Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0F044708.321ON80980940890.0
ZYRO0F10340g8.321ON81881719630.0
SAKL0H15598g8.321ON78780416970.0
YLR127C (APC2)8.321ON85384716700.0
Smik_12.1908.321ON85083916370.0
Skud_12.1968.321ON85485016150.0
Suva_10.2208.321ON85485416030.0
KLTH0G12342g8.321ON77480613351e-173
Kwal_56.239098.321ON77679713291e-172
TPHA0C008308.321ON84285712261e-155
TBLA0A039208.321ON73274712141e-155
NCAS0C032808.321ON81184710861e-135
CAGL0M04235g8.321ON78379410841e-135
Kpol_YGOB_Anc_8.3218.321ON5115109531e-119
KAFR0H022808.321ON8178459601e-116
KNAG0G024308.321ON7978309041e-109
AGL193W8.321ON7096868229e-98
Ecym_42528.321ON6896887921e-93
NDAI0G026008.321ON9119277728e-89
KLLA0D16324g8.321ON6977384867e-51
Kwal_0.701.343ON772113920.023
Skud_4.1227.296ON815108840.24
ZYRO0D02464g2.263ON69862800.68
NCAS0A138107.296ON818107790.86
NDAI0A022307.296ON816106791.0
KAFR0J015002.263ON69162771.7
ZYRO0C09438g7.296ON81996761.9
Suva_4.1127.296ON815108743.7
KLTH0H11176g1.343ON774107725.7
Smik_12.3556.73ON594188717.4
SAKL0F05016g7.134ON714102708.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0F04470
         (809 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0F04470 Chr6 complement(837936..840365) [2430 bp, 809 aa] {O...  1579   0.0  
ZYRO0F10340g Chr6 complement(837799..840255) [2457 bp, 818 aa] {...   760   0.0  
SAKL0H15598g Chr8 (1357656..1360019) [2364 bp, 787 aa] {ON} simi...   658   0.0  
YLR127C Chr12 complement(395758..398319) [2562 bp, 853 aa] {ON} ...   647   0.0  
Smik_12.190 Chr12 complement(377110..379662) [2553 bp, 850 aa] {...   635   0.0  
Skud_12.196 Chr12 complement(378532..381096) [2565 bp, 854 aa] {...   626   0.0  
Suva_10.220 Chr10 complement(404296..406860) [2565 bp, 854 aa] {...   622   0.0  
KLTH0G12342g Chr7 (1048457..1050781) [2325 bp, 774 aa] {ON} simi...   518   e-173
Kwal_56.23909 s56 complement(771248..773578) [2331 bp, 776 aa] {...   516   e-172
TPHA0C00830 Chr3 (163528..166056) [2529 bp, 842 aa] {ON} Anc_8.3...   476   e-155
TBLA0A03920 Chr1 complement(980348..982546) [2199 bp, 732 aa] {O...   472   e-155
NCAS0C03280 Chr3 (644169..646604) [2436 bp, 811 aa] {ON} Anc_8.3...   422   e-135
CAGL0M04235g Chr13 complement(464973..467324) [2352 bp, 783 aa] ...   422   e-135
Kpol_YGOB_Anc_8.321 s1036 complement(185463..186998) [1536 bp, 5...   371   e-119
KAFR0H02280 Chr8 (435246..437699) [2454 bp, 817 aa] {ON} Anc_8.3...   374   e-116
KNAG0G02430 Chr7 complement(553644..556037) [2394 bp, 797 aa] {O...   352   e-109
AGL193W Chr7 (334823..336952) [2130 bp, 709 aa] {ON} Syntenic ho...   321   9e-98
Ecym_4252 Chr4 complement(523632..525701) [2070 bp, 689 aa] {ON}...   309   1e-93
NDAI0G02600 Chr7 (595394..598129) [2736 bp, 911 aa] {ON} Anc_8.3...   301   8e-89
KLLA0D16324g Chr4 complement(1373445..1375538) [2094 bp, 697 aa]...   191   7e-51
Kwal_0.70 s0 complement(30290..32608) [2319 bp, 772 aa] {ON} YJL...    40   0.023
Skud_4.122 Chr4 (219928..222375) [2448 bp, 815 aa] {ON} YDL132W ...    37   0.24 
ZYRO0D02464g Chr4 (191069..193165) [2097 bp, 698 aa] {ON} simila...    35   0.68 
NCAS0A13810 Chr1 complement(2710214..2712670) [2457 bp, 818 aa] ...    35   0.86 
NDAI0A02230 Chr1 (502448..504898) [2451 bp, 816 aa] {ON} Anc_7.296     35   1.0  
KAFR0J01500 Chr10 complement(270147..272222) [2076 bp, 691 aa] {...    34   1.7  
ZYRO0C09438g Chr3 complement(715107..717566) [2460 bp, 819 aa] {...    34   1.9  
Suva_4.112 Chr4 (212752..215199) [2448 bp, 815 aa] {ON} YDL132W ...    33   3.7  
KLTH0H11176g Chr8 complement(957667..959991) [2325 bp, 774 aa] {...    32   5.7  
Smik_12.355 Chr12 complement(633462..635246) [1785 bp, 594 aa] {...    32   7.4  
SAKL0F05016g Chr6 complement(397906..400050) [2145 bp, 714 aa] {...    32   8.9  

>TDEL0F04470 Chr6 complement(837936..840365) [2430 bp, 809 aa] {ON}
           Anc_8.321 YLR127C
          Length = 809

 Score = 1579 bits (4089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 775/809 (95%), Positives = 775/809 (95%)

Query: 1   MSECHSSELPVIIDSIKEVALRLHPGCEDDLEALLTWLNPNESESNHHMRPPPLRLKDAI 60
           MSECHSSELPVIIDSIKEVALRLHPGCEDDLEALLTWLNPNESESNHHMRPPPLRLKDAI
Sbjct: 1   MSECHSSELPVIIDSIKEVALRLHPGCEDDLEALLTWLNPNESESNHHMRPPPLRLKDAI 60

Query: 61  KLFVNQYYNSGYISGSDGEINKGPEFELGNQLRQFYIYQVRIHFFTSFNLIQTFKDIQRL 120
           KLFVNQYYNSGYISGSDGEINKGPEFELGNQLRQFYIYQVRIHFFTSFNLIQTFKDIQRL
Sbjct: 61  KLFVNQYYNSGYISGSDGEINKGPEFELGNQLRQFYIYQVRIHFFTSFNLIQTFKDIQRL 120

Query: 121 EKYYVSPLAYIHLFESSGYEWIIERDGLRHYLLNRNMEFHNNMKQRMESLFMQDDFEYVA 180
           EKYYVSPLAYIHLFESSGYEWIIERDGLRHYLLNRNMEFHNNMKQRMESLFMQDDFEYVA
Sbjct: 121 EKYYVSPLAYIHLFESSGYEWIIERDGLRHYLLNRNMEFHNNMKQRMESLFMQDDFEYVA 180

Query: 181 EMLDWVEKAHTXXXXXXXXXXXXXAKVKQFCDDHMMGVYGKTYLVMKTFNKFIIKYWSNF 240
           EMLDWVEKAHT             AKVKQFCDDHMMGVYGKTYLVMKTFNKFIIKYWSNF
Sbjct: 181 EMLDWVEKAHTSLSSKDILLDLIIAKVKQFCDDHMMGVYGKTYLVMKTFNKFIIKYWSNF 240

Query: 241 AQLLGCPQDDHGLTNVVYTCFEKQFIRIRTQEVFDIFVNEFPNSKPTIIEMRKLITHSTD 300
           AQLLGCPQDDHGLTNVVYTCFEKQFIRIRTQEVFDIFVNEFPNSKPTIIEMRKLITHSTD
Sbjct: 241 AQLLGCPQDDHGLTNVVYTCFEKQFIRIRTQEVFDIFVNEFPNSKPTIIEMRKLITHSTD 300

Query: 301 FKTIVIAFLSTFEKKVLNPSVTTTDALLAYVKSVKAFLTLDPSGRYLQSVISFVKQTFQE 360
           FKTIVIAFLSTFEKKVLNPSVTTTDALLAYVKSVKAFLTLDPSGRYLQSVISFVKQTFQE
Sbjct: 301 FKTIVIAFLSTFEKKVLNPSVTTTDALLAYVKSVKAFLTLDPSGRYLQSVISFVKQTFQE 360

Query: 361 RSDLVVILLYAILDLQLDGLVGSHIQVDPVCLKALASELRDPELGIENDIYPDDNLANVA 420
           RSDLVVILLYAILDLQLDGLVGSHIQVDPVCLKALASELRDPELGIENDIYPDDNLANVA
Sbjct: 361 RSDLVVILLYAILDLQLDGLVGSHIQVDPVCLKALASELRDPELGIENDIYPDDNLANVA 420

Query: 421 TGMAKLNYEGCLPYEEVMQRFLSWNPDPRDMAPRAISKQSPSHMSLLDILMELFESKDFF 480
           TGMAKLNYEGCLPYEEVMQRFLSWNPDPRDMAPRAISKQSPSHMSLLDILMELFESKDFF
Sbjct: 421 TGMAKLNYEGCLPYEEVMQRFLSWNPDPRDMAPRAISKQSPSHMSLLDILMELFESKDFF 480

Query: 481 VSEFXXXXXXXXXXXXFYNLDRNWSKCLQLLKKKLARGAPNISLAPTGQQNNSERGDDYS 540
           VSEF            FYNLDRNWSKCLQLLKKKLARGAPNISLAPTGQQNNSERGDDYS
Sbjct: 481 VSEFLKLLTKRLLSLKFYNLDRNWSKCLQLLKKKLARGAPNISLAPTGQQNNSERGDDYS 540

Query: 541 NINSNDVMLWDVKLSYELCKQMHQVSGLDQRIYPKFISYLYWNCQLESKNDFEIPEPLNS 600
           NINSNDVMLWDVKLSYELCKQMHQVSGLDQRIYPKFISYLYWNCQLESKNDFEIPEPLNS
Sbjct: 541 NINSNDVMLWDVKLSYELCKQMHQVSGLDQRIYPKFISYLYWNCQLESKNDFEIPEPLNS 600

Query: 601 EFEKYSRVYSEVKAGRALKLLKDQGVIELDLEFKDGRVLQCDVTLEQYAVIQQFDEDSYA 660
           EFEKYSRVYSEVKAGRALKLLKDQGVIELDLEFKDGRVLQCDVTLEQYAVIQQFDEDSYA
Sbjct: 601 EFEKYSRVYSEVKAGRALKLLKDQGVIELDLEFKDGRVLQCDVTLEQYAVIQQFDEDSYA 660

Query: 661 NRLMAETISLYLNMEISRVKSALQFWVEKGVLYQVDAFYATQESRQDSNIKTAKSDSVGS 720
           NRLMAETISLYLNMEISRVKSALQFWVEKGVLYQVDAFYATQESRQDSNIKTAKSDSVGS
Sbjct: 661 NRLMAETISLYLNMEISRVKSALQFWVEKGVLYQVDAFYATQESRQDSNIKTAKSDSVGS 720

Query: 721 FFEKNXXXXXXXXXLSKTLNAIWPFVQGMLTNLGSLKAAKIHSFLKVTVPKEVGYIVVTQ 780
           FFEKN         LSKTLNAIWPFVQGMLTNLGSLKAAKIHSFLKVTVPKEVGYIVVTQ
Sbjct: 721 FFEKNETIIEEETTLSKTLNAIWPFVQGMLTNLGSLKAAKIHSFLKVTVPKEVGYIVVTQ 780

Query: 781 SQLESYLNSLVEEERLACTTSGSYKLPSI 809
           SQLESYLNSLVEEERLACTTSGSYKLPSI
Sbjct: 781 SQLESYLNSLVEEERLACTTSGSYKLPSI 809

>ZYRO0F10340g Chr6 complement(837799..840255) [2457 bp, 818 aa] {ON}
           similar to uniprot|Q7LGV7 Saccharomyces cerevisiae
           YLR127C
          Length = 818

 Score =  760 bits (1963), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/817 (48%), Positives = 535/817 (65%), Gaps = 26/817 (3%)

Query: 8   ELPVIIDSIKEVALRLHPGCEDDLEALLTWLNPNESESNHHMRPPPLRLKDAIKLFVNQY 67
           +L  ++  I+EVALR HP CEDDLE+LLTW+NPNE +SNH  +PP LRLK++IK+ VNQY
Sbjct: 10  DLKRLLVQIQEVALRTHPNCEDDLESLLTWINPNEPQSNHQCKPPTLRLKNSIKMLVNQY 69

Query: 68  YNSGYISGSDGEINKGPEFELGNQLRQFYIYQVRIHFFTSFNLIQTFKDIQRLEKYYVSP 127
           YN   +   + E + G  +     +RQFY+YQVR+HFF S + + TFKD+QRL KYY  P
Sbjct: 70  YN---MELREDERDTG--YLFIQLVRQFYVYQVRLHFFASLSNLHTFKDVQRLVKYYEFP 124

Query: 128 LAYIHLFESSGYEWIIERDGLRHYLLNRNMEFHNNMKQRMESLFMQDDFEYVAEMLDWVE 187
           L Y+++FE+   EWI ERDGL HYLLNR+ +   N+  R++ L M+DDF+   +++ W+ 
Sbjct: 125 LKYVYIFENCPEEWIGERDGLMHYLLNRHKKLRINVVSRLKDLVMEDDFDLAMDVVKWLN 184

Query: 188 KAHTXXXXXXXXXXXXXAKVKQFCDDHMMGVYGKTYLVMKTFNKFIIKYWSNFAQLLGCP 247
           ++++              K+ +FC D M G +   +L+M+TFN+FI  YWS F  LL CP
Sbjct: 185 ESNSNVSSMDLMLDLIVEKISRFCQDQMTGTWNNRFLIMETFNRFITSYWSQFCLLLACP 244

Query: 248 QDDHGLTNVVYTCFEKQFIRIRTQEVFDIFVNEFPNSKPTIIEMRKLITHSTDFKTIVIA 307
           +D+H LT VVY  FE+QF+++RT+E+FDI V  +P+SKPT++E+R+++  S DF  IV+ 
Sbjct: 245 EDNHELTTVVYHLFERQFVKLRTKEIFDIVVGVYPDSKPTLLELRRVLVKSKDFTQIVVE 304

Query: 308 FLSTFEKKVLNPSVTTTDALLAYVKSVKAFLTLDPSGRYLQSVISFVKQTFQERSDLVVI 367
           FLS FE+++LNPS++T +ALLAYVK+VKAFLTLDP+GR L SV +FVK  FQER+DLV +
Sbjct: 305 FLSNFERQILNPSISTVNALLAYVKTVKAFLTLDPTGRCLNSVSAFVKPYFQERNDLVTV 364

Query: 368 LLYAILDLQLDGLVG-SHIQVDPVCLKALASELRDPELGIEN--DIYPDDNL----ANVA 420
           LLYAIL+LQ +   G +   +D   L  L+ EL+DPE GIE+  +  P  +L    A+ A
Sbjct: 365 LLYAILELQSEEFEGPARAYLDTNSLNQLSQELKDPEFGIESSFETIPQADLLSRPASTA 424

Query: 421 TGMAKLNYEGCLPYEEVMQRFLSWNPDPRDMAPRAISKQSPSHMSLLDILMELFESKDFF 480
           T  A L+    LPY+ V++ FL W P+P D   +  SK   +  +LLDILM++FESKDFF
Sbjct: 425 TTAAMLDPR--LPYKSVIKNFLQWTPEPMDTISKNYSKSLSASRNLLDILMDMFESKDFF 482

Query: 481 VSEFXXXXXXXXXXXXFYNLDRNWSKCLQLLKKKLARGAPNISLAPTGQQNNSE-----R 535
           VSEF             Y LDR WS CL+LLK K         +A      +       R
Sbjct: 483 VSEFLSLLTRKLLTLKLYTLDRKWSHCLRLLKTKFGPAGAAAVVATGIGGGDGGSIDGVR 542

Query: 536 GDDYSNINSNDVMLWDVKLSYELCKQMHQVSGLDQRIYPKFISYLYWNCQLESKN-DFEI 594
           G D SNIN+ DVML DV+ S ELCK+MHQV+GLDQRIYPKFIS LYWN    S    F++
Sbjct: 543 GGDPSNINNIDVMLRDVRGSSELCKRMHQVAGLDQRIYPKFISPLYWNRDNSSNGWTFQL 602

Query: 595 PEPLNSEFEKYSRVYSEVKAGRALKLLKDQGVIELDLEFKDGRVLQCDVTLEQYAVIQQF 654
              +  E +KY +VYSE+K GRAL L KDQG++ L L F+DGR  +C+ TLEQ +VIQQF
Sbjct: 603 DPQMALELDKYCQVYSEIKPGRALHLYKDQGIVVLTLSFQDGRKKRCEATLEQCSVIQQF 662

Query: 655 DEDSYANR-LMAETISLYLNMEISRVKSALQFWVEKGVLYQVDAFYATQESRQDS---NI 710
           D  +     L  + I   L M+ +R ++ALQ WV++GVLY     Y T+E   D    N+
Sbjct: 663 DASTATTTGLTEQMIGARLQMDPARARAALQHWVQEGVLYYDGNAYKTREYLDDQPAENL 722

Query: 711 KTAKSDSVGSFFEKNXXXXXXXXXLSKTLNAIWPFVQGMLTNLGSLKAAKIHSFLKVTVP 770
             +K  S  S  +           L+  L   WPF+QGMLTNLG+LK  KIHSFLKVT P
Sbjct: 723 PASKDSSASS--QARTMSPDRDSRLTSILEQTWPFIQGMLTNLGALKVKKIHSFLKVTTP 780

Query: 771 KEVGYIVVTQSQLESYLNSLVEEERLACTTSGSYKLP 807
           KE+G+ +VT SQLESYL+SLVEEERL CTT+ +YKLP
Sbjct: 781 KELGFSMVTPSQLESYLHSLVEEERLICTTNDTYKLP 817

>SAKL0H15598g Chr8 (1357656..1360019) [2364 bp, 787 aa] {ON} similar
           to uniprot|Q7LGV7 Saccharomyces cerevisiae YLR127C
          Length = 787

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/804 (43%), Positives = 502/804 (62%), Gaps = 45/804 (5%)

Query: 16  IKEVALRLHPGCEDDLEALLTWLNPNESESNHHMRPPPLRLKDAIKLFVNQYYNSGYISG 75
           ++E     +P  ED+L+ +LTWLNPNE  SNH +RPP LRLK+ IKL VN          
Sbjct: 14  LREFVTTYNPNLEDELDGVLTWLNPNEPNSNHQLRPPSLRLKNGIKLVVN---------- 63

Query: 76  SDGEINKGPEFELGNQLRQFYIYQVRIHFFTSFNLIQTFKDIQRLEKYYVSPLAYIHLFE 135
            + ++  G      + LRQF + Q RIHFF++FN I +FKDIQRLEKYY  PL YI++F 
Sbjct: 64  -NEDVPPG----FVHLLRQFVLLQTRIHFFSNFNSITSFKDIQRLEKYYEFPLKYINIFT 118

Query: 136 SSGYEWIIERDGLRHYLLNRNMEFHNNMKQRMESLFMQDDFEYVAEMLDWVEKAHTXXXX 195
               EW IE +G RHYL+++N  F +N+K R+  L M+DDF+   ++  W+ +       
Sbjct: 119 PD--EWFIEMNGFRHYLMSKNRIFGDNIKHRVRQLIMEDDFDMAWKIYTWLTET-MGHQL 175

Query: 196 XXXXXXXXXAKVKQFCDDHMMGVYGKTYLVMKTFNKFIIKYWSNFAQLLGCPQDDHGLTN 255
                     K+  F   +MMG + + +LVM+TFN FI KYWS FAQ L CP+DDH +T 
Sbjct: 176 VSLLLEILMDKIADFSKQNMMGKWTQRFLVMETFNTFITKYWSTFAQALRCPEDDHEITT 235

Query: 256 VVYTCFEKQFIRIRTQEVFDIFVNEFPNSKPTIIEMRKLITHSTDFKTIVIAFLSTFEKK 315
            ++ CFEK+F++IRT E+++I V E+P+SKP ++E+R ++  S D+  ++I FLS FE K
Sbjct: 236 EIFHCFEKEFVKIRTSEIYEICVLEYPHSKPALLELRNVMKTSADYSKLMIEFLSKFESK 295

Query: 316 VLNPSVTTTDALLAYVKSVKAFLTLDPSGRYLQSVISFVKQTFQERSDLVVILLYAILDL 375
           ++NPSVTTT+ LL+Y++++K+FLT+DP+GRYLQSV +++K   +ER D VV LLYA+L+L
Sbjct: 296 LMNPSVTTTEILLSYIRTIKSFLTVDPAGRYLQSVTAYIKPYLRERRDTVVHLLYAMLEL 355

Query: 376 QLDGLVGSHIQVDPVCLKALASELRDPELGIEN-DIYPDDNLANVATGMAKLNYEGCLPY 434
               +  +++ ++   L  L+ EL+DP+ GIE+ D     N   V         E  L  
Sbjct: 356 DESEIDDANVSLNMPILTELSKELKDPDFGIEDADSKSRKNKLMVTDSSPVFKVEKPL-C 414

Query: 435 EEVMQRFLSWNPDPRDMAPRAISKQSPSHMSLLDILMELFESKDFFVSEFXXXXXXXXXX 494
           E+V+  FL W P+P D+A R     +  + SLLDIL+++F+SKD F+SEF          
Sbjct: 415 EQVLNYFLQWTPEPSDVAHRK-PNNTFVNKSLLDILLDIFDSKDVFISEFLSLFTKKLLG 473

Query: 495 XXFYNLDRNWSKCLQLLKKKLARGAPNISLAPTGQQNNSERGDDYSNINSNDVMLWDVKL 554
             +Y L+  W K L+LLKKK    +      P  Q        D SNIN+ D+ML DVK 
Sbjct: 474 LKYYKLETKWIKILRLLKKKFGHTS-----FPQHQ------FQDTSNINNIDIMLRDVKT 522

Query: 555 SYELCKQMHQVSGLDQRIYPKFISYLYWNCQLESK-NDFEIPEPLNSEFEKYSRVYSEVK 613
           SYEL  +MH+V+GLD R++PKFISYL+WN  LE++ +DF++P  L +E EKYS VYS++K
Sbjct: 523 SYELISKMHEVAGLDDRVFPKFISYLFWNSALEAETSDFQLPGWLETEIEKYSEVYSQLK 582

Query: 614 AGRALKLLKDQGVIELDLEFKDGRVLQCDVTLEQYAVIQQFDEDSYANRLMAETISLYLN 673
            GR L L KDQG +ELDLEFKDGR + C+V L + AVI  FD+D+    L  E I   + 
Sbjct: 583 PGRRLHLYKDQGTVELDLEFKDGRKISCEVPLNKAAVISCFDQDTALKGLAVEQIVDNVK 642

Query: 674 MEISRVKSALQFWVEKGVL--------YQVDAFYATQESRQDSNIKTAKSDSVGSFF--- 722
           ME + V S LQFW +K  +        Y+V  +Y    +   S + ++K ++ G      
Sbjct: 643 MEKALVTSILQFWCKKNAIYYDDRYNTYRVLEYYEPNSALSASTVISSKGNTNGGINPMD 702

Query: 723 EKNXXXXXXXXXLSKTLNAIWPFVQGMLTNLGSLKAAKIHSFLKVTVPKEVGYIVVTQSQ 782
           +++           ++++ IWPF+QGMLTNLGS+K  KIHSFLK+ VPK++GY   T +Q
Sbjct: 703 DQDNAGDKQQQEFIQSMSKIWPFIQGMLTNLGSMKPEKIHSFLKMAVPKDIGY-TATVNQ 761

Query: 783 LESYLNSLVEEERLACTTSGSYKL 806
           LESYLN LV+E++LA   +GSYKL
Sbjct: 762 LESYLNVLVDEDKLAAVPNGSYKL 785

>YLR127C Chr12 complement(395758..398319) [2562 bp, 853 aa] {ON}
           APC2Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition; component of the catalytic core of the
           APC/C; has similarity to cullin Cdc53p
          Length = 853

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/847 (42%), Positives = 514/847 (60%), Gaps = 55/847 (6%)

Query: 6   SSELPVIIDSIKEVALRL-HPGCEDDLEALLTWLNPNESESNHHMRPPPLRLKDAIK-LF 63
           + +L VI D ++ ++  + H    DDL +LLTW++PN+++SNH +RPP LR+K+ IK LF
Sbjct: 8   TRDLKVITDELQTLSSYIFHTNIVDDLNSLLTWMSPNDAKSNHQLRPPSLRIKNIIKVLF 67

Query: 64  VNQYYNSGY--ISGS--------DGEINKGPEFELGNQLRQFYIYQVRIHFFTSFNLIQT 113
            N    S Y  I+ S        +G  NK  + +L + L++FYI+QVR HFF  FN I  
Sbjct: 68  PNNATTSPYSMINTSQANNSIVNEGNTNKELQLQLFSTLKEFYIFQVRYHFFLHFNNINY 127

Query: 114 FKDIQRLEKYYVSPLAYIHLFESSGYEWIIERDGLRHYLLNRNMEFHNNMKQRMESLFMQ 173
            KDIQR E YY  PL Y+ +F+ +  +W +E + LRHYLLNRN++F NN++ R++ L M 
Sbjct: 128 LKDIQRWENYYEFPLRYVPIFDVNVNDWALELNSLRHYLLNRNIKFKNNLRTRLDKLIMD 187

Query: 174 DDFEYVAEMLDWVEKAHTXXXXXXXXXXXXXAKVKQFCDDHMMGVYGKTYLVMKTFNKFI 233
           DDF+    ++ W++ A+              +K+ +FC+D+M  V+ K +++M+TFNKFI
Sbjct: 188 DDFDLADNLIQWLKSANGSLSSTELIVNALYSKINKFCEDNMSRVWNKRFMIMETFNKFI 247

Query: 234 IKYWSNFAQLLGCPQDDHGLTNVVYTCFEKQFIRIRTQEVFDIFVNEFPNSKPTIIEMRK 293
            +YWS F++L+GCP+DDH LT  V+ CFE  F+RIRT E+FDI V  +P+SK T++E+RK
Sbjct: 248 NQYWSQFSKLVGCPEDDHELTTTVFNCFESNFLRIRTNEIFDICVLAYPDSKVTLLELRK 307

Query: 294 LITHSTDFKTIVIAFLSTFEKKVLNPSVTTTDALLAYVKSVKAFLTLDPSGRYLQSVISF 353
           ++    D+  IV  FLS F+K +LNPSVTT DALL YVK++KAFL LDP+GR L S+ +F
Sbjct: 308 IMKDFKDYTNIVTTFLSDFKKYILNPSVTTVDALLRYVKTIKAFLVLDPTGRCLHSITTF 367

Query: 354 VKQTFQERSDLVVILLYAILDLQLDGLVGS-HIQVDPVCLKALASELRDPELGIENDIYP 412
           VK  FQER  LV +LLYA+LDL  + L    +  VD   L +L   L D ++  + +I  
Sbjct: 368 VKPYFQERKHLVNVLLYAMLDLPEEELKEKINFNVDMKALLSLVDTLHDSDINQDTNITK 427

Query: 413 DDN------LANVAT-GMAKLNYE----GCLPYEEVMQRFLSWNPDPRDMAPRAISKQSP 461
            D       L N+   G  +LN +      + YE ++  +++W P+P DM P  I K S 
Sbjct: 428 RDKNKKSPFLWNLKVKGKRELNKDLPIRHAMLYEHILNYYIAWVPEPNDMIPGNI-KSSY 486

Query: 462 SHMSLLDILMELFESKDFFVSEFXXXXXXXXXXXXFYNLDRNWSKCLQLLKKKLARGAPN 521
              +L ++L++LFES++FF+SEF            FY LD  W++CL+L+++K+ +    
Sbjct: 487 IKTNLFEVLLDLFESREFFISEFRNLLTDRLFTLKFYTLDEKWTRCLKLIREKIVK---- 542

Query: 522 ISLAPTGQQNNSERG-------------DDYSNINSNDVMLWDVKLSYELCKQMHQVSGL 568
                T   N    G              D SN+NS DVMLWD+K S ELC++MH+V+GL
Sbjct: 543 --FTETSHSNYITNGILGLLETTAPAADADQSNLNSIDVMLWDIKCSEELCRKMHEVAGL 600

Query: 569 DQRIYPKFISYLYW--NCQLESKND--FEIPEPLNSEFEKYSRVYSEVKAGRALKLLKDQ 624
           D  I+PKFIS LYW  NC  +  ND  F +P  L  E +KYS +YS++K GR L+L KD+
Sbjct: 601 DPIIFPKFISLLYWKYNCDTQGSNDLAFHLPIDLERELQKYSDIYSQLKPGRKLQLCKDK 660

Query: 625 GVIELDLEFKDGRVLQCDVTLEQYAVIQQFDE-DSYANRLMAETISLYLNMEISRVKSAL 683
           G +E+ L FKDGR L  DV+LEQ +VI QFD  +     L  E +S  LN+   R+   L
Sbjct: 661 GKVEIQLAFKDGRKLVLDVSLEQCSVINQFDSPNDEPICLSLEQLSESLNIAPPRLTHLL 720

Query: 684 QFWVEKGVLYQVDAFYATQESRQ---DSNIKTAKSDSVGSFFE-KNXXXXXXXXXLSKTL 739
            FW++KGVL + +  Y+  E  +   D   KTA  +   S +E  N         L  TL
Sbjct: 721 DFWIQKGVLLKENGTYSVIEHSEMDFDQAQKTAPMEIENSNYELHNDSEIERKYEL--TL 778

Query: 740 NAIWPFVQGMLTNLGSLKAAKIHSFLKVTVPKEVGYIVVTQSQLESYLNSLVEEERLACT 799
               PF++GMLTNLG++K  KIHSFLK+TVPK+ GY  +T  QLE YLN+L +E RL   
Sbjct: 779 QRSLPFIEGMLTNLGAMKLHKIHSFLKITVPKDWGYNRITLQQLEGYLNTLADEGRLKYI 838

Query: 800 TSGSYKL 806
            +GSY++
Sbjct: 839 ANGSYEI 845

>Smik_12.190 Chr12 complement(377110..379662) [2553 bp, 850 aa] {ON}
           YLR127C (REAL)
          Length = 850

 Score =  635 bits (1637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/839 (41%), Positives = 509/839 (60%), Gaps = 42/839 (5%)

Query: 6   SSELPVIIDSIKEVALRL-HPGCEDDLEALLTWLNPNESESNHHMRPPPLRLKDAIK-LF 63
           + +L VI D ++ ++  + H    DDL +LL W +PN+ +SNH +RPP LR+K+ IK LF
Sbjct: 8   TRDLKVITDELQTLSSYIFHTTIADDLNSLLIWTSPNDPKSNHQLRPPSLRIKNIIKVLF 67

Query: 64  VNQ-------YYNSGYISGS---DGEINKGPEFELGNQLRQFYIYQVRIHFFTSFNLIQT 113
            N          N+G  S S   +G  NK  + +L + L+++YI+QVR HFF+ F  I  
Sbjct: 68  PNSASTSPYSVVNTGQTSNSIVNEGNTNKELQLQLLSTLKEYYIFQVRYHFFSHFENINY 127

Query: 114 FKDIQRLEKYYVSPLAYIHLFESSGYEWIIERDGLRHYLLNRNMEFHNNMKQRMESLFMQ 173
            KDIQR E YY  PL Y+ +F+     W +E + LRHYLLNRNM+F NN++ R++ L M 
Sbjct: 128 LKDIQRWENYYEFPLRYVPIFDLDINGWSLELNSLRHYLLNRNMKFKNNLRTRLDKLIMD 187

Query: 174 DDFEYVAEMLDWVEKAHTXXXXXXXXXXXXXAKVKQFCDDHMMGVYGKTYLVMKTFNKFI 233
           DDF+    ++ W+  A                K+ +FC+D M GV+ K +++M+TFNKFI
Sbjct: 188 DDFDLADNLIQWLNSADGSLSSMELIVNALFNKINKFCEDTMSGVWNKRFMIMETFNKFI 247

Query: 234 IKYWSNFAQLLGCPQDDHGLTNVVYTCFEKQFIRIRTQEVFDIFVNEFPNSKPTIIEMRK 293
            +YWS F++L+GCP+DDH LT  V+ CFE  F+RIRT+E+FDI V  +PNSK T++E++K
Sbjct: 248 NQYWSQFSKLIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPNSKVTLLELKK 307

Query: 294 LITHSTDFKTIVIAFLSTFEKKVLNPSVTTTDALLAYVKSVKAFLTLDPSGRYLQSVISF 353
           ++    D+  IV  FLS F+K +LNPS+TT DALL YVK++KAFL LDP+GR L S+ +F
Sbjct: 308 IMKDFKDYANIVTTFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSITTF 367

Query: 354 VKQTFQERSDLVVILLYAILDLQLDGLVGS-HIQVDPVCLKALASELRDPELGIENDIYP 412
           VK  FQER  LV +LLYA+LDL  + L      +VD   L +L   L D ++    ++  
Sbjct: 368 VKPYFQERKHLVDLLLYAMLDLPEEELKEKITFKVDIKALISLVDTLHDSDISQFTNVM- 426

Query: 413 DDNLANVATGMAKLNYEG---------CLPYEEVMQRFLSWNPDPRDMAPRAISKQSPSH 463
             N       +  L  +G          + Y+ ++  +L+W P+P DM P ++ K S   
Sbjct: 427 KRNKNKKGPFLWNLKVKGKNGPSPTSQTMIYQHILNYYLTWVPEPNDMIPGSV-KSSCIK 485

Query: 464 MSLLDILMELFESKDFFVSEFXXXXXXXXXXXXFYNLDRNWSKCLQLLKKKLA--RGAPN 521
            +L ++L++LFES++FF+SEF            FY LD  W++CL+L+++K+   R   +
Sbjct: 486 TNLFEVLLDLFESREFFISEFRNLLTDRLFTLKFYKLDDKWTQCLKLIREKVVKFRETSH 545

Query: 522 ISLAPTG----QQNNSERGD-DYSNINSNDVMLWDVKLSYELCKQMHQVSGLDQRIYPKF 576
           ++    G     +  +   D D SN+NS DVMLWD+K S ELC++MH+V+GLD  I+PKF
Sbjct: 546 VNYITNGILGLPETTAPSADADQSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPAIFPKF 605

Query: 577 ISYLYW--NCQLESKND--FEIPEPLNSEFEKYSRVYSEVKAGRALKLLKDQGVIELDLE 632
           IS LYW  NC ++S N+  F +P  L  E +KYS VYS++K GR L+L KDQG +E++L 
Sbjct: 606 ISLLYWKYNCDMQSSNELTFHLPIHLKKELQKYSDVYSQLKPGRKLQLCKDQGKVEIELN 665

Query: 633 FKDGRVLQCDVTLEQYAVIQQFDE-DSYANRLMAETISLYLNMEISRVKSALQFWVEKGV 691
           FKDGR L  DV+LEQ +VI QFD  D+ +  L  E +S  LN+   R+   L FW++KGV
Sbjct: 666 FKDGRKLVLDVSLEQCSVINQFDSTDNKSISLTLEQLSDSLNITPPRLVHLLDFWIQKGV 725

Query: 692 LYQVDAFYATQESRQDSNIKTAKSDSVGSFFEKNXXXXXXXXXLSK----TLNAIWPFVQ 747
           + + +  Y+  E+ +    K  K   + +  E N           +    TL    PF++
Sbjct: 726 ISKENGVYSVIENCETDFDKVHKDIPMET--ENNNRGLRNESEAERKCELTLQRSLPFIE 783

Query: 748 GMLTNLGSLKAAKIHSFLKVTVPKEVGYIVVTQSQLESYLNSLVEEERLACTTSGSYKL 806
           GML NLG++K  KIHSFLK+TVPK+ GY  V+  QLE YL++L +E RL    +GSY++
Sbjct: 784 GMLANLGAMKLNKIHSFLKITVPKDWGYNRVSLQQLEQYLSALADEGRLKYIANGSYEI 842

>Skud_12.196 Chr12 complement(378532..381096) [2565 bp, 854 aa] {ON}
           YLR127C (REAL)
          Length = 854

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/850 (40%), Positives = 502/850 (59%), Gaps = 60/850 (7%)

Query: 6   SSELPVIIDSIKEVA-LRLHPGCEDDLEALLTWLNPNESESNHHMRPPPLRLKDAIK-LF 63
           + +L VI D ++ ++    H    DDL +LL W++PN+ +SNH +RPP LR+K+ IK LF
Sbjct: 8   TRDLKVITDQLQTLSSYVFHTNIADDLNSLLIWMSPNDPKSNHQLRPPSLRIKNIIKVLF 67

Query: 64  VNQYYNSGY----------ISGSDGEINKGPEFELGNQLRQFYIYQVRIHFFTSFNLIQT 113
            N    S Y              +G  NK  + +L + L+++Y++QVR HFF  FN I  
Sbjct: 68  PNNVSTSSYGVINSGQTINAVAGEGNTNKELQLQLLSTLKEYYVFQVRYHFFLRFNDIIY 127

Query: 114 FKDIQRLEKYYVSPLAYIHLFESSGYEWIIERDGLRHYLLNRNMEFHNNMKQRMESLFMQ 173
            KDIQR E YY  PL Y+ +F+ S  +W +E + LRHY+LNRN++F NN++ R+  L M 
Sbjct: 128 LKDIQRWENYYEFPLRYVPIFDLSVNDWSLELNSLRHYMLNRNIKFKNNLRVRLNKLIMD 187

Query: 174 DDFEYVAEMLDWVEKAHTXXXXXXXXXXXXXAKVKQFCDDHMMGVYGKTYLVMKTFNKFI 233
           DDF+    ++ W+  A+               K+++FC+ +M GV+ K +++M+TFNKFI
Sbjct: 188 DDFDLAGNLIRWLNFANGSLSSMELIVNALFNKIEKFCEANMSGVWNKRFMIMETFNKFI 247

Query: 234 IKYWSNFAQLLGCPQDDHGLTNVVYTCFEKQFIRIRTQEVFDIFVNEFPNSKPTIIEMRK 293
            +YWS F +L+ CP+DDH LT  V+ CFE  F+RIRT+E+FDI V  +P+SK  ++E++K
Sbjct: 248 NQYWSQFCELICCPEDDHELTTTVFNCFESNFLRIRTREIFDICVLAYPDSKVALLELKK 307

Query: 294 LITHSTDFKTIVIAFLSTFEKKVLNPSVTTTDALLAYVKSVKAFLTLDPSGRYLQSVISF 353
           ++    D+  IV  FLS F+K +LNPS+TT DALL YVK++KAFL LDP+GR L S+I+F
Sbjct: 308 IMKDFKDYTNIVTKFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSIITF 367

Query: 354 VKQTFQERSDLVVILLYAILDLQLDGLVGS-HIQVDPVCLKALASELRDPELGIENDIYP 412
           VK  FQER  LV +LLYA+LDL  + L      +VD   L +L   L D ++G   D + 
Sbjct: 368 VKPYFQERKHLVNVLLYAMLDLPEEELKEKITFKVDMKALLSLVDILHDYDIGQNTDAHK 427

Query: 413 DDNLANVATGMAKLNYEG------------CLPYEEVMQRFLSWNPDPRDMAPRAISKQS 460
             +    +  +  L  +G             + YE V+  +L+W P+P D+ P ++ K S
Sbjct: 428 SKDKNKRSPFLWNLKVKGKKETNEDPLARQTMLYEHVLNHYLTWVPEPNDIIPGSV-KSS 486

Query: 461 PSHMSLLDILMELFESKDFFVSEFXXXXXXXXXXXXFYNLDRNWSKCLQLLKKKLAR--- 517
               +L +IL++LFES++FF+SEF            FY LD  WS+CL+L+++++ +   
Sbjct: 487 YIKTNLFEILLDLFESREFFISEFRNLLTDRLSSLKFYKLDDKWSQCLKLIRERIVKFTE 546

Query: 518 ------------GAPNISLAPTGQQNNSERGDDYSNINSNDVMLWDVKLSYELCKQMHQV 565
                       G P  + AP           D SN+NS DVMLWD+K S ELC++MH+V
Sbjct: 547 TNHANYITNGILGLPETT-APAADA-------DQSNLNSIDVMLWDIKCSEELCRKMHEV 598

Query: 566 SGLDQRIYPKFISYLYWNCQLESKN----DFEIPEPLNSEFEKYSRVYSEVKAGRALKLL 621
           +GLD  ++PKFIS LYW    +++N     F IP  L  E +KYS +YS++K GR L+L 
Sbjct: 599 AGLDPTVFPKFISLLYWKHNGDTQNPKDSKFRIPADLERELQKYSDIYSQMKPGRRLQLC 658

Query: 622 KDQGVIELDLEFKDGRVLQCDVTLEQYAVIQQFD--EDSYANRLMAETISLYLNMEISRV 679
           KDQG +E++L F+DGR L  DV+LEQY+V+ QF+   D   N L  + +S  LN+  S++
Sbjct: 659 KDQGKVEMELSFRDGRKLVLDVSLEQYSVMNQFNSTNDEPIN-LSLKQLSESLNITTSKL 717

Query: 680 KSALQFWVEKGVLYQVDAFYATQESRQDSNIKTAKSDSVGSFFEKNXXXXXXXXXLSK-- 737
              L FW++KGVL +    Y+  E   D+     + D +      N           K  
Sbjct: 718 LQLLNFWIQKGVLSEEGEVYSVIE-YSDTGFSQTQKDVLMKNVNNNNELRDESEVEKKCE 776

Query: 738 -TLNAIWPFVQGMLTNLGSLKAAKIHSFLKVTVPKEVGYIVVTQSQLESYLNSLVEEERL 796
            TL    PF++GML NLG++K  KIHSFLK+TVPK+ GY  +T  QLE YLN+L +E +L
Sbjct: 777 LTLQRSLPFIEGMLANLGAMKLNKIHSFLKITVPKDWGYNRITLLQLEKYLNTLTDEGKL 836

Query: 797 ACTTSGSYKL 806
               +GSY++
Sbjct: 837 KYIANGSYEI 846

>Suva_10.220 Chr10 complement(404296..406860) [2565 bp, 854 aa] {ON}
           YLR127C (REAL)
          Length = 854

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/854 (40%), Positives = 498/854 (58%), Gaps = 68/854 (7%)

Query: 6   SSELPVIIDSIKEVALRL-HPGCEDDLEALLTWLNPNESESNHHMRPPPLRLKDAIK-LF 63
           + +L +I D ++ ++  + H    DDL +LL W++P++ +SNH +RPP LR+K+ IK LF
Sbjct: 8   TRDLKIITDELQTLSSYIFHTNITDDLNSLLIWMSPDDPKSNHQLRPPSLRIKNIIKNLF 67

Query: 64  VNQYYNSGYISGS----------DGEINKGPEFELGNQLRQFYIYQVRIHFFTSFNLIQT 113
            N    S Y + +          +G  NK  + +  +  +++YI+QVR HFF  F+ I  
Sbjct: 68  PNNACTSSYGAMNTAQANNSIVNEGNTNKELQLQFISTFKEYYIFQVRYHFFLHFSSINY 127

Query: 114 FKDIQRLEKYYVSPLAYIHLFESSGYEWIIERDGLRHYLLNRNMEFHNNMKQRMESLFMQ 173
            KDIQR E YY  PL Y+ +F+ +   W +E + LRHYLLNRN +F NN++ R+  L + 
Sbjct: 128 LKDIQRWENYYEFPLRYVSIFDLNVNGWTLELNSLRHYLLNRNTKFKNNLRTRLNKLIID 187

Query: 174 DDFEYVAEMLDWVEKAHTXXXXXXXXXXXXXAKVKQFCDDHMMGVYGKTYLVMKTFNKFI 233
           DDF+  + ++ W+  A+               K+  FC+ +M GV+ K +++M+TFNKFI
Sbjct: 188 DDFDLASNLIRWLNSANGSLSSMDLIVNALFDKISMFCEINMSGVWNKRFMIMETFNKFI 247

Query: 234 IKYWSNFAQLLGCPQDDHGLTNVVYTCFEKQFIRIRTQEVFDIFVNEFPNSKPTIIEMRK 293
            +YWS F++L+GCP+DDH LT  V+ CFE  F+RIRT+E+FDI V  +P SK T++E++K
Sbjct: 248 NQYWSQFSELIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPGSKITLLELKK 307

Query: 294 LITHSTDFKTIVIAFLSTFEKKVLNPSVTTTDALLAYVKSVKAFLTLDPSGRYLQSVISF 353
           ++    D+  IV  FLS F+K +LNPS+TT DALL+YVK++KAFL LDP+GR L S+ +F
Sbjct: 308 IMKDFKDYTNIVTTFLSDFKKHILNPSITTVDALLSYVKTIKAFLVLDPTGRCLHSITTF 367

Query: 354 VKQTFQERSDLVVILLYAILDLQLDGLVGS-HIQVDPVCLKALASELRDPELGIENDIYP 412
           VK  FQER  LV +LLYAILDL  + L      +VD   L  L   L D ++        
Sbjct: 368 VKPYFQERKHLVNVLLYAILDLPEEELKEKISFKVDMKALLLLVETLHDSDI-------- 419

Query: 413 DDNLANVATGMAKLNYEGCLP----------------------YEEVMQRFLSWNPDPRD 450
            D + N      K N  G  P                      YE ++  +L+W P+P D
Sbjct: 420 -DQITNTPKSKDK-NKGGSFPWNLHVKGKKEKNGSSSITQSMLYEHILNYYLTWVPEPND 477

Query: 451 MAPRAISKQSPSHMSLLDILMELFESKDFFVSEFXXXXXXXXXXXXFYNLDRNWSKCLQL 510
           M P  I K S    +L ++L++LFES++FF+SEF            FY LD  WS+CL+L
Sbjct: 478 MIPGNI-KSSSIKTNLFEVLLDLFESREFFISEFRNLLTDRLFTLKFYKLDNKWSRCLKL 536

Query: 511 LKKKLARGAPN-----ISLAPTG-QQNNSERGD-DYSNINSNDVMLWDVKLSYELCKQMH 563
           +++K+ +         I+    G  Q  +   D D SNINS DVMLWD+K S ELC +MH
Sbjct: 537 IREKIVKSTETNQTNYIANGIIGLPQTTAPAADADLSNINSIDVMLWDIKCSEELCLKMH 596

Query: 564 QVSGLDQRIYPKFISYLYWNCQLESKN----DFEIPEPLNSEFEKYSRVYSEVKAGRALK 619
           +V+GLD  IYPKFIS LYW    ++ N     F +P  L +E +KYS +YS++K GR L+
Sbjct: 597 EVAGLDPAIYPKFISLLYWKHNGDTNNANELTFHLPGNLENELQKYSDIYSQLKPGRKLQ 656

Query: 620 LLKDQGVIELDLEFKDGRVLQCDVTLEQYAVIQQFDE-DSYANRLMAETISLYLNMEISR 678
           L KDQG IE++L+F DGR L  DV+LEQ +VI QF+  D     L  E +S  LN+  +R
Sbjct: 657 LCKDQGKIEMELDFNDGRKLVLDVSLEQCSVINQFNSTDGEPIYLSLEQLSEPLNIAPAR 716

Query: 679 VKSALQFWVEKGVLYQVDAFYATQE-SRQDSN-----IKTAKSDSVGSFFEKNXXXXXXX 732
           +   L FW+++GVL + +  Y+  E SR D N           ++     ++        
Sbjct: 717 LLDLLNFWIQRGVLSEENGVYSVIEYSRTDFNQTQIEFPMKNENNNNELRDETEVERKCE 776

Query: 733 XXLSKTLNAIWPFVQGMLTNLGSLKAAKIHSFLKVTVPKEVGYIVVTQSQLESYLNSLVE 792
             L ++L    PF++GML NLG++K  KIHSFLK+TVPK  GY  +T  QLE YLN L +
Sbjct: 777 LILERSL----PFIEGMLANLGAMKLNKIHSFLKITVPKNWGYNRITLLQLEKYLNVLAD 832

Query: 793 EERLACTTSGSYKL 806
           E +L   T+GSY+L
Sbjct: 833 EGKLKYITNGSYEL 846

>KLTH0G12342g Chr7 (1048457..1050781) [2325 bp, 774 aa] {ON} similar
           to uniprot|Q7LGV7 Saccharomyces cerevisiae YLR127C
          Length = 774

 Score =  518 bits (1335), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 298/806 (36%), Positives = 452/806 (56%), Gaps = 51/806 (6%)

Query: 14  DSIKEVALRLHP-------GCEDDLEALLTWLNPNESESNHHMRPPPLRLKDAIKLFVNQ 66
           D  +E++ +LH          EDDLE +LTW+NPNE  SNH MRPP LR+K AIK  +N 
Sbjct: 5   DEGRELSEQLHSLLHDVDSSLEDDLEGILTWVNPNEPGSNHQMRPPSLRVKSAIKSLLN- 63

Query: 67  YYNSGYISGSDGEINKGPEFELGNQLRQFYIYQVRIHFFTSFNLIQTFKDIQRLEKYYVS 126
                      G +      +L   L ++ I+Q R HFF ++  +  FKD+Q+LE+YY  
Sbjct: 64  -----------GVVTSESFIDL---LGKYMIFQTRKHFFLNYQSLLYFKDVQKLERYYEF 109

Query: 127 PLAYIHLFESSGYEWIIERDGLRHYLLNRNMEFHNNMKQRMESLFMQDDFEYVAEMLDWV 186
           P  Y+++F S   EW  E  GLR+YL+ +N    NN++ R+E L  +DDF+   ++ +W+
Sbjct: 110 PTRYVNIFSSE--EWCDEMSGLRNYLIRQNSGLKNNIQLRLEQLVHEDDFDMACKIYEWL 167

Query: 187 EKAHTXXXXXXXXXXXXXAKVKQFCDDHMMGVYGKTYLVMKTFNKFIIKYWSNFAQLLGC 246
            +A               +KVK F   +M   + + + +M+ +N F+  YWS F ++L C
Sbjct: 168 CQAEGRLLPEILVDVLL-SKVKLFASKNMNSAWTQRFTIMEAYNLFVTNYWSVFCRMLQC 226

Query: 247 PQDDHGLTNVVYTCFEKQFIRIRTQEVFDIFVNEFPNSKPTIIEMRKLITHSTDFKTIVI 306
            +DDH +TN +Y CFE++FIRIRT +VFDIFV  FP +KPT++E+R ++  S  +  ++ 
Sbjct: 227 MEDDHEITNEIYRCFEEEFIRIRTSQVFDIFVTGFPTTKPTLLELRSVLKTSVKYTELIT 286

Query: 307 AFLSTFEKKVLNPSVTTTDALLAYVKSVKAFLTLDPSGRYLQSVISFVKQTFQERSDLVV 366
            FL  FE K+LNPS+TT + LL+YV+++K+ L +D S RY Q + +FV+    ER D V 
Sbjct: 287 EFLYQFESKMLNPSITTAEILLSYVRAIKSILIVDVSFRYFQLLTNFVRPYLMERHDTVA 346

Query: 367 ILLYAILDLQLDGLVGSHIQVDPVCLKA-LASELRDPELGIENDIYPDDNLANVATGMAK 425
             LYA+L L    L   +     + + + L++ELR     I +      NL +    ++ 
Sbjct: 347 TFLYAMLGLDASDLSSKNSTSTHMSIASQLSAELRGSHQPISSSTAERGNLPHGKHALSM 406

Query: 426 LNYEGCLPYEEVMQRFLSWNPDPRDMAPRAISKQSPSHMSLLDILMELFESKDFFVSEFX 485
             YE    Y++++  +L WNP+P D + +A + Q+     L DI++ELF+SKD  V EF 
Sbjct: 407 NPYEPA--YQQIIDYYLHWNPEPAD-SIQANNDQALISKELFDIIVELFDSKDVIVREFL 463

Query: 486 XXXXXXXXXXXFYNLDRNWSKCLQLLKKKLARGAPNISLAPTGQQNNSERGDDYSNINSN 545
                       Y L+ NW + L+++KKKL     +     + Q+        +SNIN+ 
Sbjct: 464 GLFTRKLLGLRGYKLESNWVQSLKVVKKKL-----DFKTYSSAQE--------FSNINNI 510

Query: 546 DVMLWDVKLSYELCKQMHQVSGLDQRIYPKFISYLYWNCQLESK---NDFEIPEPLNSEF 602
           DVML DVK S ELC  MH+  GL  RI PKF+SYL+WN   +      D  +P+ L ++ 
Sbjct: 511 DVMLRDVKHSEELCSLMHEKLGLSDRIIPKFVSYLFWNAHSDFSALPKDHPLPKELEADI 570

Query: 603 EKYSRVYSEVKAGRALKLLKDQGVIELDLEFKDGRVLQCDVTLEQYAVIQQFDEDSYANR 662
             Y + Y+ VK GR L+L  +Q ++EL L   DGR L  +VTL++  V+     +     
Sbjct: 571 NNYKKAYTNVKKGRKLRLHPEQSIVELQLRLADGRDLNYEVTLDEALVLSYLSSNGDGT- 629

Query: 663 LMAETISLYLNMEISRVKSALQFWVEKGVL-YQVDAFYATQESRQDSNIKTA-KSDSVGS 720
              E I    N++IS+V+ +L+FWV+  +L Y  +    + E RQ+ ++K A +  S   
Sbjct: 630 --VEEIVKQTNLDISQVEKSLKFWVKSSILRYSTETSRYSVEERQNVDVKHAVERQSSSE 687

Query: 721 FFEKNXXXXXXXXXLSKTLNAIWPFVQGMLTNLGSLKAAKIHSFLKVTVPKEVGYIVVTQ 780
                            ++  + PF++GMLTNLGSLKA KIHSFLK+ VPKE+GY   T 
Sbjct: 688 IVNATDSVDLQQQQFIDSMQKVLPFIKGMLTNLGSLKADKIHSFLKMAVPKEIGY-SATP 746

Query: 781 SQLESYLNSLVEEERLACTTSGSYKL 806
           SQL+ YLN+LVEE +L  T +G+++L
Sbjct: 747 SQLQLYLNALVEESKLVKTPNGAFRL 772

>Kwal_56.23909 s56 complement(771248..773578) [2331 bp, 776 aa] {ON}
           YLR127C (APC2) - subunit of the anaphase promoting
           complex (APC) [contig 171] FULL
          Length = 776

 Score =  516 bits (1329), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 293/797 (36%), Positives = 451/797 (56%), Gaps = 54/797 (6%)

Query: 21  LRLHP-GCEDDLEALLTWLNPNESESNHHMRPPPLRLKDAIKLFVNQYYNSGYISGSDGE 79
           LR H    +DDLE++LTW+NPNE  SNH +RPP LRLK AIK+ +N+  N          
Sbjct: 18  LRGHDITVDDDLESVLTWINPNEPTSNHQLRPPSLRLKSAIKILINENGN---------- 67

Query: 80  INKGPEFELGNQLRQFYIYQVRIHFFTSFNLIQTFKDIQRLEKYYVSPLAYIHLFESSGY 139
              GP   L + LRQ+ I+Q R HFF  +  +  FKD+Q+LE+YY  PL ++ LF     
Sbjct: 68  ---GPA--LTDILRQYLIFQTRKHFFAHYYSLCHFKDVQKLERYYEFPLRFVRLFNRE-- 120

Query: 140 EWIIERDGLRHYLLNRNMEFHNNMKQRMESLFMQDDFEYVAEMLDWVEKAHTXXXXXXXX 199
           EW  E +GLR+YL+++N+ F+ N + R+  L ++DDFE   ++ +W+ +A          
Sbjct: 121 EWAEEINGLRNYLISKNLVFNRNARLRLRQLVLEDDFEMACKLYEWLCRAEGRLLTHLLV 180

Query: 200 XXXXXAKVKQFCDDHMMGVYGKTYLVMKTFNKFIIKYWSNFAQLLGCPQDDHGLTNVVYT 259
                +KVK F   HM   + K ++ ++ +N FI KYWS  +Q+L CP+DDH +TN +Y 
Sbjct: 181 DAVL-SKVKAFALKHMEEAWSKRFVTVELYNLFISKYWSTLSQMLQCPEDDHDVTNEIYR 239

Query: 260 CFEKQFIRIRTQEVFDIFVNEFPNSKPTIIEMRKLITHSTDFKTIVIAFLSTFEKKVLNP 319
           CFE++FIRIRTQ+ F IFV  +P S+PT++E+R ++     +  +V   LS FE ++LNP
Sbjct: 240 CFEEEFIRIRTQQAFKIFVTGYPESEPTLLELRSVLKTPAKYTQLVTELLSQFEARMLNP 299

Query: 320 SVTTTDALLAYVKSVKAFLTLDPSGRYLQSVISFVKQTFQERSDLVVILLYAILDLQLDG 379
           S+TT + LL+YVK++K+ LT+D S RY Q +  FV+    ER D VV  LYA+L L    
Sbjct: 300 SITTAEILLSYVKAIKSILTIDVSFRYFQLLTDFVRPFLMERRDTVVTFLYAMLGLDASE 359

Query: 380 L-----VGSHIQVDPVCLKALASELRDPELGIENDIYPDDNLANVATGMAKLNYEGCLPY 434
                  G+H  +       L++EL+D    I      D +  +    MA +N +  + Y
Sbjct: 360 TRGPKPTGAHASI----ASQLSAELKDSHQPIFRSAL-DKSAQSPVDDMASVNPKEPV-Y 413

Query: 435 EEVMQRFLSWNPDPRDMAPRAISKQSPSHMSLLDILMELFESKDFFVSEFXXXXXXXXXX 494
           ++V+  +L W P+P D + +A +  +  +  L DI++ELF+SKD  + EF          
Sbjct: 414 QQVINFYLHWTPEPSD-SIQANNSDTLMNKGLFDIIVELFDSKDIIIGEFLTLFTDKLLD 472

Query: 495 XXFYNLDRNWSKCLQLLKKKLARGAPNISLAPTGQQNNSERGDDYSNINSNDVMLWDVKL 554
              Y L++NW K L++LK +                 N       SNIN+ DVML DVK 
Sbjct: 473 LKGYRLEQNWVKSLKILKNRF-------------DFKNYSNAQGVSNINNIDVMLRDVKH 519

Query: 555 SYELCKQMHQVSGLDQRIYPKFISYLYWNCQLESKN---DFEIPEPLNSEFEKYSRVYSE 611
           S ELC QMH V  + + + P FISYL+WN   +      D  +P  L SE  KY  +Y++
Sbjct: 520 SEELCAQMHSVPEISREVIPMFISYLFWNAGSKFSTLPKDCRLPSQLESEIRKYKDMYAQ 579

Query: 612 VKAGRALKLLKDQGVIELDLEFKDGRVLQCDVTLEQYAVIQQFDEDSYANRLMAETISLY 671
           +K GR L+L ++Q  + L L F D RV+  +V++++ +V+    E +  +R   + I   
Sbjct: 580 IKPGRKLRLHQEQSTVVLQLHFADKRVMDFEVSMDKSSVLACVAETTGISR---DKIVEA 636

Query: 672 LNMEISRVKSALQFWVEKGVLY--QVDAFYATQESRQDSNIKTAKSDSVGSFFEKNXXXX 729
             +E ++V   L+FW++  VL      + Y++ E RQD++  + +   + +  +      
Sbjct: 637 TGLEKAQVDQNLRFWLDASVLRFDSKTSLYSSLE-RQDTDNASEREAQMRAEDQARSAFD 695

Query: 730 XXXXXLSKTLNAIWPFVQGMLTNLGSLKAAKIHSFLKVTVPKEVGYIVVTQSQLESYLNS 789
                  +++  +WPF++GMLTNLG+LK  KIHSFLKV VPKE+G+   T +QLE+YL  
Sbjct: 696 SQQQQFVESMEKVWPFIRGMLTNLGTLKVEKIHSFLKVAVPKEIGFNATT-AQLEAYLRL 754

Query: 790 LVEEERLACTTSGSYKL 806
           LV+E +L C+ + ++KL
Sbjct: 755 LVDENKLVCSANNAFKL 771

>TPHA0C00830 Chr3 (163528..166056) [2529 bp, 842 aa] {ON} Anc_8.321
           YLR127C
          Length = 842

 Score =  476 bits (1226), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 299/857 (34%), Positives = 464/857 (54%), Gaps = 75/857 (8%)

Query: 7   SELPVIIDSIKEVALRLHPGCEDDLEALLTWLNPNESESNHHMRPPPLRLKDAIK---LF 63
           +E+  I+ +I E+      G  DD+++LL WLNPN+ +SNH ++PP +RLK  IK   L 
Sbjct: 4   TEVDSIVGNIYELVDSKSCGSSDDIDSLLDWLNPNDPKSNHQLKPPTIRLKKVIKKILLD 63

Query: 64  VNQYYNSGYISGSDGEINKGPEFELGNQLRQFYIYQVRIHFFTSFNLIQTFKDIQRLEKY 123
           VN   +   I              L + LR +YI+QVR++FF++   I  FKDI +LEKY
Sbjct: 64  VNTLGDYDSIET------------LNSLLRYYYIFQVRLNFFSNLQSITYFKDIIKLEKY 111

Query: 124 YVSPLAYIHLFESSGYEWIIERDGLRHYLLNRNMEFHNNMKQRMESLFMQDDFEYVAEML 183
           Y  P+ ++ +F ++ Y W  E + +RHYLL  N+ F +N+  R++ L  +DDF+   E++
Sbjct: 112 YEFPILHVPIFLNNNYIWETELNKIRHYLLRTNLTFRSNLINRLKKLVKEDDFDLAQEII 171

Query: 184 DWVEKAH-TXXXXXXXXXXXXXAKVKQFCDDHMMGVYGKTYLVMKTFNKFIIKYWSNFAQ 242
            W  +A+ +              K+  + D      + + +++M+T+NKFI KYWSNFA 
Sbjct: 172 KWSNEANFSLLSSKQIILNALLDKITMYADKQFTNAWSQRFIIMETYNKFINKYWSNFAV 231

Query: 243 LLGCPQDDHGLTNVVYTCFEKQFIRIRTQEVFDIFVNEFPNSKPTIIEMRKLITHSTDFK 302
           LL C +DDH +T V+Y  FEKQF+RIR++E+FDI V  +P+SKPTI+E+R L+T S    
Sbjct: 232 LLNCAEDDHEITKVLYKYFEKQFLRIRSEEIFDICVISYPDSKPTIMELRGLLTQSKIST 291

Query: 303 TIVIAFLSTFEKKVLNPSVTTTDALLAYVKSVKAFLTLDPSGRYLQSVISFVKQTFQERS 362
            I+I  LS F+ KVLN S+ T   L+AY+K+VK+ L LDP+ RYLQS  SF     Q++S
Sbjct: 292 NILIRLLSEFQLKVLNLSIPTCTILIAYIKTVKSLLILDPTSRYLQSFTSFTNPYLQQKS 351

Query: 363 DLVVILLYAILDLQLDGLVGSHI-QVDPVCLKALASELRDPELGI-----ENDIYPDDNL 416
           D++ ILL+AILDL+ D +  + I +VD   LK L+ ELR+   GI     + DI  +   
Sbjct: 352 DIIYILLFAILDLRTDDIKTNPIVKVDQNLLKLLSEELRESHFGINLNFSDVDISDNLEN 411

Query: 417 ANVATGMAKLNYEG----CLPYEEVMQRFLSWNPDPRDMAPRAISKQSPSHMSLLDILME 472
            N    +++L+Y G     L Y +++ R L+W P+ + ++P   S +     +LLDIL  
Sbjct: 412 GNNNKNISQLDYAGQESSQLLYSQILNRALTWLPESKLVSPNK-SIKMMRKKNLLDILFA 470

Query: 473 LFESKDFFVSEFXXXXXXXXXXXXFYNLDRNWSKCLQLLKKKLARGAPN-ISLAPTGQQN 531
           +F+  + F+  F             YNL+ +W +CL+L K K    +PN +  APT    
Sbjct: 471 IFDDHELFLKRFVELLKQKLFVIKGYNLEESWVQCLRLFKTKF---SPNSLDDAPTSTNL 527

Query: 532 NSERGDDYSNINSN-DVMLWDVKLSYELCKQMHQVSGLDQRIYPKFISYLYWNCQLESKN 590
            +  G++ S   +N DVMLWD++ S +L +QMH +  LD RI  K IS LYW  Q + KN
Sbjct: 528 ETLTGNNDSMYMTNIDVMLWDMRGSKKLTEQMHLIDELDNRINLKIISSLYW--QYDMKN 585

Query: 591 D---------FEIPEPLNSEFEKYSRVYSEVKAGRALKLLKDQGVIELDLEFKDGRVLQC 641
           +          ++ + L ++ +KYS++YS +K GR L LL DQ  IE+D  F+D R + C
Sbjct: 586 EKRKTYYGLLNKMDQTLFNQLDKYSKLYSRLKPGRVLNLLTDQSTIEIDFNFEDNRTVTC 645

Query: 642 DVTLEQYAVIQQFDEDSYANRLMAETISLYLNMEISRVKSALQFWVEKGVLYQVDAFYAT 701
           + T E Y  I  F E+   +    E +S+  +  +  +K +L+FW+++ +LY     Y  
Sbjct: 646 ECTFENYMSICPFLENEGTSSYTLEELSIITSFGLEDLKISLKFWLDQKILYFDGKTYRP 705

Query: 702 QE--SRQDSNIKTAKSDSVGSFFEKNXXXXXXXXXLS----------------------K 737
            E   R +  I++ +S++V S              L                       K
Sbjct: 706 LEYLDRSEIIIESPESNNVNSVMSITNNPLNGFAILGKGNDTIDRPSQENITKCTPDHDK 765

Query: 738 TLNA-------IWPFVQGMLTNLGSLKAAKIHSFLKVTVPKEVGYIVVTQSQLESYLNSL 790
           T NA       I  +V  +LTNLG     K+++ L+ T   +     V+   LE+ +  L
Sbjct: 766 TFNATSQEVSKIKEYVLSILTNLGEQNIEKLYNVLQ-TTSHDTAIKKVSSVTLENIVTEL 824

Query: 791 VEEERLACTTSGSYKLP 807
           VE  ++ C  +G Y+LP
Sbjct: 825 VENGQILCLPNGLYQLP 841

>TBLA0A03920 Chr1 complement(980348..982546) [2199 bp, 732 aa] {ON}
           Anc_8.321 YLR127C
          Length = 732

 Score =  472 bits (1214), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 272/747 (36%), Positives = 415/747 (55%), Gaps = 57/747 (7%)

Query: 1   MSECHSSELPVIIDSIKEVALRLHP--GCEDDLEALLTWLNPNESESNHHMRPPPLRLKD 58
           MS  +   L  I   +KE +  L P     D+LE LL WL+PN+  SNHH+ PP L+LK 
Sbjct: 1   MSLINELTLTDIKQQLKESSKLLSPYKDISDELETLLIWLDPNDPNSNHHLHPPTLQLKT 60

Query: 59  AIKLFVNQYYNSGYISGSDGEINKGPEFELGNQ----LRQFYIYQVRIHFFTSFNLIQTF 114
            IK           I+ S  +I K P   + N     L+ FY+YQVR +FF   + I+ +
Sbjct: 61  IIK----------QITPS-SDIYKDPSNSIKNNIQNWLKLFYVYQVRTYFFKKIDNIRQY 109

Query: 115 KDIQRLEKYYVSPLAYIHLFESSGYEWIIERDGLRHYLLNRNMEFHNNMKQRMESLFMQD 174
           KD+ +LEKYY  PL +I LF  +  EW  E   LRHY+L++N EF   +   +  L  ++
Sbjct: 110 KDMIKLEKYYQFPLQFIPLF--TFQEWCFELLSLRHYILHQNKEFTQKIILELRQLIKEE 167

Query: 175 DFEYVAEMLDWVEKAHTXXXXXXXXXXXXXAKVKQFCDDHMMGVYGKTYLVMKTFNKFII 234
           DFE   +++ W+ +  +              K+  +C+  M G + + YLVM+T+N F++
Sbjct: 168 DFETSLDIVTWIREVDSNLLSENFILDILLEKITLYCEQTMKGNWTRRYLVMETYNTFMM 227

Query: 235 KYWSNFAQLLGCPQDDHGLTNVVYTCFEKQFIRIRTQEVFDIFVNEFPNSKPTIIEMRKL 294
            YW NF QLL C +D+H +TN+++  FEKQFI+IR QE+F I +  +P++KPT++E+R L
Sbjct: 228 NYWLNFTQLLNCKEDNHKITNILFKYFEKQFIKIRIQEIFKICILSYPDTKPTLLELRNL 287

Query: 295 ITHSTDFKTIVIAFLSTFEKKVLNPSVTTTDALLAYVKSVKAFLTLDPSGRYLQSVISFV 354
           +     F+ +V+ FLS FE+ VL P++ T D LLAY+++VK+F  LDPSGRYL S+ +++
Sbjct: 288 LVTYNFFQKLVVNFLSAFERIVLTPTINTIDCLLAYIRTVKSFQILDPSGRYLYSITNYI 347

Query: 355 KQTFQERSDLVVILLYAILDLQLDGLVGS--HIQVDPVCLKALASELRDPELGIENDIYP 412
              F+ER  L  ILL+AIL L    L  +   I+V  + LK + +EL DPELGIEN    
Sbjct: 348 NPHFRERKMLAPILLHAILALPKIDLENAIYPIKVSSISLKLIINELEDPELGIENTSTK 407

Query: 413 DDN---------------------LANVATGMAKLNYEGCLPYEEVMQRFLSWNPDPRDM 451
            ++                     L ++    +  +    L  ++V+++FL+W P P D+
Sbjct: 408 KNSIKKFNEILSPKRFNNHNSSEYLPDLLQNTSSEDSNSTLLVQKVVKQFLTWVPIPNDI 467

Query: 452 APRAISKQSPSHMSLLDILMELFESKDFFVSEFXXXXXXXXXXXXFYNLDRNWSKCLQLL 511
           A    +K+  S  +LLDIL+ +FESK+F ++EF             Y L+  W  CLQLL
Sbjct: 468 ATND-TKKLYSSTNLLDILLNIFESKEFLLTEFSKLLSKRLLITKNYKLEGKWGACLQLL 526

Query: 512 KKKLARGAPNISLAPTGQQNNSERGDDYSNINSNDVMLWDVKLSYELCKQMHQVSGLDQR 571
           +K+ + G+ N +       +N   G++    N N VML D+  S ELCK  H  +G++ R
Sbjct: 527 RKRFSSGSDNYTNTNLADTDNLVNGENLKITNMN-VMLSDLNYSSELCKIFHHANGVNTR 585

Query: 572 IYPKFISYLYW---------NCQLESKNDFEIPEPLNSEFEKYSRVYSEVKAGRALKLLK 622
           +YPKFIS  YW         N   E  N F+IP  L   FE+Y+++Y ++  GR + +  
Sbjct: 586 VYPKFISSHYWVDLDDENVSNGPNEETNHFQIPPSLLGYFEEYAKLYEDLNEGRKVDIWP 645

Query: 623 DQGVIELDLEFKDGRVLQCDVTLEQYAVIQQFDEDSYANR----LMAETISLYLNMEISR 678
           ++GVIE+ L F+DGRVL+ D TL QYA++Q   E +   +         +S+ LN+ +  
Sbjct: 646 NEGVIEIKLSFEDGRVLEIDATLPQYALLQYIQEKNAIMQNNQGFTVNELSVPLNLSLQN 705

Query: 679 VKSALQFWVEKGVLYQVDAFYATQESR 705
           V   + FW++K VL +VD  Y+  E +
Sbjct: 706 VTELVDFWLKKNVLKKVDDKYSILEYK 732

>NCAS0C03280 Chr3 (644169..646604) [2436 bp, 811 aa] {ON} Anc_8.321
           YLR127C
          Length = 811

 Score =  422 bits (1086), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 270/847 (31%), Positives = 437/847 (51%), Gaps = 90/847 (10%)

Query: 7   SELPVIIDSIKE-VALRLHPGCEDDLEALLTWLNPNESESNHHMRPPPLRLKDAIKLFVN 65
           ++LP II S++E V  + HP     LE+LL WL+PN S+     +PP L LKD I L   
Sbjct: 5   ADLPTIITSLREQVERQFHP----QLESLLLWLDPNSSKGTRQNKPPTLELKDCINLL-- 58

Query: 66  QYYNSGYISGSDGEINKGPEFELGNQLRQFYIYQVRIHFFTSFNLIQTFKDIQRLEKYYV 125
               +GY        ++  +F++   LR++Y+Y V+ HF  + + I   KD + LE  Y+
Sbjct: 59  ---RAGY--------SQDEKFKMW--LREYYLYVVKFHFMKNVDEISVLKDFKLLEMIYI 105

Query: 126 SPLAYIHLFESSGYEWIIERDGLRHYLLNRNMEFHNNMKQRMESLFM---QDDFEY---- 178
            PL ++ L +S+    +++    +HYL+++N+ F  N+  + +  F+   Q +FEY    
Sbjct: 106 YPLQFMDLVDSTDISNLVK--SFKHYLIDKNVTFRKNLITKFKDCFLVGNQFEFEYEFAN 163

Query: 179 VAEMLDWVEKAHTXXXXXXXXXXXXXAKVKQFCDDHMMGVYGKTYLVMKTFNKFIIKYWS 238
           + E++ W++ +                K++ F  + M+G   + ++VM+TFNKFI  YW 
Sbjct: 164 IVEIIHWIQDSEGVLSATDLILDASLTKIEIFAREQMIGKLNQKFIVMETFNKFIDIYWK 223

Query: 239 NFAQLLGCPQDDHGLTNVVYTCFEKQFIRIRTQEVFDIFVNEFPNSKPTIIEMRKLITHS 298
           N  QL+G  +DDH LTN++Y  FE+QFI+IR +E+  I V ++P +KPTI+E++ +++  
Sbjct: 224 NLTQLIGNIEDDHDLTNLIYQFFERQFIKIRIEEILTIMVQDYPQTKPTILELKSILSKQ 283

Query: 299 TD---------------FKTIVIAFLSTFEKKVLNPSVTTTDALLAYVKSVKAFLTLDPS 343
                             K ++  FL TF+++ LNP + T D L AYVK+ K+FL LDPS
Sbjct: 284 NSSTAGARKRGRRKDEWSKKLLKQFLVTFKREFLNPCIPTIDVLNAYVKATKSFLLLDPS 343

Query: 344 GRYLQSVISFVKQTFQERS-DLVVILLYAILDLQLDGLVGSHIQVDPVCLKALASELRDP 402
           G  L S++ FVK   +    ++V ILLYA+L+L+   L+  + +     ++++  EL   
Sbjct: 344 GSLLNSIVIFVKPYLRSNEVEMVDILLYALLNLKSKDLIELNCEKTTYDMRSI--ELLSK 401

Query: 403 ELGIENDIYPDDNLANVATGMAKLNYEG-------CLPYEEVMQRFLSWNPDPRDMAPRA 455
           EL  ++  +  D          K + EG        LPYE+V   FL+W P    ++  +
Sbjct: 402 ELSNDHSKHAGD------VDYKKFSPEGTNEFENSTLPYEQVYTDFLNWKPSITPISESS 455

Query: 456 ISKQSPS---HMSLLDILMELFESKDFFVSEFXXXXXXXXXXXXFYNLDRNWSKCLQLLK 512
              +  S   +++ +D +    ESKD  +SEF             Y ++  W KCL++L+
Sbjct: 456 NDDEFASLGKNITPIDYVFNALESKDKLISEFLKLLTIKLLHMKGYEVEDRWQKCLKILQ 515

Query: 513 KKLARGAPNISLAPTGQQNNSERGDDYSNINSNDVMLWDVKLSYELCKQMHQVSGL---- 568
            K+           T  +N        S+IN+  +ML D+ +S E   +  ++S      
Sbjct: 516 DKV-----------TSDKNIVNDESITSDINTILIMLHDISISKESSNE--KISEFQNSS 562

Query: 569 DQRIYPKFISYLYWNCQLESKNDFEIPEPLNSEFEKYSRVYSEVKAGRALKLLKDQGVIE 628
           + +++PKFIS LYW  + +S+  F +   L  +  KY + Y     G  LKL+   G+  
Sbjct: 563 EMQLFPKFISKLYWKFKRQSEYQFPLDSKLRKKLSKYMKSYHHSHPGMKLKLVNGTGICS 622

Query: 629 LDLEFKDGRVLQCDVTLEQYAVIQQF--DEDSYANRLMAETISLYLNMEISRVKSALQFW 686
           L+L FKDGR L  D T EQY V+  F  D+D  +  L    +S  L M+  RV++ LQFW
Sbjct: 623 LNLTFKDGRKLSVDATFEQYTVLSAFHNDKDDSSQVLSINQLSTMLKMDPERVRAHLQFW 682

Query: 687 VEKGVLYQVDAFYATQESRQDSNIKTAKSDSVGSFFE--------KNXXXXXXXXXLSKT 738
           + K VL   + +Y  QE   +  + +  +    S           K            + 
Sbjct: 683 INKKVLCHQNDYYTIQEYLNNQELSSGPTVITSSILPLSQERMPFKRSVPTNVLNDPKEI 742

Query: 739 LNAIWPFVQGMLTNLGSLKAAKIHSFLKVTVPKEVGYIVVTQSQLESYLNSLVEEERLAC 798
           L+ ++P++  M TNLGSLK  KIHSFL ++VP+ + Y  VT +QLE+YL+ LVEEE+L  
Sbjct: 743 LHRVYPYINDMFTNLGSLKVDKIHSFLNMSVPRGLHYSKVTVTQLEAYLDQLVEEEQLIV 802

Query: 799 TTSGSYK 805
              GS+K
Sbjct: 803 LPDGSFK 809

>CAGL0M04235g Chr13 complement(464973..467324) [2352 bp, 783 aa]
           {ON} similar to uniprot|Q12440 Saccharomyces cerevisiae
           YLR127c APC2 component of the anaphase promoting complex
          Length = 783

 Score =  422 bits (1084), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 264/794 (33%), Positives = 424/794 (53%), Gaps = 60/794 (7%)

Query: 33  ALLTWLNPNESESNHHMRPPPLRLKDAIKLFVNQYYNSGYISGSDGEINKGPEFELGNQL 92
            LL WL+P   + NH ++PP L +K  I+           + GS+       +++L + +
Sbjct: 32  VLLQWLDP-AGKKNHQLKPPNLLVKTMIE---------KLLLGSN-------DYQLLSNI 74

Query: 93  RQFYIYQVRIHFFTSFNLIQTFKDIQRLEKYYVSPLAYIHLFESSGYEWIIERDG--LRH 150
           + +Y +Q R++F+  +  I+T  +++R+E++ + PL YI +FE +     +E +     +
Sbjct: 75  QDYYCWQCRVYFYNEYKRIETLNELKRIERHVLFPLKYIPIFEGNNR---VENEVRLFGN 131

Query: 151 YLLNRNMEFHNNMKQRMESLFMQDDFEYVAEMLDWVEKAHTXXXXXXXXXXXXXAKVKQF 210
           YLL  N +  +   +R+ +  ++DDFE   E++D+ +   T              K++QF
Sbjct: 132 YLLKTNKKVMSRAVERLRNRMLEDDFELATEIVDYFDYCQTDSTSIVLDIILD--KIEQF 189

Query: 211 CDDHMMGVYGKTYLVMKTFNKFIIKYWSNFAQLLGCPQDDHGLTNVVYTCFEKQFIRIRT 270
           C  H    + K YL+M+TFN+FI +YW   + LL C +D+H +TN +Y  FEKQFI IRT
Sbjct: 190 CQLHYTRKWNKRYLIMETFNQFISQYWDQLSSLLFCQEDNHTITNTLYKYFEKQFISIRT 249

Query: 271 QEVFDIFVNEFPNSKPTIIEMRKLITHSTDFKTIVIAFLSTFEKKVLNPSVTTTDALLAY 330
            E+FDI ++   + +PT++E+RK I+   DF  +V+  LS F  KV+NPS+ T DAL  Y
Sbjct: 250 NEIFDICISNPASVQPTLLELRKEISTVNDFNCVVVELLSKFNLKVINPSIVTADALFLY 309

Query: 331 VKSVKAFLTLDPSGRYLQSVISFVKQTFQERSDLVVILLYAILDL-QLDGLVGSHIQVDP 389
           ++++K F  LDPSGRYLQ++ S+VK  F++R DLV +LL+++L L + D L     QV  
Sbjct: 310 IRTIKTFSILDPSGRYLQTISSYVKPHFRQRKDLVHLLLFSMLGLDETDQLNTMPSQVSE 369

Query: 390 VCLKALASELRDPELGIENDIYPDDNLANVATGMAKLNYEGCLPYEEVMQRFLSWNPDPR 449
             L AL +EL+D E+    +   DD +  +    +K   E  +  E+V++R++ W P+  
Sbjct: 370 EKLTALTNELKDTEICSYTE-ESDDVVDPMIGSFSK--EEDSMVLEQVIKRYMEWIPE-- 424

Query: 450 DMAPRAISKQ--SPSHMSLLDILMELFESKDFFVSEFXXXXXXXXXXXXFYNLDRNWSKC 507
              P +  K   S   + L DIL+EL ESK+  V EF             Y LD+ WSK 
Sbjct: 425 --VPTSFGKGILSDHKLDLFDILLELLESKETLVIEFKNLLTKKLLDLRGYTLDKKWSKF 482

Query: 508 LQLLKKKLARGAPNISLAPTGQQNNSERGDDYSNINSNDVMLWDVKLSYELCKQMH-QVS 566
           L LLKK+              +   +   +D +NIN+ D+ML D+  S ++   M   + 
Sbjct: 483 LSLLKKRF-----------DNRSTETMDEEDLNNINTIDIMLRDIYKSRQIATDMQLDLH 531

Query: 567 GLDQRIYPKFISYLYW--NCQLESK-NDFEIPEPLNSEFEKYSRVYSEVKAGRALKLLKD 623
             + ++YPK +S LYW  N   +SK  DFE+   L    E YSR YS+ + G+ L+L +D
Sbjct: 532 NTNVKVYPKIVSALYWSNNSDTQSKAGDFEMDGELEHLLELYSRFYSQKQIGQKLELRRD 591

Query: 624 QGVIELDLEFKDGRVLQCDVTLEQYAVIQQFDEDSYANRLMAETISL-----YLNMEISR 678
            G + L+L F DGR + C  +L QY+V+  F    + +    E +++        M+  +
Sbjct: 592 NGSVSLNLSFLDGRTVHCKASLRQYSVLTLFKSPKHDSNFPTEGLTISELCARSGMQSKQ 651

Query: 679 VKSALQFWVEKGVLYQVDAFYATQES---RQDSNIKTAKSDSVGSFFEKNXXXXXXXXXL 735
           +   L++WV K VLY  D  Y T E    + DS           S  E++          
Sbjct: 652 MADILRYWVSKDVLYFSDGKYRTLEFLRWKGDSTYAAIPDVLEESVVERSSQHEDKQ--- 708

Query: 736 SKTLNAIWPFVQGMLTNLGSLKAAKIHSFLKVTVPKEVGYIVVTQSQLESYLNSLVEEER 795
              +    P+++ +L NLG+LK  K+H+ L+  +PK+  Y  V Q QL+ YL++LVEE  
Sbjct: 709 ENHVERALPYIKDILLNLGTLKIDKLHALLQSAMPKDSHYSTVNQKQLQDYLDTLVEEGV 768

Query: 796 LACTTSGSYKLPSI 809
           L+  ++ SYKLP I
Sbjct: 769 LSSASNDSYKLPQI 782

>Kpol_YGOB_Anc_8.321 s1036 complement(185463..186998) [1536 bp, 511
           aa] {ON} ANNOTATED BY YGOB -
          Length = 511

 Score =  371 bits (953), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 216/510 (42%), Positives = 295/510 (57%), Gaps = 21/510 (4%)

Query: 317 LNPSVTTTDALLAYVKSVKAFLTLDPSGRYLQSVISFVKQTFQERSDLVVILLYAILDLQ 376
           +NPS+TT DAL+AYVK+VK+FLTLDPSG+YL S+ +FV    QER+DLV +LLYAILDLQ
Sbjct: 1   MNPSITTVDALIAYVKTVKSFLTLDPSGKYLHSISTFVNPYLQERNDLVSVLLYAILDLQ 60

Query: 377 LDGLVGSHIQV-DPVCLKALASELRDPELGIENDIYPDDNLANVATGMAKLNYEGCLPYE 435
            +        + D   L  L+ ELRDPE GIE ++  D +   +    +  + +  L Y 
Sbjct: 61  SENFQEEAQNILDADSLVILSDELRDPEFGIEGELNIDLDKNELTGQPSNKSGDSSLLYR 120

Query: 436 EVMQRFLSWNPDPRDMAPRAISKQSPSHMSLLDILMELFESKDFFVSEFXXXXXXXXXXX 495
           +V+ + L+W P+   +  +   K      +LLDIL+E+FE+ + F++EF           
Sbjct: 121 QVITQMLNWVPESSKIDSKR-QKMIGLRKNLLDILLEIFENNEVFIAEFLKLLTKKLLKL 179

Query: 496 XFYNLDRNWSKCLQLLKKKLARGAPNISLAPTGQQNNSERGDDYSNINSNDVMLWDVKLS 555
            +Y LD  WSKCL+LLK+K    +   +   T   N +  G D   IN+ DVMLWD+K S
Sbjct: 180 KYYKLDSRWSKCLKLLKEKFKGNSAGTTSISTNIGNVT--GSDLVYINNIDVMLWDLKTS 237

Query: 556 YELCKQMHQVSGLDQRIYPKFISYLYWNCQLESKN------DFEIPEPLNSEFEKYSRVY 609
            +L  +MHQ+ GLD+RI PKFIS LYW+   ESK+        +I   L+++ EKY RVY
Sbjct: 238 GDLTSRMHQIEGLDRRIQPKFISSLYWDQAKESKSKGNNAKQTQIDPLLSTQLEKYIRVY 297

Query: 610 SEVKAGRALKLLKDQGVIELDLEFKDGRVLQCDVTLEQYAVIQQFDEDSYANRLMAETIS 669
           SE+K GR L LLKD G +EL+  F+DGR + CD TLEQ  +I  F E    N L  E + 
Sbjct: 298 SELKPGRTLHLLKDHGTVELEFTFEDGRTISCDATLEQSNIINYFSEAVSENGLSLEQLH 357

Query: 670 LYLNMEISRVKSALQFWVEKGVLYQVDAFYATQESRQDSNIKTAKSDSVGSFFEKNXX-- 727
           +   +E + +K  LQFWV++ VLY     Y   E      I        G   ++     
Sbjct: 358 ILSGIESTGLKKILQFWVDEKVLYFDGQLYRILEYLDQPEIIVQSLTHTGEVLKEEQKLN 417

Query: 728 ---------XXXXXXXLSKTLNAIWPFVQGMLTNLGSLKAAKIHSFLKVTVPKEVGYIVV 778
                           + +TLN +WP+++GMLTNLGSLK  KIHSFL+ TVPK+V Y  +
Sbjct: 418 PLSSSSITSDIDQMNKIHETLNNVWPYIKGMLTNLGSLKLEKIHSFLRATVPKDVNYNSI 477

Query: 779 TQSQLESYLNSLVEEERLACTTSGSYKLPS 808
           T S LE YLNSLVE++ L    SGSY+LPS
Sbjct: 478 TVSSLEVYLNSLVEDDVLELLASGSYRLPS 507

>KAFR0H02280 Chr8 (435246..437699) [2454 bp, 817 aa] {ON} Anc_8.321
           YLR127C
          Length = 817

 Score =  374 bits (960), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 273/845 (32%), Positives = 425/845 (50%), Gaps = 116/845 (13%)

Query: 29  DDLEALLTWLNPNESESNHHMRPPPLRLKDAIKLFVNQYYNSGYISGSDGEINKGPEFEL 88
           +DL+ LL WL+P E    H  +PP LR+K +I     Q     +   SD           
Sbjct: 18  EDLDRLLLWLSPAE----HQCKPPSLRIKKSI-----QRIRECFQLSSD----------F 58

Query: 89  GNQLRQFYIYQVRIHFFT----SFNLIQTFKDIQRLEKYYVSPLAYIHLFESSGYEWIIE 144
            N L + YI  +R  F +    + N ++ F D+ +LE     P  +I   E   +E+   
Sbjct: 59  TNCLVKLYIDLIRFEFISYMKENANCLK-FNDVLKLENRIEHPRLFIPELE---FEYFKN 114

Query: 145 RDGLRHYLLNRNMEFHNNMKQRMESLFMQDDFEYVAEMLDWVEKAHTXXXX-XXXXXXXX 203
              LRHYLL+ +  F   +   +E+L M+DDF     +LDW++ A++             
Sbjct: 115 LHMLRHYLLDSDKSFKTALCTSIENLIMEDDFYSATIILDWIDSAYSIDLSPKDLVLDML 174

Query: 204 XAKVKQFCDDHMMGVYGKTYLVMKTFNKFIIKYWSNFAQLLGCPQDDHGLTNVVYTCFEK 263
             K+   C   + G + + ++V++TFN FI  YWS+FAQLL CP++DH LT  V+ CFE+
Sbjct: 175 VKKIAGICSGSIRGSWTRRFIVIETFNDFIEVYWSHFAQLLKCPENDHELTKTVFKCFER 234

Query: 264 QFIRIRTQEVFDIFVNEFPNSKPTIIEMRKLITHSTDFKTIVIAFLSTFEKKVLNPSVTT 323
           +FI IR  E+F+IF + +P SKPTI+E+RK++    D + +   FL TF+ ++LNP VTT
Sbjct: 235 EFINIRINEIFEIFTSAYPESKPTILELRKVMKAPKDLQRLTYTFLDTFKDEMLNPCVTT 294

Query: 324 TDALLAYVKSVKAFLTLDPSGRYLQSVISFVKQTFQERSDLVVILLYAILDLQLDGLVGS 383
            DAL +Y+K++K FL LDP+GRYL  V +FVK  FQ++SDL+ ILLYAILDL+       
Sbjct: 295 IDALTSYLKAIKGFLLLDPAGRYLNLVTTFVKPYFQDKSDLINILLYAILDLKPKDFEDL 354

Query: 384 HIQVDPVCLKALASELR-DPELGIENDIYPDDN-----LANV-ATGMAKLNYEGCLPYEE 436
           +I   P  L  L+ ++R DPE  IEN + P+DN     + N+ + G   L+ +G L  + 
Sbjct: 355 NISYIP-GLNKLSLDMREDPEFSIEN-VEPNDNNYKRTVPNLESIGANSLHDKGTLIQDH 412

Query: 437 VMQRFLSWNPDP----------------RDMAPRAISKQSPSHMSLLDILMELFESKDFF 480
           +M++F+ W P+P                 D            +++LLDIL++LFESK+ F
Sbjct: 413 IMKQFMMWVPEPNMNNLENDHDNGNDFEEDNNDVTAVNSIFYNVNLLDILLDLFESKEIF 472

Query: 481 VSEFXXXXXXXXXXXXFYNLDRNWSKCLQLLKKKLARGAPNISL-------------APT 527
           + +F             Y +D NW KCL+L+  K    + NIS+              PT
Sbjct: 473 IGKFVNLLTIKFFKLQNYRVDPNWQKCLELINSKF--NSSNISMDEKMEEDVAIGTVNPT 530

Query: 528 GQQNNSE-RGDDYSN--------INSNDVMLWDV----KLSYELCKQMHQVSGLDQR--- 571
            +    E R  + SN        +N  +VML D+    K S+++  ++++  GL      
Sbjct: 531 NENYVDEKRKTNASNDMEEIQISLNKIEVMLNDIRHSEKFSFQISSELNRY-GLRSNNVG 589

Query: 572 IYPKFISYLYWNCQLE--SKNDFEIPEPLNSEFEK----YSRVYSEVKAGRALKLLKDQG 625
           I PKFIS LYW+ +      N+F      + E  K    Y+  Y  +  G AL   K + 
Sbjct: 590 IKPKFISPLYWDYEDNELGVNNFLKENVFDEECTKAILQYASEYCSINKGFALHYCKGKE 649

Query: 626 VIELDLEFKDGRVLQCDVTLEQYAVIQQFDEDSYANRLMAETISLYLNMEISR--VKSAL 683
           +IE+++ F DG +    V   QY V+  FD  +   +L  E+I      + S+  +  AL
Sbjct: 650 MIEVEISFNDGAIKGFLVNASQYYVLTLFDTGN--EKLTIESILTAGEAKRSKNEIIDAL 707

Query: 684 QFWVEKGVLYQVDAFYATQESRQDSNIKTAKSDSVGSFFEKNXXXXXXXXXLSKTLNAIW 743
           +FWVEK VL     +Y +++     N K   +        K                   
Sbjct: 708 KFWVEKNVLVYEGGYYYSRDLHSIENSKGNTTTRTDDLLVKEAL---------------- 751

Query: 744 PFVQGMLTNLGSLKAAKIHSFLKVTVP--KEVGYIVVTQSQLESYLNSLVEEERLACTTS 801
           P+++ ML + G+L A++I +FLK T+P  ++  +I+   + + S L++LV +  L   +S
Sbjct: 752 PYIKTMLESFGNLSASRIQNFLKATLPAAQDSDHII---TDIHSVLDTLVSDGILFKNSS 808

Query: 802 GSYKL 806
           GSYKL
Sbjct: 809 GSYKL 813

>KNAG0G02430 Chr7 complement(553644..556037) [2394 bp, 797 aa] {ON}
           Anc_8.321 YLR127C possible pseudogene; NNN added to
           avoid internal stop codon
          Length = 797

 Score =  352 bits (904), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 250/830 (30%), Positives = 405/830 (48%), Gaps = 106/830 (12%)

Query: 28  EDDLEALLTWLNPNESESNHHMRPPPLRLKDAIKLFVNQYYNSGYISGSDGEINKGPEFE 87
           +DDLE ++ W++P      H   PP LR+K AI+  +                  G   E
Sbjct: 22  QDDLERVMGWIHPQA----HACHPPSLRMKKAIRSVL------------------GKASE 59

Query: 88  LGNQLRQFYIYQVRIHFFTSFNLIQTFKDIQRLEKYYVSPLAYIHLFESSGYEWIIERD- 146
           L  Q + +YI  ++  +     + + FK IQ LE   V P+ Y+  F S   +  IE+  
Sbjct: 60  LDRQFKIYYIDVIKQEYLCD-QVKREFKHIQVLESKLVYPVTYLP-FLSISDQLAIEQTI 117

Query: 147 -GLRHYLLNRNMEFHNNMKQRMESLFMQDDFEYVAEMLDWVEKAHTXXXXX-XXXXXXXX 204
             LRHYL++ +    N++    E+L   DDFE   ++++W+  A+               
Sbjct: 118 CSLRHYLVDNDDNLRNSLVAEFETLMQDDDFESGYQIIEWLYTANAKLLRPWNLALDTIV 177

Query: 205 AKVKQFCDDHMMGVYGKTYLVMKTFNKFIIKYWSNFAQLLGCPQDDHGLTNVVYTCFEKQ 264
           +K+   CD+ M   +   +LVM TFNKFI  YWS+ A+ L   +D+H  T V+Y CFEK+
Sbjct: 178 SKISTLCDNEMRRNWEAKFLVMNTFNKFINLYWSHLAKFLHLSEDNHDFTKVLYKCFEKE 237

Query: 265 FIRIRTQEVFDIFVNEFPNSKPTIIEMRKLITHSTDFKTIVIAFLSTFEKKVLNPSVTTT 324
           F+RIRT+E+F+I V  +  +K TI+E+R  ++       +V  FL  F+ KVLNPSV T 
Sbjct: 238 FVRIRTEEIFEIVVESYQAAKTTILELRTFMSGYERLSKLVNQFLKQFKIKVLNPSVNTV 297

Query: 325 DALLAYVKSVKAFLTLDPSGRYLQSVISFVKQTFQERSDLVVILLYAILDLQLDGLVGSH 384
           +AL+A+++SVK F+ LDP  R++ ++ +FVK  F +R D V I+LYAILDL+   +    
Sbjct: 298 EALVAFIRSVKCFVILDPRARHMHTITNFVKPFFHQRGDAVQIILYAILDLR--DVDFEK 355

Query: 385 IQVDPV-CLKALASELRD----------------------PELGIENDIYPDDNLANVAT 421
           + V PV  L  L+ ELR+                      P L   + +  DD L +  T
Sbjct: 356 MGVSPVKGLSELSHELREDPYVNINAKCQTPTPSPSKISSPHLNDSSSMDVDDKLDDGTT 415

Query: 422 GMAKLNYEGCLPYEEVMQRFL-----SWNPDPRDMAPRAIS-KQSPSHMSLLDILMELFE 475
            +          Y++V+ +F        N   RD     +   Q  +  +LLD L ELF+
Sbjct: 416 DLV---------YKQVLNQFXXRGHHETNQGTRDYVGVNVKFSQRSNRTNLLDPLFELFD 466

Query: 476 SKDFFVSEFXXXXXXXXXXXXFYNLDRNWSKCLQLLKKKLARG--------APNISLAPT 527
            KD  +S F             Y L+ NW++C QL+K+K+ +G        + + + AP 
Sbjct: 467 KKDELLSCFLKLLTLKLFKLSGYTLEPNWNECYQLIKRKVTKGDVGDGGPLSRDTADAPV 526

Query: 528 GQQNNSERGDDYSNINSNDVMLWDVKLSYELCKQMHQVSGLDQRIYPKFISYLYWN---- 583
              N         ++N  DVML D++ + ++ +++H+ S L+  ++PKFIS  YW+    
Sbjct: 527 SSNNEQV----LLSLNKIDVMLHDLRENAKITRRLHRTSMLNGNVFPKFISSQYWSYRDD 582

Query: 584 --CQLESKNDFEIPEPLNSEFEKYSRVYSEVKAGRALKLLKDQGVIELDLEFKDGRVLQC 641
              +  +++  +I   L ++  +Y   + E+K GR ++L K++ + E++L   DG V Q 
Sbjct: 583 TFTKAGNRDQIKIDPVLETDILQYGGRFCELKYGRMVRLCKEKTIFEIELTVNDGEVPQV 642

Query: 642 -DVTLEQYAVIQQFDEDSYANRLMAETISLYLNMEISRVKSALQFWVEKGVLYQVDAFY- 699
             V   +Y+VI+++             +     M+I+ V+++L +WV  G+L    + Y 
Sbjct: 643 FKVDAMKYSVIEKYATGGPRAGYTPTELCELCGMDIADVQTSLTYWVNAGLLRLSSSGYY 702

Query: 700 -ATQESRQDSNIKTAKSDSVGSFFEKNXXXXXXXXXLSKTLNAIWPFVQGMLTNLGSLKA 758
            +T E+    N  T    S   F +                  +W F++GML +LG+L  
Sbjct: 703 ESTSETGPPPNRGTPLEASTREFLD----------------GVVWTFIRGMLESLGTLSC 746

Query: 759 AKIHSFLKVTVPKEVGYI-VVTQSQLESYLNSLVEEER-LACTTSGSYKL 806
           A+IH +L  TVP  + Y   VT  QL+ YL+  V+    L  T  G YKL
Sbjct: 747 AEIHEYLAATVPATIRYQETVTMLQLQGYLDYNVQSTHLLQQTPEGEYKL 796

>AGL193W Chr7 (334823..336952) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR127C (APC2)
          Length = 709

 Score =  321 bits (822), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 212/686 (30%), Positives = 344/686 (50%), Gaps = 54/686 (7%)

Query: 25  PGCEDDLEALLTWLNPNESESNHHMRPPPLRLKDAIKLFVNQYYNSGYISGSDGEINKGP 84
           P  +D++EA+L W++PN+  +NH MRPP LR+K++I+L               GE   G 
Sbjct: 23  PSLKDEIEAVLEWMDPNDDHNNHQMRPPSLRIKNSIRLL------------RLGEQAPGT 70

Query: 85  EFELGNQLRQFYIYQVRIHFFTSFNLIQTFKDIQRLEKYYVSPLAYIHLFESSGYEWIIE 144
              L   LRQ  + Q+R HFF  +  ++ + D+ +LE+YY  PL Y+ +F     E   E
Sbjct: 71  TVGL---LRQCAVSQMRQHFFRHWERLEQYTDMVKLERYYEFPLRYVAVFTED--EVAAE 125

Query: 145 RDGLRHYLLNRNMEFHNNMKQRMESLFMQDD-FEYVAEMLDWVEKAHTXXXXXXXXXXXX 203
             GLR YLLN N  F  NM+ R+ +L +QDD FE  A +  W+ +               
Sbjct: 126 LVGLRKYLLNGNPGFRANMEARIRALILQDDDFETAARLYKWIVQG-LGHPMVKFVIEVL 184

Query: 204 XAKVKQFCDDHMMGVYGKTYLVMKTFNKFIIKYWSNFAQLLGCP-QDDHGLTNVVYTCFE 262
             K+  FC + M G   + YL+M+ FN FI + W+ F QLL  P  DD  L N++Y CFE
Sbjct: 185 TQKIALFCRNRMDGNVDQRYLIMEVFNSFIARCWAQFIQLLQFPTADDPELNNLIYRCFE 244

Query: 263 KQFIRIRTQEVFDIFVNEFPNSKPTIIEMRKLITHST-DFKTIVIAFLSTFEKKVLNPSV 321
           K+FI ++TQE+F   + +FP SKP ++EM+ +I   T +   +V    + F K++L PSV
Sbjct: 245 KKFIELKTQELFHQIIPKFPMSKPALLEMKSVIKGDTAELDRLVAQIYNDFHKELLVPSV 304

Query: 322 TTTDALLAYVKSVKAFLTLDPSGRYLQSVISFVKQTFQERSDLVVILLYAILDLQLDG-- 379
           TT + LL YVK++K  + +DP+GR +    S +K   +ERSDL++ +L AIL+L  D   
Sbjct: 305 TTVEILLYYVKTIKCLMVVDPTGRSMNRFTSKLKPKIKERSDLIISVLCAILELDSDEIH 364

Query: 380 --LVGSHIQVDPVCLKALASELRDPELGIENDIYPDDNLANVATGMAKLNYEGCLPYEEV 437
             +  + +  +P  L  L+ EL+       N      +  + + G A +        +++
Sbjct: 365 EVISKNTLTENPQLLSQLSKELK-------NSTALTFHSMSTSKGKAAIYSVAFERQDQL 417

Query: 438 MQRFLSWNPDPRDMA---PRAISKQSPSHMSL------LDILMELFESKDFFVSEFXXXX 488
           +++FL W P+P        +A++       +L      L+++ ++F+S +  ++EF    
Sbjct: 418 VKQFLEWTPEPGPFTADDAKALNSDDDGAETLELPKDVLEVVFQVFDSPEVLINEFIQLV 477

Query: 489 XXXXXXXXFYNLDRNWSKCLQLLKKKLARGAPNISLAPTGQQNNSERGDDYSNINSNDVM 548
                    Y L+  WS+ L+ + KK  +    +  +   +          SN+ +  VM
Sbjct: 478 TNHMLQMDGYVLNAKWSQLLKTVMKKYFKNNKQVLKSMCEE----------SNLVNVFVM 527

Query: 549 LWDVKLSYELCKQMHQVSGLDQRIYPKFISYLYWNCQLESK-NDFEIPEPLNSEFEKYSR 607
             D++ S        ++  +   +YPK ISYLYW     S   D+ +   L + F++  +
Sbjct: 528 WSDLEKSATFQTWSTKLQLVPPNVYPKIISYLYWKIGRRSPYGDYAVAPGLAAIFDQMEK 587

Query: 608 VYSEVKAGRALKLLKDQGVIELDLEFKDGRVLQCDVTLEQYAVIQQFDEDSYANRLMAET 667
            +     GR L+  KDQG ++L L F+DGR     V+L +Y VI  F     A  L    
Sbjct: 588 AFETRSPGRKLRFQKDQGSVDLQLVFEDGRHWSSRVSLPKYTVIDLFQRQ--ACPLSVTD 645

Query: 668 ISLYLNMEISRVKSALQFWVEKGVLY 693
           I+ + NM    V+  +QFW  + VL+
Sbjct: 646 IAAHTNMSPRLVEDIIQFWCHEHVLH 671

>Ecym_4252 Chr4 complement(523632..525701) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGL193W
          Length = 689

 Score =  309 bits (792), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 210/688 (30%), Positives = 344/688 (50%), Gaps = 59/688 (8%)

Query: 26  GCEDDLEALLTWLNPNESESNHHMRPPPLRLKDAIKLFVNQYYNSGYISGSDGEINKGPE 85
              DDLE LLTW+NPN+  +NH MR P LR+K++IKL                +++   +
Sbjct: 24  ALRDDLENLLTWINPNDDHNNHQMRLPSLRIKNSIKLL---------------KLDDAEQ 68

Query: 86  FELGNQLRQFYIYQVRIHFFTSFNLIQTFKDIQRLEKYYVSPLAYIHLFESSGYEWIIER 145
             L   LRQ+ + Q+R HFF ++  +  +KD+ RLE+YY  PL Y+ LF  +  E   E 
Sbjct: 69  VFLLQLLRQWTLSQLRYHFFHNWESLMQYKDMLRLERYYEFPLKYVGLF--TAEELSNEL 126

Query: 146 DGLRHYLLNRNMEFHNNMKQRMESLFMQ-DDFEYVAEMLDWVEKAHTXXXXXXXXXXXXX 204
            GLR YLLNRN  F NNM+ R+  L ++ DDFE  +++  W+ +                
Sbjct: 127 IGLRKYLLNRNSTFRNNMESRIRVLILEEDDFEMSSKLYKWMVQG-LGHPMVKFVIDLLT 185

Query: 205 AKVKQFCDDHMMGVYGKTYLVMKTFNKFIIKYWSNFAQLLGCP-QDDHGLTNVVYTCFEK 263
            K++ FC   M G   + +++ + FN FI K W+ F QLL  P +DD  L N++Y CFE 
Sbjct: 186 NKIELFCKSRMEGNVDQKHVIEEVFNAFIDKCWNQFIQLLQFPNEDDQELNNLIYRCFEN 245

Query: 264 QFIRIRTQEVFDIFVNEFPNSKPTIIEMRKLITHSTD-FKTIVIAFLSTFEKKVLNPSVT 322
           +FI ++T+E+FD  + +FP SKP+++EM+ +I  +T+    +V    + F  ++L PSVT
Sbjct: 246 KFIEMKTKELFDEIIPKFPLSKPSLLEMKSVIKGATEELDRLVAQICNDFHSELLIPSVT 305

Query: 323 TTDALLAYVKSVKAFLTLDPSGRYLQSVISFVKQTFQERSDLVVILLYAILDLQLDG--- 379
           T + LL YVK++K  + +DP+GR +      +K   +ERSDL+  +L AIL+L  D    
Sbjct: 306 TIEILLYYVKAIKCLMVVDPTGRSMNRFTFKLKPKIKERSDLITTVLCAILELTKDEIHE 365

Query: 380 -LVGSHIQVDPVCLKALASELRDPELGIENDIYPDDNLANVATGMAKLNYEGCLPYEE-- 436
            +  + +  +P  L  L+ EL++             N  +V T  +K          +  
Sbjct: 366 VISKNTLTENPQLLDQLSKELKNSTAL---------NFHSVTTIKSKAAIYSVAQERQNP 416

Query: 437 VMQRFLSWNPDP----RDMAPRAISKQSPSHMSL------LDILMELFESKDFFVSEFXX 486
           ++++FL W P+P     D++    +    +  +L      L+++ ++F+S +  ++EF  
Sbjct: 417 LVKQFLEWTPEPGPFNEDISKLGNNDTDDTTETLELPKDVLEVVFQVFDSPEILINEFIK 476

Query: 487 XXXXXXXXXXFYNLDRNWSKCLQLLKKKLARGAPNISLAPTGQQNNSERGDDYSNINSND 546
                      Y L   WS+ L+ L KK  +    +  +   +          SN+ +  
Sbjct: 477 LITNHMLQMEGYILSAKWSQLLKTLMKKYFKNNKQVLKSICEE----------SNLVNVF 526

Query: 547 VMLWDVKLSYELCKQMHQVSGLDQRIYPKFISYLYWNCQLES-KNDFEIPEPLNSEFEKY 605
           VM  D++ S        ++  +   +YPK ISYLYW    +S   D+ I   L   F++ 
Sbjct: 527 VMWSDLEKSASFQNWSTKLQLIPSNVYPKIISYLYWKISRKSLYGDYRISSALAIIFQQM 586

Query: 606 SRVYSEVKAGRALKLLKDQGVIELDLEFKDGRVLQCDVTLEQYAVIQQFDEDSYANRLMA 665
            + +     GR L+   DQG +E+ L F DGR     V+L +Y VI+ F +      L  
Sbjct: 587 EKAFEMKSPGRKLRFQNDQGTVEIALTFDDGRHWSNKVSLPKYTVIELFQK--VPRGLRT 644

Query: 666 ETISLYLNMEISRVKSALQFWVEKGVLY 693
             I    +M    V++ +Q+W ++ VLY
Sbjct: 645 ADIVQQTDMAQHHVEAIVQYWCQEHVLY 672

>NDAI0G02600 Chr7 (595394..598129) [2736 bp, 911 aa] {ON} Anc_8.321
           YLR127C
          Length = 911

 Score =  301 bits (772), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 258/927 (27%), Positives = 427/927 (46%), Gaps = 172/927 (18%)

Query: 19  VALRLHPGCEDDLEALLTWLNPNESESNHHMRPPPLRLKDAIKLFVNQYYNSGYISGSDG 78
           + + + P     L+ +L WLNPNE+ +        + LK+ I + V+ Y       G D 
Sbjct: 18  IFVSIDPQYHPQLQTMLLWLNPNETTTQSATTMT-IDLKNCINIIVSTY-------GKDD 69

Query: 79  EINKGPEFELGNQLRQFYIYQVRIHFFTSFNL--IQTFKDIQRLEKYYVSPLAYIH-LFE 135
           +I            +++Y + +++HF        + + ++  +LE  Y++PL + + L +
Sbjct: 70  QIRL--------LFKKYYSFVIKLHFMKDNRPKNMTSIREFHKLENLYLTPLRFTYDLID 121

Query: 136 SSGYEWIIERDGLRHYLLNRNMEFHNNMKQRMESLFMQDD---FEY----VAEMLDWVEK 188
           ++  + +I  +  + YL+N N  F  N+   ME+LF+ +D   F+Y    + E++ W+  
Sbjct: 122 TNEMQSLI--NIFKRYLINNNFTFRKNVLHSMETLFLTEDQFEFQYNMNSLNEIVIWLND 179

Query: 189 AHTXXXXXXXXXXXXXAKVKQFCDDHMMGVYGKTYLVMKTFNKFIIKYWSNFAQLL---- 244
           A+               K+++FC   M G++   +++M+ FN FI +YW   ++L     
Sbjct: 180 ANGNVSPIDLLLDLLLRKIEKFCQREMAGLWNGRFIIMEKFNLFINQYWKLISKLFHHQQ 239

Query: 245 ---GCPQDDHGLTNVVYTCFEKQFIRIRTQEVFDIFVNEFPNSKPTIIEMRK-LITHSTD 300
              G  ++DH LTN++Y  F +QFI+IR  E   I V+ FP S PTIIE++  LIT S  
Sbjct: 240 FDYGDVENDHALTNLIYYFFTQQFIKIRINESLKIMVSNFPISTPTIIELKNVLITSSMP 299

Query: 301 ---------------------FKTIVIAFLSTFEKKVLNPSVTTTDALLAYVKSVKAFLT 339
                                 K  V  FL  F++K LNP + T   + A VK   +FL 
Sbjct: 300 RENVSTTATTTFRDTNLSEEYLKLFVKKFLKDFQRKFLNPCIPTIPLIRALVKMTNSFLI 359

Query: 340 LDPSGRYLQSVISFVKQTFQERS-DLVVILLYAILDLQLDGL--VGSHIQVD-------- 388
           LDP G+ L ++I  +K   Q R+ D+V ILLYA+L+L    L  +G +I  D        
Sbjct: 360 LDPRGQLLTTIILTLKPLIQRRTTDIVNILLYAMLNLNEMELHKLGCNIDFDIESFNILV 419

Query: 389 ----PVCLKALASELRDPEL---------------GIENDIYPDDNLANVATG-----MA 424
               P  +K++     +P +                I ND  P  N+ ++A       +A
Sbjct: 420 SELYPTIIKSMNQNQNNPSVVPYTTAGTGTTCSNERITNDDIPYQNVKDMANANTMEYLA 479

Query: 425 KLNYEGCLPYEEVMQRFLSWNPDPRDMAPRAISKQSP---------SHMSLLDILMELFE 475
           +   E   P+ ++ +++L W P P +    + SK +               +D L   F+
Sbjct: 480 RRKPE-TKPFFDLFKQYLEWVP-PMNKIYDSTSKNTVVDDEETSRIRSRHAIDYLFRFFD 537

Query: 476 SKDFFVSEFXXXXXXX-XXXXXFYNLDRNWSKCLQLLKKKLARGAPNISLAPTGQQNNSE 534
           S D  +SE+             +Y LD NW  CL LLK+K                +N  
Sbjct: 538 SIDLLLSEYLKLLTEKFIHSKNYYTLDNNWLWCLNLLKEK-------------SNSSNVP 584

Query: 535 RGDDYSNINSNDVMLWDVKLSYEL------CKQMHQVSGLDQRIYPKFISYLYWNC---- 584
             +  S IN+ D+ML D+K S          K+ + V G D   YPK +S LYW      
Sbjct: 585 DENVKSTINTIDIMLNDMKRSASYGKDKKHTKENNMVQG-DIGFYPKEVSKLYWKINSTN 643

Query: 585 ----QLESKNDF-------EIPEPLNSEFEKYSRVYSEV-KAGRALKLLKDQGVIELDLE 632
               ++  K DF       +  EP ++   K +R ++E+ + G+ ++L KD+ ++E+ + 
Sbjct: 644 IAKWRMNMKGDFFHLLKYSKTAEPNHTMDIKLNRFFNELGRKGKKMELYKDKSLMEMKIS 703

Query: 633 FKDGRVLQCD-VTLEQYAVIQQFDEDSYANRLMAETISLYLNMEISRVK--SALQFWVEK 689
           F DGR L  D +T+EQY V+  F  +  A   + +    +  ++  + K    +QFWV+K
Sbjct: 704 FDDGRELFFDNITIEQYDVLSLFTVEKGAAFTLEKAYDFFSGLKRGKQKLEECIQFWVDK 763

Query: 690 GVLYQ---------------VDAFYATQESRQDSNIKT--------------AKSDSVGS 720
            VLY                +D     ++ ++++ IK+              A+ D +  
Sbjct: 764 KVLYLDDDDGCYKVLERLTFLDEIKQRKKMQEETVIKSDARMGIDHDYVQEAAEDDDIAG 823

Query: 721 FFEKNXXXXXXXXXLSKTLNAIWPFVQGMLTNLGSLKAAKIHSFLKVTVPKEVGYIVVTQ 780
           F             +   L+ I+PF+ GML NLGS+K  KIHSFLK+TVP++  Y  +  
Sbjct: 824 FETHKDVISRANDEIKNILDRIFPFINGMLENLGSMKLEKIHSFLKMTVPRDFEYNRIAI 883

Query: 781 SQLESYLNSLVEEERLACTTSGSYKLP 807
            QLE+YLN LVE+E+L  TT G++K P
Sbjct: 884 HQLENYLNGLVEDEKLETTTDGAFKKP 910

>KLLA0D16324g Chr4 complement(1373445..1375538) [2094 bp, 697 aa]
           {ON} weakly similar to uniprot|Q7LGV7 Saccharomyces
           cerevisiae YLR127C
          Length = 697

 Score =  191 bits (486), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 189/738 (25%), Positives = 323/738 (43%), Gaps = 104/738 (14%)

Query: 17  KEVALRLHPGCEDDLEALLTWLNPNESESNHHMRPPPLRLKDAIKLFVNQYYNSGYISGS 76
           +++ L L    E++++ +L WLNP         + P LR+K  +K+ + Q         S
Sbjct: 13  EKILLNLASNLEEEVDMVLAWLNPT-----FQPQIPTLRIKQCLKVVLEQ---------S 58

Query: 77  DGEINKGPEFELGNQLRQFYIYQVRIHFFTSFNLIQTFKDIQRLEKYYVSPLAYIHLFES 136
           D       E        Q+Y+  +R HFF  F+ I  +KD+ +LEK Y+S + +  +F +
Sbjct: 59  DERTRFLIE--------QYYLTLIRTHFFLQFDDIVNWKDMIKLEKLYISKVEF--MFGT 108

Query: 137 SGYEWIIER-DGLRHYLLNRNMEFHNNMKQRMESLFMQDDFEYVAEMLDWVEKAHTXXXX 195
           S Y WI E     +  L+ +N EF   +  ++ES  + +D     +M  W+  A      
Sbjct: 109 SVY-WIKEEMISFKRLLMKKNNEFRKQLHAKLESHILDNDLVRFDQMYQWLAPAFDGQEI 167

Query: 196 XXXXXXXXXAKVKQFCDDHMMGVYGKTYLVMKTFNKFIIKYWSNFAQLLGCPQDDHGLTN 255
                     KV Q     M       YLVM T+N FI  +WS F++LL   +DDH LT 
Sbjct: 168 EFNVRIIN-LKVDQMSQKLMKNKIDDRYLVMNTYNHFIKDFWSKFSKLL-IIEDDHELTA 225

Query: 256 VVYTCFEKQFIRIRTQEVFDIFVNEFPNSKPTIIEMRKLITHSTDFKTIVIAFLST---- 311
           ++Y  FEK +I+ +  E +   V +FP S+  ++E+R ++  + D KT+    L T    
Sbjct: 226 IIYQSFEKNYIKYKCDEFYTDIVPKFPASRKCLLELRSIL--NKDIKTVGTKVLETLYHG 283

Query: 312 FEKKVLNPSVTTTDALLAYVKSVKAFLTLDPSGRYLQSVISFVKQTFQERSDLVVILLYA 371
           F  + L  S+ T + L  Y+K+VK    +DP G  L+S+   V+     R D++  LL  
Sbjct: 284 FVSRFLTSSLLTCEILYYYIKTVKCLKIIDPMGICLRSLSKAVRVYLNPRPDIIKTLLLG 343

Query: 372 ILDLQ-------LDGLVGSHIQVDPVCLKALASELRDPELGIENDIYPDDNLANVATGMA 424
           I   Q            GS + ++   L+  + E+ D  +G E    P          + 
Sbjct: 344 IFPFQNNERFKIASSTDGSSVHLEK--LEQFSREVGDFSMGPE---LPTALPWFNQPHLP 398

Query: 425 KLNYEGCLPYEEVMQRFLSWNPDP-------RDMAPRAISKQSPSHMSLLDILMELFESK 477
           +  Y+G    +++++++L+W P+P        D A        P  + L+ +L+++ ESK
Sbjct: 399 RCTYDGD---DQLLKQYLNWVPEPPRIKLDVEDFADNDGKYVPP--VDLIHVLLDVLESK 453

Query: 478 DFFVSEFXXXXXXXXXXXXFYNLDRNWSKCLQLLKKKLARGAPNISLAPTGQQNNSERGD 537
              V +              Y+LD  W + + ++            L  T +   +    
Sbjct: 454 RTLVDDLLGVVSGKFIESEEYSLDPEWQRIMDIILN---------HLEGTRKGTVTSEEA 504

Query: 538 DYSNINSNDVMLWDVKLSYELCKQMHQVSGLDQRIYP--KFISYLYW------NCQLES- 588
           D +++N  D+ML D++LS +   Q+   +      +P  K +S LYW      N +L + 
Sbjct: 505 DLTHLNDVDIMLEDLRLSSQFRNQVAHKNNSHFENFPHIKILSKLYWRHYQNLNGRLVTT 564

Query: 589 --KNDFEIPEPLNSEFEKYSRVYSEVKAGRALKLLKDQGV---IELDLEFKDGRVLQCDV 643
             K D E+ EPL    +K ++VY  +  GR LK   D G    + +++  K G      V
Sbjct: 565 KYKWDSEM-EPL---IQKLTKVYERLNTGRTLKF--DTGSSSRVSINIVTKSGERRFFKV 618

Query: 644 TLEQYAVIQQFDEDSYA----------------NRLMAETISLYLNMEISRVKSALQFWV 687
           T+EQY VI  F  ++                   R   + +    +M   ++   L FW 
Sbjct: 619 TMEQYLVISHFQNETNGRNAPGMMADCNYVIPERRYTLKDLHKMTSMPRQKILDILSFWQ 678

Query: 688 EKGVLYQ-VDAFYATQES 704
           +K ++ +  D  Y+ QE 
Sbjct: 679 QKEIVTKHSDDSYSVQEG 696

>Kwal_0.70 s0 complement(30290..32608) [2319 bp, 772 aa] {ON}
           YJL047C (RTT101) - Regulator of Ty1 Transposition
           [contig 76] FULL
          Length = 772

 Score = 40.0 bits (92), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 60/113 (53%), Gaps = 8/113 (7%)

Query: 585 QLESKNDFEIPEPLNSEFEKYSRVY--SEVKAGRALKLLKD---QGVIELDLEFKDGRVL 639
           Q +S  D  I +PL + +  ++  Y  SE KA + L  L++      +E + +  DG  L
Sbjct: 543 QDQSLGDLNISKPLQALWNNFTEFYARSEPKADKKLLTLQNTLHHLEVETNFKLDDGSYL 602

Query: 640 QCDVTLEQYAVIQQFDEDSYANRLMAETISLYLNMEISRVKSALQFWVEKGVL 692
             ++TL Q ++++ F+E      L +  I  YLN+  + ++ AL+ ++E G+L
Sbjct: 603 VLELTLLQTSILELFNEH---KELSSLEIGSYLNVSGATLEVALESFIEVGLL 652

>Skud_4.122 Chr4 (219928..222375) [2448 bp, 815 aa] {ON} YDL132W
           (REAL)
          Length = 815

 Score = 37.0 bits (84), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 57/108 (52%), Gaps = 7/108 (6%)

Query: 591 DFEIPEPLNSEFEKYSRVYSEVKAGRALKLLKD--QGVIELDLEFKDGRV-LQCDVTLEQ 647
           +F++P+ L S  EK    YS+   GR LK L    +G ++ D+  K GR      VTL Q
Sbjct: 572 EFKLPKELASSHEKLKESYSQKHNGRVLKWLWPLCRGELKADIG-KPGRAPFNFTVTLFQ 630

Query: 648 YAVIQQFDEDSYANRLMAETISLYLNMEISRVKSALQFWVEKGVLYQV 695
            A++  +++   A+ L  E+I    N+ I  + +A+  +++  ++ QV
Sbjct: 631 MAILLLYND---ADVLTLESIQESTNLNIQHIAAAMIPFIKFKLIQQV 675

>ZYRO0D02464g Chr4 (191069..193165) [2097 bp, 698 aa] {ON} similar
           to uniprot|P40483 Saccharomyces cerevisiae YIL108W
           Hypothetical ORF
          Length = 698

 Score = 35.4 bits (80), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 4/62 (6%)

Query: 240 FAQLLGCPQDDHGLTNVVYTCFEKQFIRIRTQEVFDIFVNEFPNSKPTIIEMRKLITHST 299
              LLGCP  ++G+    YT   + F+   T+E F +  N +  +KP I+   +   H  
Sbjct: 320 IGHLLGCPHQENGVMLRDYTVLNRSFL---TKEAFSVRTNSY-GAKPPILPREECTWHRL 375

Query: 300 DF 301
           D 
Sbjct: 376 DL 377

>NCAS0A13810 Chr1 complement(2710214..2712670) [2457 bp, 818 aa]
           {ON} Anc_7.296 YDL132W
          Length = 818

 Score = 35.0 bits (79), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 54/107 (50%), Gaps = 5/107 (4%)

Query: 591 DFEIPEPLNSEFEKYSRVYSEVKAGRALKLLKDQGVIELDLEF-KDGRV-LQCDVTLEQY 648
           DF++P  L     K  +VY+E   GR LK L      EL  +  K GRV  Q  VTL Q 
Sbjct: 576 DFKLPIELQESHMKLEQVYTEKHNGRILKWLWPLCRGELIADIGKPGRVPFQFTVTLFQM 635

Query: 649 AVIQQFDEDSYANRLMAETISLYLNMEISRVKSALQFWVEKGVLYQV 695
           A++  F++   ++ L  ETI    ++ I  + +A+  +++  ++ Q 
Sbjct: 636 AILLLFND---SDVLTLETIQEGTSLSIQNIAAAMVPFIKFKLIQQT 679

>NDAI0A02230 Chr1 (502448..504898) [2451 bp, 816 aa] {ON} Anc_7.296
          Length = 816

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 51/106 (48%), Gaps = 5/106 (4%)

Query: 591 DFEIPEPLNSEFEKYSRVYSEVKAGRALKLLKDQGVIELDLEF-KDGR-VLQCDVTLEQY 648
           +F++P+ L   ++K   +Y+E   GR LK L      EL     K GR      VTL Q 
Sbjct: 574 EFKLPQDLQQSYKKLEEIYTEKHNGRILKWLWPLCRGELSAAIGKPGRPAFHFTVTLFQM 633

Query: 649 AVIQQFDEDSYANRLMAETISLYLNMEISRVKSALQFWVEKGVLYQ 694
           A++  F+E    + L  E I    N+ +  + +A+  +++  +L Q
Sbjct: 634 AILLLFNE---KDVLTLENIQEATNLNLQNIAAAMVPFIKYKLLQQ 676

>KAFR0J01500 Chr10 complement(270147..272222) [2076 bp, 691 aa] {ON}
           Anc_2.263 YIL108W
          Length = 691

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 4/62 (6%)

Query: 240 FAQLLGCPQDDHGLTNVVYTCFEKQFIRIRTQEVFDIFVNEFPNSKPTIIEMRKLITHST 299
              LLGCP  +HG+    YT   + F+   T+E F    N +  +KP I    +   H  
Sbjct: 319 IGHLLGCPHQEHGVMLRDYTRLNRSFL---TREAFATRTNSY-GAKPPIFPKEECTWHRL 374

Query: 300 DF 301
           D 
Sbjct: 375 DL 376

>ZYRO0C09438g Chr3 complement(715107..717566) [2460 bp, 819 aa] {ON}
           highly similar to uniprot|Q12018 Saccharomyces
           cerevisiae YDL132W CDC53 Cullin structural protein of
           SCF complexes (which also contain Skp1p Cdc34p and an
           F-box protein) involved in ubiquitination SCF promotes
           the G1-S transition by targeting G1 cyclins and the
           Cln-CDK inhibitor Sic1p for degradation
          Length = 819

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 47/96 (48%), Gaps = 7/96 (7%)

Query: 591 DFEIPEPLNSEFEKYSRVYSEVKAGRALKLLKD--QGVIELDLEFKDGR-VLQCDVTLEQ 647
           DF++P  L   +EK   +YS    GR LK L    +G I   +  K GR   Q  VTL Q
Sbjct: 572 DFKLPLVLQHSYEKLEEMYSNKHNGRVLKWLWPLCRGEIRAAIG-KQGRPPFQFTVTLFQ 630

Query: 648 YAVIQQFDEDSYANRLMAETISLYLNMEISRVKSAL 683
            +++ QF+++     L  E I    N+ +  + +A+
Sbjct: 631 MSILLQFNDNDV---LTLEQIQEGTNLSVQNIAAAM 663

>Suva_4.112 Chr4 (212752..215199) [2448 bp, 815 aa] {ON} YDL132W
           (REAL)
          Length = 815

 Score = 33.1 bits (74), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 55/108 (50%), Gaps = 7/108 (6%)

Query: 591 DFEIPEPLNSEFEKYSRVYSEVKAGRALKLLKD--QGVIELDLEFKDGRV-LQCDVTLEQ 647
           +F++P+ L    EK    YS+   GR LK L    +G I  D+  K GRV     VTL Q
Sbjct: 572 EFKLPKELVPSHEKLKDSYSQKHNGRVLKWLWPLCRGEIRADIG-KPGRVPFNFTVTLFQ 630

Query: 648 YAVIQQFDEDSYANRLMAETISLYLNMEISRVKSALQFWVEKGVLYQV 695
            A++  +++   A+ L  E I    ++ I  + +A+  +++  ++ QV
Sbjct: 631 MAILLLYND---ADTLTLENIQDGTSLSIQHIAAAMIPFIKFKLVQQV 675

>KLTH0H11176g Chr8 complement(957667..959991) [2325 bp, 774 aa] {ON}
           weakly similar to uniprot|P47050 Saccharomyces
           cerevisiae YJL047C RTT101 Cullin family member subunit
           of a complex containing ubiquitin ligase activity binds
           HRT1 and is modified by the ubiquitin like protein RUB1
           Regulator of Ty1 Transposition Regulator of Ty1
           Transposition
          Length = 774

 Score = 32.3 bits (72), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 53/107 (49%), Gaps = 8/107 (7%)

Query: 591 DFEIPEPLNSEFEKYSRVYSEVKAGRALKLLKDQGV-----IELDLEFKDGRVLQCDVTL 645
           + +IP  L++ ++K+   Y+E       K L  Q +     ++ + + +DGR L  ++TL
Sbjct: 557 ELKIPRSLDALWQKFCAFYAESDPRSTKKPLVLQNMLHHLEVQTNFKLEDGRPLMLELTL 616

Query: 646 EQYAVIQQFDEDSYANRLMAETISLYLNMEISRVKSALQFWVEKGVL 692
            Q +++  F+E   +  L    I   L +  + ++ AL  ++  G+L
Sbjct: 617 LQASILDLFNE---SGELTVRDIESELGVAANILEPALTSFISAGLL 660

>Smik_12.355 Chr12 complement(633462..635246) [1785 bp, 594 aa] {ON}
           YLR276C (REAL)
          Length = 594

 Score = 32.0 bits (71), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 84/188 (44%), Gaps = 31/188 (16%)

Query: 16  IKEVALRLHPGCEDDLEALLTWLNPNESESNHHMRPPPLRLKDAIKLFVNQYYNSGYI-S 74
           + EV L L  G +DDL  +  +L   ++     M      L D I+    ++  S  I  
Sbjct: 178 VDEVDLVLTFGYQDDLNKIGEYLPLKKNLQTFLMSAT---LNDDIQALKQKFCRSPAILK 234

Query: 75  GSDGEINKGPEFELGNQLRQFYIYQVRIHFFTSFNLIQTFKDIQRLEKYYVSPLAYIHLF 134
            +D EINK       N+L Q+Y   VR++ F  F L      I +L+      L +++  
Sbjct: 235 FNDEEINKNQ-----NKLLQYY---VRVNEFDKFLLCYV---IFKLDLIKGKTLIFVNNI 283

Query: 135 ESSGY--EWIIERDGLRHYLLNRNM----------EFHNNMKQRMESLFMQDDFEYVAEM 182
           +  GY  + ++E+ G+R  +LN  +          +F+ N+ Q    L   DD EY+ E 
Sbjct: 284 DR-GYRLKLVMEQFGIRSCILNSELPVNSRQHIVDQFNKNVYQL---LIATDDTEYIKEE 339

Query: 183 LDWVEKAH 190
            + VE+ H
Sbjct: 340 DEDVEEGH 347

>SAKL0F05016g Chr6 complement(397906..400050) [2145 bp, 714 aa] {ON}
           similar to uniprot|P40557 YIL005W Saccharomyces
           cerevisiae EPS1 protein disulfide isomerase related
           protein involved in endoplasmic reticulum retention of
           resident ER proteins
          Length = 714

 Score = 31.6 bits (70), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 42/102 (41%), Gaps = 11/102 (10%)

Query: 267 RIRTQEVFDIFVNEFPNSKPTIIEMRKLITHSTDFKTIVIAFLSTFEKKVL--------- 317
           R   QE+ DI   +   S   + +MR+ I HS D K ++  +L   E   L         
Sbjct: 530 RTNKQEMVDIMKQKNAPSADIVKKMREEIYHSYDHK-VLFTYLDIHENSYLLRRYGLNVH 588

Query: 318 NPSVTTTDALLAYVKSVKAFLTLDPSGRYLQSVIS-FVKQTF 358
           N +    D L+      K +   DP G YL S    F+K+T 
Sbjct: 589 NRAYNVGDVLIVDKNGGKFYYEQDPFGNYLTSHSPYFLKETL 630

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 84,565,324
Number of extensions: 3748793
Number of successful extensions: 10442
Number of sequences better than 10.0: 40
Number of HSP's gapped: 10521
Number of HSP's successfully gapped: 42
Length of query: 809
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 691
Effective length of database: 39,950,811
Effective search space: 27606010401
Effective search space used: 27606010401
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 70 (31.6 bits)