADD 433

Query: 425 FVSNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPKPSYNQ 484
           F++NVT FAC+LAKHRKSD+LD RDIQ+HLERNWNIRIPG++ DEIRST+KWNP PSYNQ
Sbjct: 434 FITNVTNFACKLAKHRKSDSLDVRDIQMHLERNWNIRIPGFANDEIRSTKKWNPTPSYNQ 493

Query: 485 KMQAINSDK 493
            + AIN++K
Sbjct: 494 MVNAINNNK 502

 Score = 91.3 bits (225), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 101/198 (51%), Gaps = 8/198 (4%)

Query: 29  ELTTKFRALVNEAKSVGENTPRGKELLIKASKIKAIYDNYNXXXXXXXXXFVQGRNGGTP 88
           +L  + ++LVNEAK +G +T  GKELL +A++IKA+Y+ Y+             +     
Sbjct: 20  QLADRLKSLVNEAKRIGVDTKEGKELLRQAARIKALYEAYSKQRQQQAQAQAGAQGAVNN 79

Query: 89  GANPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLANIIKQVLTPEQNQQFEALSQNF 148
            A                                  + N IK +LTP+Q + +  L Q +
Sbjct: 80  NA-------TNVKSMDQQQQQQQQQQQQQATASSNNVTNNIKVLLTPQQREAYNRLVQKY 132

Query: 149 QARANSIRDKHTFLKQHIERLNQEV-SKQTDASAKKQLEEKKTELANNLKMLNMEYGALQ 207
           +    +I+ +  FLK++I  L+QE+ +++ ++ + +QLE  + EL   ++ L+ +Y  LQ
Sbjct: 133 EDDGQNIKGEFNFLKRNISVLDQEIRNRRGNSLSVQQLEVNRNELLMKIRALSAQYSTLQ 192

Query: 208 QEFQNGKKKFYVECARHN 225
           Q++Q  ++KFY+EC++ N
Sbjct: 193 QKYQEDRRKFYIECSQTN 210

>TBLA0A03940 Chr1 (984062..986320) [2259 bp, 752 aa] {ON} Anc_8.323
           YDR145W
          Length = 752

 Score =  296 bits (757), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 136/218 (62%), Positives = 171/218 (78%)

Query: 293 STSSNTGSRAQSQVTNVNAAASMAYNNGANKSAIFKQSDPLVPISETVTAKTPSPVTYKT 352
           S  SN+ +R QS +TNVNAAAS +  +      IFKQ++PL+PISE +T K P  + Y+ 
Sbjct: 533 SGQSNSQNRQQSAITNVNAAASTSSKSLTKTMNIFKQTEPLLPISEHLTTKIPEAIPYRN 592

Query: 353 NRPTLTGGTAMNAAALNTPTMTKLPPYEVDTERVMSKRKLRELVKTVGIDEGDGETVIDG 412
           NRPTLTGGTAMN + LNTP +TKLPPYE+DT+RVM KRKL+E+V++VG+D+GDGETVI G
Sbjct: 593 NRPTLTGGTAMNTSVLNTPVLTKLPPYEIDTQRVMLKRKLKEVVRSVGVDDGDGETVIGG 652

Query: 413 DVESLLLDLADDFVSNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYSADEIRS 472
           DVE  LLDLAD+FV++VT FAC++AKHRKSD+LD  DIQLHLE+NWNIRIP YS D IRS
Sbjct: 653 DVEEALLDLADNFVTSVTTFACKIAKHRKSDSLDVGDIQLHLEKNWNIRIPSYSMDVIRS 712

Query: 473 TRKWNPKPSYNQKMQAINSDKATSAKNASSGKSLSQSK 510
           +RKWNP  SYNQK+ ++N  K +S K++ S    S SK
Sbjct: 713 SRKWNPTASYNQKLNSLNPGKGSSGKHSHSNNKSSTSK 750

 Score =  124 bits (311), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 59/104 (56%), Positives = 77/104 (74%), Gaps = 1/104 (0%)

Query: 124 QLANIIKQVLTPEQNQQFEALSQNFQARANSIRDKHTFLKQHIERLNQEVSK-QTDASAK 182
           QLAN IKQ+LTPEQN+Q++ L  NFQ RA +I++KH FLKQHI R   E++K    A  +
Sbjct: 229 QLANYIKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAELNKPNIPALDR 288

Query: 183 KQLEEKKTELANNLKMLNMEYGALQQEFQNGKKKFYVECARHNP 226
            +LE+KK EL +NLK ++++Y  L QEFQNGKK FY+ CAR NP
Sbjct: 289 VKLEKKKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNP 332

 Score = 75.9 bits (185), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%)

Query: 23  QQRQLLELTTKFRALVNEAKSVGENTPRGKELLIKASKIKAIYDNYN 69
           QQ+QL+EL  KF+ LVNEAK VGENT RGKELL++A KIK IYDN+N
Sbjct: 57  QQKQLMELVAKFKLLVNEAKKVGENTARGKELLMQAGKIKQIYDNFN 103

>TBLA0H01280 Chr8 complement(287810..289027) [1218 bp, 405 aa] {ON}
           Anc_8.323 YDR145W
          Length = 405

 Score =  162 bits (410), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 93/113 (82%), Gaps = 1/113 (0%)

Query: 379 YEVDTERVMSKRKLRELVKTVGIDEGDGETV-IDGDVESLLLDLADDFVSNVTGFACRLA 437
           YE+++ERV+SKRKLRELV++V IDE D + + IDGDVE LLLD+AD+FVSN+T F+CRL+
Sbjct: 274 YELNSERVLSKRKLRELVRSVSIDEHDEKDLSIDGDVEELLLDMADEFVSNITSFSCRLS 333

Query: 438 KHRKSDNLDTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPKPSYNQKMQAIN 490
           +HR S+ ++ RDIQLH+ERNWNIR+PG++ADEI+S +KW     Y   + ++N
Sbjct: 334 RHRNSNMVNKRDIQLHVERNWNIRVPGFNADEIKSAKKWQSSNVYMHYLNSVN 386

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 60/208 (28%), Positives = 103/208 (49%), Gaps = 10/208 (4%)

Query: 19  GIGGQQRQLLELTTKFRALVNEAK-SVGENTPRGKELLIKASKIKAIYDNYNXXXXXXXX 77
            +  QQ+QL EL   F+ L+ +AK + G+ T +GKELLIKA+K+K ++            
Sbjct: 7   SLAQQQKQLNELAENFKNLIKDAKLNGGDTTEKGKELLIKATKVKKLF-------TQLSN 59

Query: 78  XFVQGRNGGTPGANPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLANIIKQVLTPEQ 137
            +    +      +                                 L+ +IK  LTPEQ
Sbjct: 60  KYKNDSSSNDSTLSRSNSNSSLKNMNTPPSTSSNNSSSTPMVRSNSNLSMMIKNALTPEQ 119

Query: 138 NQQFEALSQNFQARANSIRDKHTFLKQHIERLNQEVSKQTDASAKKQLEEKKTELANNLK 197
           N+ +E L ++FQ RA  I+ +H+ +K+ I+ +++ ++ +T+   ++ L  K+ E    LK
Sbjct: 120 NESYETLLKDFQIRAAKIKREHSDVKEKIDNISKLLNSKTN--NQEALTAKRNEYLFQLK 177

Query: 198 MLNMEYGALQQEFQNGKKKFYVECARHN 225
            L+ +Y  L Q+FQN KK FY++ A+ N
Sbjct: 178 KLSKDYTELHQQFQNEKKNFYLKSAKQN 205

>TBLA0E04490 Chr5 (1146095..1146526) [432 bp, 143 aa] {ON} Anc_4.297
           YKL192C
          Length = 143

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 4/52 (7%)

Query: 421 LADDFVSNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYSADEIRS 472
           L D  V+N T FA    K    D+LDT ++ + +E  ++I IP   AD+++S
Sbjct: 81  LKDKTVTNETQFA----KDLSLDSLDTVELLVAIEEEFDIEIPDNVADDLKS 128

>Skud_13.426 Chr13 (751977..752540) [564 bp, 187 aa] {ON} YMR255W
           (REAL)
          Length = 187

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 50/97 (51%), Gaps = 14/97 (14%)

Query: 330 SDPLV--PISETVTAKTPSPVTYKTNRPTLTGGTAMNAAALNTPTMTKLPPYEVDTER-V 386
           +DPL   P S+ +T  +P P++   NRP  T   +      ++P+  KL   +++ +R +
Sbjct: 89  TDPLAINPFSQKITEVSPPPISPSKNRPAKTKSKS------DSPSKMKLLKKKIEEQREI 142

Query: 387 MSK----RKLRELVKTVGIDEGDGETVIDGDVESLLL 419
           + K    ++ ++++     DEG+   V D D E L+L
Sbjct: 143 LQKTHHNKQQQQVLMDFLNDEGNSNWV-DDDEEELIL 178

>NDAI0B04280 Chr2 (1074653..1076869) [2217 bp, 738 aa] {ON}
           Anc_2.165 YOR112W
          Length = 738

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 24/45 (53%)

Query: 392 LRELVKTVGIDEGDGETVIDGDVESLLLDLADDFVSNVTGFACRL 436
           L E  K   I + +G+ V+  DVE+L LD  D F + V GF   L
Sbjct: 249 LYEEFKEFHIKDPEGKLVVMTDVENLFLDSKDSFTNLVPGFLENL 293

>Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON}
           (10036..12474) [2439 nt, 813 aa]
          Length = 812

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 79/177 (44%), Gaps = 27/177 (15%)

Query: 328 KQSDPLVPISETVTAKTPSPVTYKTNRPTLTGGTAMN--AAALNTPTMTKLPPYEVDTER 385
           +Q+   VPIS+ V    P P   + NR  +    ++N  A  + +   ++L P  V+   
Sbjct: 329 EQTTEAVPISKNVEIYEPQPKKRRLNRSRVKPLDSLNFFAGGVTSIGASQL-PLPVEEAN 387

Query: 386 VMSKRKLRELVKTVGIDEGDGETVIDGDVESLLLDLADDFVSNVTGFACRLAKHRKSDNL 445
            ++++K +E++K+ G  E + ET +D      LL  A +F            K  KS   
Sbjct: 388 NITRKKDKEVIKSQGKGEINIETEMDESGNGELLSTASEF------------KKPKS--- 432

Query: 446 DTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPKPSYNQKMQAINSDKATSAKNASS 502
              D+Q  LE+   + I   S ++I+      PK   N  +Q + S+K  S  + SS
Sbjct: 433 ---DVQHKLEKRMQVAI-DRSPEKIKK-----PKLEENISIQQLLSNKVKSTSDTSS 480

>Skud_15.201 Chr15 (360205..361071) [867 bp, 288 aa] {ON} YOR036W
           (REAL)
          Length = 288

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 150 ARANSIRDKHTFLK--QHIERLNQEVSKQTDASAKKQLEEKKTELANNLKMLNMEYG 204
           AR   +RD    L+  Q I+R   EV KQ +  A++ LE   TE+ANN  +L+ E G
Sbjct: 111 AREKLVRDVSYSLQEFQGIQRQFTEVMKQVNEKARESLE--ATEMANNAALLDEEQG 165

>KLTH0D15554g Chr4 (1284597..1284968) [372 bp, 123 aa] {ON} similar
           to uniprot|P32463 Saccharomyces cerevisiae YKL192C ACP1
           Mitochondrial matrix acyl carrier protein involved in
           biosynthesis of octanoate which is a precursor to lipoic
           acid activated by phosphopantetheinylation catalyzed by
           Ppt2p
          Length = 123

 Score = 29.6 bits (65), Expect = 7.1,   Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 12/68 (17%)

Query: 413 DVESLLLDLADDF--------VSNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPG 464
           ++ S ++D+   F        ++N T FA    K    D+LDT ++ + +E  ++I IP 
Sbjct: 45  EISSRVIDVVKSFDKTTASASITNDTHFA----KDLGLDSLDTVELLVAIEEEFDIEIPD 100

Query: 465 YSADEIRS 472
             ADEI+S
Sbjct: 101 KVADEIKS 108

>Kwal_47.17140 s47 complement(269893..270264) [372 bp, 123 aa] {ON}
           YKL192C (ACP1) - mitochondrial acyl carrier protein
           [contig 212] FULL
          Length = 123

 Score = 29.6 bits (65), Expect = 7.1,   Method: Composition-based stats.
 Identities = 15/40 (37%), Positives = 25/40 (62%)

Query: 436 LAKHRKSDNLDTRDIQLHLERNWNIRIPGYSADEIRSTRK 475
            AK    D+LDT ++ + +E  ++I IP   ADEI+S ++
Sbjct: 72  FAKDLGLDSLDTVELLVAIEEEFDIEIPDKVADEIKSVKE 111

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.123    0.336 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,443,989
Number of extensions: 1670778
Number of successful extensions: 8648
Number of sequences better than 10.0: 153
Number of HSP's gapped: 9111
Number of HSP's successfully gapped: 196
Length of query: 510
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 396
Effective length of database: 40,409,475
Effective search space: 16002152100
Effective search space used: 16002152100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 68 (30.8 bits)