Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0F044508.318ON52452423020.0
Suva_10.2118.318ON56651111381e-150
SAKL0H15664g8.318ON55649711201e-147
Smik_12.1868.318ON57248111171e-146
YLR120C (YPS1)8.318ON56948511131e-146
Kpol_543.618.318ON58845611121e-146
TPHA0A015808.318ON60046310841e-141
Kwal_26.7254singletonON57049510781e-141
NCAS0C033008.318ON55945610701e-140
Smik_4.3888.318ON59749710741e-140
YDR144C (MKC7)8.318ON59647010711e-139
Skud_4.4038.318ON59049810661e-139
Suva_2.3058.318ON59747210441e-135
NDAI0G026208.318ON59048110371e-134
Smik_12.1878.319ON50747710111e-132
KAFR0H023008.318ON52147710061e-131
YLR121C (YPS3)8.319ON5084729931e-129
ZYRO0F10252gsingletonON5514739941e-128
Skud_12.1938.319ON4974729891e-128
ZYRO0G02904gsingletonON5315169591e-123
KNAG0G024108.318ON5304549541e-123
KAFR0B06530singletonON5384809521e-122
Ecym_42518.318ON5024499471e-122
Suva_10.2128.319ON7454449441e-118
KNAG0E03220singletonON5404879211e-117
KLTH0G12386g8.318ON5805169191e-117
TBLA0A039108.318ON5964809161e-116
ZYRO0F10318g8.319ON4864648931e-114
CAGL0M04191g8.318ON6013288911e-112
TBLA0D00140singletonON6074938911e-112
AGL192W8.318ON4994648781e-112
Skud_12.1928.318ON5693328811e-111
Kwal_33.14239singletonON6514698751e-109
NCAS0B035608.318ON5863328651e-109
ZYRO0F10230g8.318ON5803208561e-107
NDAI0J010308.318ON6523368451e-105
KLTH0F06754gsingletonON7674828521e-105
KAFR0B057108.318ON5753268261e-103
KNAG0I009108.318ON5693368161e-102
KAFR0E03940singletonON6384538181e-101
ZYRO0F10274gsingletonON5723338012e-99
TBLA0E02630singletonON6893377935e-97
TBLA0H012908.318ON6673327882e-96
SAKL0F07172g7.182ON5424147749e-96
KLLA0E04049g8.318ON5893307733e-95
KNAG0I009008.319ON5314807554e-93
CAGL0E01771gsingletonON5194257397e-91
Suva_9.13singletonON4644227313e-90
SAKL0C02970gsingletonON5924757413e-90
KAFR0I01700singletonON5524917331e-89
Suva_16.14singletonON5404787224e-88
CAGL0E01815gsingletonON5194317171e-87
Kwal_56.239028.318ON6293307242e-87
CAGL0E01793gsingletonON5164297031e-85
CAGL0E01749gsingletonON4824196897e-84
CAGL0E01881gsingletonON5084586847e-83
CAGL0E01859gsingletonON5054496812e-82
KAFR0B06700singletonON5314466832e-82
KNAG0I01200singletonON6774326845e-81
YIR039C (YPS6)singletonON5374056589e-79
CAGL0E01837gsingletonON5214466431e-76
CAGL0E01419g8.318ON5913436436e-76
NCAS0A124607.182ON5404256171e-72
Smik_65.1singletonON3423056011e-72
ZYRO0F10296gsingletonON5283286143e-72
Suva_34.1singletonON3873105945e-71
YIL015W (BAR1)7.182ON5874275973e-69
TPHA0C008408.318ON10004526153e-69
ZYRO0E02266gsingletonON5063305852e-68
KLLA0D15917g7.182ON5114265834e-68
CAGL0E01727gsingletonON5394125733e-66
Skud_9.1547.182ON5164335713e-66
KNAG0H027607.182ON5634295543e-63
Smik_9.1757.182ON5934105423e-61
AGR240W7.182ON4524085245e-60
SAKL0E15356gsingletonON5574675281e-59
NDAI0B017207.182ON5474425253e-59
Ecym_43947.182ON5184125093e-57
TDEL0H026507.182ON5524345035e-56
ZYRO0D15554g7.182ON5214114972e-55
CAGL0J02288g7.182ON5413924781e-52
Smik_5.7singletonON3042284612e-52
Kpol_1063.227.182ON3363074063e-44
Suva_79.1singletonON2272193738e-41
SAKL0H00330gsingletonON5784073747e-38
TBLA0D045807.182ON3954063313e-33
SAKL0H06512g8.677ON4044642707e-25
ZYRO0F07392g8.677ON4183732672e-24
NCAS0C013608.677ON4063762582e-23
NDAI0E021058.677ON4083742583e-23
TBLA0B038308.677ON4133992557e-23
Kwal_26.88028.677ON4123762521e-22
KNAG0J017108.677ON4153742503e-22
TPHA0D012608.677ON4193752494e-22
KLTH0D11264g8.677ON4173762476e-22
YPL154C (PEP4)8.677ON4053742414e-21
Smik_6.3518.677ON4053742343e-20
Skud_16.1288.677ON4053742334e-20
KLLA0D05929g8.677ON4093742317e-20
Suva_9.1877.182ON3331532288e-20
Suva_16.1568.677ON4063782301e-19
Suva_62.1singletonON2522492221e-19
Kpol_1013.68.677ON4023732282e-19
Suva_9.186singletonOFF5431542259e-19
Kpol_1072.158.677ON3994142211e-18
Ecym_23968.677ON4153772212e-18
TDEL0A062308.677ON4084712122e-17
CAGL0M02211g8.677ON4153852113e-17
KAFR0H024208.677ON4163672095e-17
Smik_5.6singletonON123941751e-14
ACR144W8.677ON4083911882e-14
Ecym_13245.401ON5763461625e-11
KLLA0F22088g5.401ON5582981581e-10
Smik_67.1singletonON1101111422e-10
YGL258W-AsingletonON77521332e-09
Skud_4.6185.401ON5863281473e-09
YDR349C (YPS7)5.401ON5963031421e-08
Smik_4.6135.401ON5962921376e-08
TDEL0E022305.401ON5732881368e-08
NDAI0C046105.401ON6093011351e-07
ACR150W5.401ON5534061322e-07
Suva_2.5205.401ON5982841224e-06
NCAS0F031505.401ON6454871207e-06
ZYRO0A06578g5.401ON7202781199e-06
AGR407CsingletonON2682961151e-05
KLTH0E02596g5.401ON5962731162e-05
KNAG0C051405.401ON5982931125e-05
SAKL0G07524g5.401ON6322781126e-05
ACR143WsingletonON393591108e-05
Kwal_55.200345.401ON5932111091e-04
TPHA0E019205.401ON6242711091e-04
CAGL0A02431g5.401ON5872371063e-04
Kpol_1059.335.401ON6622891054e-04
YGL259W (YPS5)singletonON16566995e-04
KAFR0E040805.401ON5964251010.001
TBLA0H016805.401ON609282890.031
TDEL0F002303.383ON17080712.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0F04450
         (524 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0F04450 Chr6 complement(835112..836686) [1575 bp, 524 aa] {O...   891   0.0  
Suva_10.211 Chr10 complement(394404..396104) [1701 bp, 566 aa] {...   442   e-150
SAKL0H15664g Chr8 (1365886..1367556) [1671 bp, 556 aa] {ON} simi...   436   e-147
Smik_12.186 Chr12 complement(367771..369489) [1719 bp, 572 aa] {...   434   e-146
YLR120C Chr12 complement(386511..388220) [1710 bp, 569 aa] {ON} ...   433   e-146
Kpol_543.61 s543 complement(141395..143161) [1767 bp, 588 aa] {O...   432   e-146
TPHA0A01580 Chr1 (315749..317551) [1803 bp, 600 aa] {ON} Anc_8.3...   422   e-141
Kwal_26.7254 s26 (280683..282395) [1713 bp, 570 aa] {ON} YLR120C...   419   e-141
NCAS0C03300 Chr3 (647716..649395) [1680 bp, 559 aa] {ON}              416   e-140
Smik_4.388 Chr4 complement(705092..706885) [1794 bp, 597 aa] {ON...   418   e-140
YDR144C Chr4 complement(744311..746101) [1791 bp, 596 aa] {ON}  ...   417   e-139
Skud_4.403 Chr4 complement(715972..717744) [1773 bp, 590 aa] {ON...   415   e-139
Suva_2.305 Chr2 complement(539604..541397) [1794 bp, 597 aa] {ON...   406   e-135
NDAI0G02620 Chr7 (599890..601662) [1773 bp, 590 aa] {ON}  YGL258W-A   404   e-134
Smik_12.187 Chr12 complement(370001..371524) [1524 bp, 507 aa] {...   394   e-132
KAFR0H02300 Chr8 (439083..440648) [1566 bp, 521 aa] {ON} Anc_8.3...   392   e-131
YLR121C Chr12 complement(388744..390270) [1527 bp, 508 aa] {ON} ...   387   e-129
ZYRO0F10252g Chr6 complement(828774..830429) [1656 bp, 551 aa] {...   387   e-128
Skud_12.193 Chr12 complement(371627..373120) [1494 bp, 497 aa] {...   385   e-128
ZYRO0G02904g Chr7 (220115..221710) [1596 bp, 531 aa] {ON} simila...   374   e-123
KNAG0G02410 Chr7 complement(550827..552419) [1593 bp, 530 aa] {O...   372   e-123
KAFR0B06530 Chr2 (1355295..1356911) [1617 bp, 538 aa] {ON}            371   e-122
Ecym_4251 Chr4 complement(520455..521963) [1509 bp, 502 aa] {ON}...   369   e-122
Suva_10.212 Chr10 complement(396611..398848) [2238 bp, 745 aa] {...   368   e-118
KNAG0E03220 Chr5 complement(647282..648904) [1623 bp, 540 aa] {O...   359   e-117
KLTH0G12386g Chr7 (1052977..1054719) [1743 bp, 580 aa] {ON} simi...   358   e-117
TBLA0A03910 Chr1 complement(977504..979294) [1791 bp, 596 aa] {O...   357   e-116
ZYRO0F10318g Chr6 complement(835672..837132) [1461 bp, 486 aa] {...   348   e-114
CAGL0M04191g Chr13 complement(461446..463251) [1806 bp, 601 aa] ...   347   e-112
TBLA0D00140 Chr4 (31269..33092) [1824 bp, 607 aa] {ON}                347   e-112
AGL192W Chr7 (337445..338944) [1500 bp, 499 aa] {ON} Syntenic ho...   342   e-112
Skud_12.192 Chr12 complement(369422..371131) [1710 bp, 569 aa] {...   343   e-111
Kwal_33.14239 s33 (582768..584723) [1956 bp, 651 aa] {ON} YDR144...   341   e-109
NCAS0B03560 Chr2 complement(629374..631134) [1761 bp, 586 aa] {O...   337   e-109
ZYRO0F10230g Chr6 complement(826246..827988) [1743 bp, 580 aa] {...   334   e-107
NDAI0J01030 Chr10 (235967..237925) [1959 bp, 652 aa] {ON}             330   e-105
KLTH0F06754g Chr6 (590569..592872) [2304 bp, 767 aa] {ON} weakly...   332   e-105
KAFR0B05710 Chr2 complement(1177594..1179321) [1728 bp, 575 aa] ...   322   e-103
KNAG0I00910 Chr9 (171104..172813) [1710 bp, 569 aa] {ON}              318   e-102
KAFR0E03940 Chr5 (779476..781392) [1917 bp, 638 aa] {ON}              319   e-101
ZYRO0F10274g Chr6 complement(831057..832775) [1719 bp, 572 aa] {...   313   2e-99
TBLA0E02630 Chr5 complement(665115..667184) [2070 bp, 689 aa] {O...   310   5e-97
TBLA0H01290 Chr8 (290515..292518) [2004 bp, 667 aa] {ON} Anc_8.3...   308   2e-96
SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {...   302   9e-96
KLLA0E04049g Chr5 (366535..368304) [1770 bp, 589 aa] {ON} simila...   302   3e-95
KNAG0I00900 Chr9 (169003..170598) [1596 bp, 531 aa] {ON}              295   4e-93
CAGL0E01771g Chr5 complement(175652..177211) [1560 bp, 519 aa] {...   289   7e-91
Suva_9.13 Chr9 (14409..15803) [1395 bp, 464 aa] {ON} YIR039C (REAL)   286   3e-90
SAKL0C02970g Chr3 (285647..287425) [1779 bp, 592 aa] {ON} some s...   290   3e-90
KAFR0I01700 Chr9 complement(346265..347923) [1659 bp, 552 aa] {O...   286   1e-89
Suva_16.14 Chr16 (11240..12862) [1623 bp, 540 aa] {ON} YIR039C (...   282   4e-88
CAGL0E01815g Chr5 complement(181154..182713) [1560 bp, 519 aa] {...   280   1e-87
Kwal_56.23902 s56 complement(767431..769320) [1890 bp, 629 aa] {...   283   2e-87
CAGL0E01793g Chr5 complement(178411..179961) [1551 bp, 516 aa] {...   275   1e-85
CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {...   270   7e-84
CAGL0E01881g Chr5 (188277..189803) [1527 bp, 508 aa] {ON} simila...   268   7e-83
CAGL0E01859g Chr5 complement(185870..187387) [1518 bp, 505 aa] {...   266   2e-82
KAFR0B06700 Chr2 complement(1396587..1398182) [1596 bp, 531 aa] ...   267   2e-82
KNAG0I01200 Chr9 (226271..228304) [2034 bp, 677 aa] {ON}              268   5e-81
YIR039C Chr9 complement(430498..432111) [1614 bp, 537 aa] {ON}  ...   258   9e-79
CAGL0E01837g Chr5 complement(183237..184802) [1566 bp, 521 aa] {...   252   1e-76
CAGL0E01419g Chr5 (132904..134679) [1776 bp, 591 aa] {ON} simila...   252   6e-76
NCAS0A12460 Chr1 complement(2461028..2462650) [1623 bp, 540 aa] ...   242   1e-72
Smik_65.1 Chr65 (2..1027) [1026 bp, 342 aa] {ON} YIR039C (REAL)       236   1e-72
ZYRO0F10296g Chr6 complement(833615..835201) [1587 bp, 528 aa] {...   241   3e-72
Suva_34.1 Chr34 complement(13..1176) [1164 bp, 387 aa] {ON} YIR0...   233   5e-71
YIL015W Chr9 (322342..324105) [1764 bp, 587 aa] {ON}  BAR1Aspart...   234   3e-69
TPHA0C00840 Chr3 (173318..176320) [3003 bp, 1000 aa] {ON} Anc_8....   241   3e-69
ZYRO0E02266g Chr5 complement(169081..170601) [1521 bp, 506 aa] {...   229   2e-68
KLLA0D15917g Chr4 complement(1336727..1338262) [1536 bp, 511 aa]...   229   4e-68
CAGL0E01727g Chr5 (171119..172738) [1620 bp, 539 aa] {ON} simila...   225   3e-66
Skud_9.154 Chr9 (291885..293435) [1551 bp, 516 aa] {ON} YIL015W ...   224   3e-66
KNAG0H02760 Chr8 (507659..509350) [1692 bp, 563 aa] {ON} Anc_7.1...   218   3e-63
Smik_9.175 Chr9 (296875..298656) [1782 bp, 593 aa] {ON} YIL015W ...   213   3e-61
AGR240W Chr7 (1200736..1202094) [1359 bp, 452 aa] {ON} Syntenic ...   206   5e-60
SAKL0E15356g Chr5 (1283552..1285225) [1674 bp, 557 aa] {ON} weak...   207   1e-59
NDAI0B01720 Chr2 complement(409125..410768) [1644 bp, 547 aa] {O...   206   3e-59
Ecym_4394 Chr4 (827655..829211) [1557 bp, 518 aa] {ON} similar t...   200   3e-57
TDEL0H02650 Chr8 (445052..446710) [1659 bp, 552 aa] {ON} Anc_7.1...   198   5e-56
ZYRO0D15554g Chr4 complement(1298587..1300152) [1566 bp, 521 aa]...   196   2e-55
CAGL0J02288g Chr10 complement(223820..225445) [1626 bp, 541 aa] ...   188   1e-52
Smik_5.7 Chr5 (4489..5403) [915 bp, 304 aa] {ON} YIR039C (REAL)       182   2e-52
Kpol_1063.22 s1063 (50979..51989) [1011 bp, 336 aa] {ON} (50979....   160   3e-44
Suva_79.1 Chr79 complement(1..681) [681 bp, 227 aa] {ON} YIR039C...   148   8e-41
SAKL0H00330g Chr8 complement(40564..42300) [1737 bp, 578 aa] {ON...   148   7e-38
TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa] ...   132   3e-33
SAKL0H06512g Chr8 complement(573927..575141) [1215 bp, 404 aa] {...   108   7e-25
ZYRO0F07392g Chr6 (598584..599840) [1257 bp, 418 aa] {ON} highly...   107   2e-24
NCAS0C01360 Chr3 complement(249141..250361) [1221 bp, 406 aa] {O...   103   2e-23
NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}    103   3e-23
TBLA0B03830 Chr2 complement(880233..881474) [1242 bp, 413 aa] {O...   102   7e-23
Kwal_26.8802 s26 (949063..950301) [1239 bp, 412 aa] {ON} YPL154C...   101   1e-22
KNAG0J01710 Chr10 (312872..314119) [1248 bp, 415 aa] {ON} Anc_8....   100   3e-22
TPHA0D01260 Chr4 (262523..263782) [1260 bp, 419 aa] {ON} Anc_8.6...   100   4e-22
KLTH0D11264g Chr4 (920981..922234) [1254 bp, 417 aa] {ON} highly...   100   6e-22
YPL154C Chr16 complement(259714..260931) [1218 bp, 405 aa] {ON} ...    97   4e-21
Smik_6.351 Chr6 (563275..564492) [1218 bp, 405 aa] {ON} YPL154C ...    95   3e-20
Skud_16.128 Chr16 complement(231348..232565) [1218 bp, 405 aa] {...    94   4e-20
KLLA0D05929g Chr4 (507555..508784) [1230 bp, 409 aa] {ON} highly...    94   7e-20
Suva_9.187 Chr9 (310921..311922) [1002 bp, 333 aa] {ON} YIL015W ...    92   8e-20
Suva_16.156 Chr16 complement(268862..270082) [1221 bp, 406 aa] {...    93   1e-19
Suva_62.1 Chr62 complement(3..758) [756 bp, 252 aa] {ON} YIR039C...    90   1e-19
Kpol_1013.6 s1013 (10059..11267) [1209 bp, 402 aa] {ON} (10059.....    92   2e-19
Suva_9.186 Chr9 (310161..310220,310267..310332,310362..310451,31...    91   9e-19
Kpol_1072.15 s1072 complement(35798..36997) [1200 bp, 399 aa] {O...    90   1e-18
Ecym_2396 Chr2 complement(769479..770726) [1248 bp, 415 aa] {ON}...    90   2e-18
TDEL0A06230 Chr1 (1091257..1092483) [1227 bp, 408 aa] {ON} Anc_8...    86   2e-17
CAGL0M02211g Chr13 complement(264202..265449) [1248 bp, 415 aa] ...    86   3e-17
KAFR0H02420 Chr8 complement(462759..464009) [1251 bp, 416 aa] {O...    85   5e-17
Smik_5.6 Chr5 (4120..4488) [369 bp, 123 aa] {ON} YIR039C (REAL)        72   1e-14
ACR144W Chr3 (603306..604532) [1227 bp, 408 aa] {ON} Syntenic ho...    77   2e-14
Ecym_1324 Chr1 complement(662306..664036) [1731 bp, 576 aa] {ON}...    67   5e-11
KLLA0F22088g Chr6 (2064310..2065986) [1677 bp, 558 aa] {ON} weak...    65   1e-10
Smik_67.1 Chr67 (653..982) [330 bp, 110 aa] {ON} YGL259W (REAL)        59   2e-10
YGL258W-A Chr7 (9162..9395) [234 bp, 77 aa] {ON} Putative protei...    56   2e-09
Skud_4.618 Chr4 complement(1101382..1103142) [1761 bp, 586 aa] {...    61   3e-09
YDR349C Chr4 complement(1172386..1174176) [1791 bp, 596 aa] {ON}...    59   1e-08
Smik_4.613 Chr4 complement(1098592..1100382) [1791 bp, 596 aa] {...    57   6e-08
TDEL0E02230 Chr5 (427831..429552) [1722 bp, 573 aa] {ON} Anc_5.4...    57   8e-08
NDAI0C04610 Chr3 complement(1052297..1054126) [1830 bp, 609 aa] ...    57   1e-07
ACR150W Chr3 (614407..616068) [1662 bp, 553 aa] {ON} Syntenic ho...    55   2e-07
Suva_2.520 Chr2 complement(929574..931370) [1797 bp, 598 aa] {ON...    52   4e-06
NCAS0F03150 Chr6 complement(630327..632264) [1938 bp, 645 aa] {O...    51   7e-06
ZYRO0A06578g Chr1 (533368..535530) [2163 bp, 720 aa] {ON} simila...    50   9e-06
AGR407C Chr7 complement(1475317..1476123) [807 bp, 268 aa] {ON} ...    49   1e-05
KLTH0E02596g Chr5 (235803..237593) [1791 bp, 596 aa] {ON} weakly...    49   2e-05
KNAG0C05140 Chr3 (999304..1001100) [1797 bp, 598 aa] {ON} Anc_5....    48   5e-05
SAKL0G07524g Chr7 (624810..626708) [1899 bp, 632 aa] {ON} simila...    48   6e-05
ACR143W Chr3 (601369..602550) [1182 bp, 393 aa] {ON} Syntenic ho...    47   8e-05
Kwal_55.20034 s55 (223867..225648) [1782 bp, 593 aa] {ON} YDR349...    47   1e-04
TPHA0E01920 Chr5 (393982..395856) [1875 bp, 624 aa] {ON} Anc_5.4...    47   1e-04
CAGL0A02431g Chr1 complement(261812..263575) [1764 bp, 587 aa] {...    45   3e-04
Kpol_1059.33 s1059 (70588..72576) [1989 bp, 662 aa] {ON} (70588....    45   4e-04
YGL259W Chr7 (8470..8967) [498 bp, 165 aa] {ON}  YPS5Protein wit...    43   5e-04
KAFR0E04080 Chr5 (818320..820110) [1791 bp, 596 aa] {ON} Anc_5.4...    44   0.001
TBLA0H01680 Chr8 (385315..387144) [1830 bp, 609 aa] {ON} Anc_5.4...    39   0.031
TDEL0F00230 Chr6 (36217..36729) [513 bp, 170 aa] {ON} Anc_3.383 ...    32   2.2  

>TDEL0F04450 Chr6 complement(835112..836686) [1575 bp, 524 aa] {ON}
           Anc_8.318 YLR120C
          Length = 524

 Score =  891 bits (2302), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/524 (84%), Positives = 445/524 (84%)

Query: 1   MQLLPAALISGFLLGSQAVALSDVDEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKR 60
           MQLLPAALISGFLLGSQAVALSDVDEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKR
Sbjct: 1   MQLLPAALISGFLLGSQAVALSDVDEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKR 60

Query: 61  DDGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVX 120
           DDGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPV 
Sbjct: 61  DDGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVT 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASG 180
                                   VDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASG
Sbjct: 121 QLSTSTLATSSGTATSSGNSGIATVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASG 180

Query: 181 TWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNSASSGAYQYENFP 240
           TWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNSASSGAYQYENFP
Sbjct: 181 TWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNSASSGAYQYENFP 240

Query: 241 MALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPI 300
           MALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPI
Sbjct: 241 MALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPI 300

Query: 301 EFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGY 360
           EFD             IRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGY
Sbjct: 301 EFDVTVQGVSVTSGSTIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGY 360

Query: 361 YSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFL 420
           YSMRCPSENNDTRLNFDFGGFQI                TCYLGMIPLTSNAAIFGDNFL
Sbjct: 361 YSMRCPSENNDTRLNFDFGGFQISANLSSYLLSSRSSSSTCYLGMIPLTSNAAIFGDNFL 420

Query: 421 VHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSSTWSTNQAIXXXXXX 480
           VHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSSTWSTNQAI      
Sbjct: 421 VHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSSTWSTNQAISTSGSG 480

Query: 481 XXXXXXXXXXXXXXXXXXXRNAVGDTLAPSPLFLLFATIISFFI 524
                              RNAVGDTLAPSPLFLLFATIISFFI
Sbjct: 481 SGSGTARTTTTSSNGASGARNAVGDTLAPSPLFLLFATIISFFI 524

>Suva_10.211 Chr10 complement(394404..396104) [1701 bp, 566 aa] {ON}
           YLR120C (REAL)
          Length = 566

 Score =  442 bits (1138), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 242/511 (47%), Positives = 313/511 (61%), Gaps = 42/511 (8%)

Query: 1   MQLLPAALISGFLLGSQAVAL-------SDVDEKPGKYVHLSFDKLRGNSYEEAGKGNKP 53
           +  + +AL+S  L  SQ +A         D  +   K+V LSFDKL G+S + AG+  KP
Sbjct: 3   LATIRSALLSS-LFASQTLAKLIPVATDGDGGDTGSKFVKLSFDKLYGDSLDTAGRDKKP 61

Query: 54  SAELRKRDDGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDS 113
              L KR DGYEEI I N+Q+FYS++LE+GTP+QN+TVL+DTGSSDLW+    NPYC   
Sbjct: 62  EVRLSKRADGYEEIIITNQQSFYSVDLEVGTPAQNITVLVDTGSSDLWIMGSSNPYCSSD 121

Query: 114 DDTKPV---------------------------XXXXXXXXXXXXXXXXXXXXXXXXXVD 146
           D +K V                                                    +D
Sbjct: 122 DSSKYVLRKRDTSSSSGDLVNDINPFGWLTETGSVTGATATATGSGTATQSVPASEATMD 181

Query: 147 CSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSN 206
           C EYGTF  S S++F+SNNTAF ISYGD TFA+GT+GTD  +L DLNVT LSFAVAN++N
Sbjct: 182 CEEYGTFTSSDSSTFKSNNTAFEISYGDGTFAAGTFGTDVLNLSDLNVTGLSFAVANETN 241

Query: 207 STVGVMGIGLAGLQSTYVGVNSASSG-AYQYENFPMALKSQGIIDRNAYSLFLNEPDADK 265
           ST+GV+GIGL  L+ TY G ++++ G +Y+Y+NFP+ LK+ G I  NAYSL+LN+ DA  
Sbjct: 242 STMGVLGIGLPSLEVTYSGSSASNGGKSYKYDNFPIVLKNSGAIKSNAYSLYLNDSDAKH 301

Query: 266 GSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXXXX-XXXXIRNLTNTQ 324
           G++LFG VDH+KYSG LYTV ++N     G  +PI+FD               + LT T+
Sbjct: 302 GTILFGGVDHNKYSGTLYTVALVNTL--SGFTSPIQFDITLNGLGIIDDNGDEKTLTTTK 359

Query: 325 FPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIX 384
            P LLDSGTTL+Y+P  + +LIA  VGAQYS   GYY M CPS +N T + FDFGGF I 
Sbjct: 360 IPVLLDSGTTLTYLPVEMVELIAENVGAQYSSRIGYYVMECPSSDNSTEIVFDFGGFHI- 418

Query: 385 XXXXXXXXXXXXXXXTCYLGMIPLT-SNAAIFGDNFLVHAYVVYDLENYEISMAQAAFNN 443
                          TC LG+IP + S  +I GD+FL +AYVVYDLEN EISMAQA +N 
Sbjct: 419 -NASLSSFILSTSGNTCLLGIIPTSDSTGSILGDSFLTNAYVVYDLENLEISMAQAKYNV 477

Query: 444 SDSQIEVISDSIPSAVRAQGYSSTWSTNQAI 474
           +   IEVIS S+P+AV+A GY++TWST  +I
Sbjct: 478 TSEDIEVISTSVPNAVKAPGYTNTWSTTASI 508

>SAKL0H15664g Chr8 (1365886..1367556) [1671 bp, 556 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 556

 Score =  436 bits (1120), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 234/497 (47%), Positives = 299/497 (60%), Gaps = 38/497 (7%)

Query: 8   LISGFLLGSQAVALSDVDEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKRDDGYEEI 67
           +I+  LL SQ V  S + ++  KYV L FDK RG++YEE+ K NKP A L KRDDG++EI
Sbjct: 5   IIAISLLLSQLVTASVLKKRSPKYVSLPFDKSRGSTYEESSKHNKPYAVLSKRDDGFQEI 64

Query: 68  EIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYC----------------- 110
           E+ N+ +F+S+ELEIGTP QNVTVL+DTGSSDLWV+   NPYC                 
Sbjct: 65  ELKNQVSFFSVELEIGTPRQNVTVLVDTGSSDLWVTGSNNPYCRAGSVGNRRNDASSGSG 124

Query: 111 -------------IDSDDTKPVX-------XXXXXXXXXXXXXXXXXXXXXXXXVDCSEY 150
                        I  D+   V                                +DCS+Y
Sbjct: 125 SGSGSSNNKKRVNIKRDEISSVRSWLTASGTNTRTQSGSASATRANSLSSALATIDCSQY 184

Query: 151 GTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVG 210
           GTF+ S S++F SN+T F I YGD+++A GTWG D   L D+++  LSFAVANQ+NSTVG
Sbjct: 185 GTFNTSASSTFSSNDTLFVIFYGDSSYAYGTWGQDELYLHDIDIGGLSFAVANQTNSTVG 244

Query: 211 VMGIGLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLF 270
           V+GIGL GL+ TY G  S++   YQY+NFP+ LK   +I  NAYSLFLN  ++  GS+LF
Sbjct: 245 VLGIGLPGLEVTYSGYASSARNRYQYDNFPLILKRNNVIKANAYSLFLNSTNSSSGSLLF 304

Query: 271 GAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQFPALLD 330
           GAVDHSKYSGQLYTVP+LN   + G  +PI+F+                LT T  PALLD
Sbjct: 305 GAVDHSKYSGQLYTVPLLNTLESSGYTDPIQFEVAVQGIGVRTSGSNTTLTTTVIPALLD 364

Query: 331 SGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXXXXXXX 390
           SG TLSY P  + ++IA A+ A YS   GYY + CPS ++DT + +DFGGF I       
Sbjct: 365 SGATLSYFPVQVAEMIADALDATYSSSYGYYIVDCPSSDDDTEIIYDFGGFHI-ASKLTD 423

Query: 391 XXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEV 450
                     C LG++P  SN  I GD FL  AYVVYDL+N+EIS+AQA +   D QIEV
Sbjct: 424 YILTTNRPSICVLGIVPQNSNRFILGDVFLTSAYVVYDLDNFEISLAQANYEGGDEQIEV 483

Query: 451 ISDSIPSAVRAQGYSST 467
           IS+S+PSA++A  YSST
Sbjct: 484 ISESVPSAIKAPSYSST 500

>Smik_12.186 Chr12 complement(367771..369489) [1719 bp, 572 aa] {ON}
           YLR120C (REAL)
          Length = 572

 Score =  434 bits (1117), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 238/481 (49%), Positives = 301/481 (62%), Gaps = 41/481 (8%)

Query: 30  KYVHLSFDKLRGNSYEEAGKGNKPSAELRKRDDGYEEIEIYNEQNFYSIELEIGTPSQNV 89
           K+V L F KL G+S +  G+  KP A L KR DGYEEI I N+Q+FYS+EL++G+P QNV
Sbjct: 40  KFVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNV 99

Query: 90  TVLLDTGSSDLWVSSPENPYC------------IDSDD--------------------TK 117
           TVL+DTGSSDLW+    NPYC            ID  D                    T 
Sbjct: 100 TVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTG 159

Query: 118 PVXXXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTF 177
            +                         +DC EYGTF  S S++FRSNNT FSISYGD TF
Sbjct: 160 GLIGPTATGSGGSSETATQSVPASEATMDCKEYGTFTTSDSSTFRSNNTYFSISYGDGTF 219

Query: 178 ASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNSASSG--AYQ 235
           ASGT+GTD  DL DLNVT LSFAVAN++NST+GV+GIGL  L+ TY G ++AS G   ++
Sbjct: 220 ASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSG-STASRGRRPFK 278

Query: 236 YENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRG 295
           Y+NFP+ LK+ G I  NAYSL+LN+ DA+ G++LFGAVDHSKY+G LYT+P++N     G
Sbjct: 279 YDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASG 338

Query: 296 IQNPIEFDXXXX-XXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQY 354
             +PI+FD               + LT T+ PALLDSGTTL+Y+P T+  LIA  +GAQY
Sbjct: 339 FSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQY 398

Query: 355 SQYTGYYSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTSN-AA 413
           S   GYY + CPS+++ T++ FDFGGF I                TC LG+IP + N   
Sbjct: 399 SYRLGYYVLDCPSDDS-TQIVFDFGGFHI---NASLSSFILSTGSTCLLGIIPTSDNTGT 454

Query: 414 IFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSSTWSTNQA 473
           I GD+FL +AYVVYDL+N EISMAQA +N +   IEVIS SIPSAV+A GY++TWST+  
Sbjct: 455 ILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTWSTSAT 514

Query: 474 I 474
           I
Sbjct: 515 I 515

>YLR120C Chr12 complement(386511..388220) [1710 bp, 569 aa] {ON}
           YPS1Aspartic protease, member of the yapsin family of
           proteases involved in cell wall growth and maintenance;
           attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 569

 Score =  433 bits (1113), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 234/485 (48%), Positives = 298/485 (61%), Gaps = 39/485 (8%)

Query: 25  DEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKRDDGYEEIEIYNEQNFYSIELEIGT 84
           D+   K+V L F KL G+S E  G   KP   L KR DGYEEI I N+Q+FYS++LE+GT
Sbjct: 32  DDSNSKFVKLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEEIIITNQQSFYSVDLEVGT 91

Query: 85  PSQNVTVLLDTGSSDLWVSSPENPYC------------IDSDD----------------- 115
           P QNVTVL+DTGSSDLW+   +NPYC            ID  D                 
Sbjct: 92  PPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKRDDSSSGGSLINDINPFGW 151

Query: 116 ---TKPVXXXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISY 172
              T                            +DC +YGTF  S S++FRSNNT FSISY
Sbjct: 152 LTGTGSAIGPTATGLGGGSGTATQSVPASEATMDCQQYGTFSTSGSSTFRSNNTYFSISY 211

Query: 173 GDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNSASSG 232
           GD TFASGT+GTD  DL DLNVT LSFAVAN++NST+GV+GIGL  L+ TY G  ++ SG
Sbjct: 212 GDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASHSG 271

Query: 233 -AYQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMY 291
            AY+Y+NFP+ LK+ G I  N YSL+LN+ DA  G++LFGAVDHSKY+G LYT+P++N  
Sbjct: 272 KAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTL 331

Query: 292 RNRGIQNPIEFDXXXXXXXXXXXXXI-RNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAV 350
              G  +PI+FD               + LT T+ PALLDSGTTL+Y+P T+  +IA  +
Sbjct: 332 SASGFSSPIQFDVTINGIGISDSGSSNKTLTTTKIPALLDSGTTLTYLPQTVVSMIATEL 391

Query: 351 GAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTS 410
           GAQYS   GYY + CPS+++   + FDFGGF I                TC LG+IP + 
Sbjct: 392 GAQYSSRIGYYVLDCPSDDS-MEIVFDFGGFHI---NAPLSSFILSTGTTCLLGIIPTSD 447

Query: 411 N-AAIFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSSTWS 469
           +   I GD+FL +AYVVYDLEN EISMAQA +N +   IE+I+ S+PSAV+A GY++TWS
Sbjct: 448 DTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIITSSVPSAVKAPGYTNTWS 507

Query: 470 TNQAI 474
           T+ +I
Sbjct: 508 TSASI 512

>Kpol_543.61 s543 complement(141395..143161) [1767 bp, 588 aa] {ON}
           complement(141395..143161) [1767 nt, 589 aa]
          Length = 588

 Score =  432 bits (1112), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 229/456 (50%), Positives = 284/456 (62%), Gaps = 34/456 (7%)

Query: 26  EKPGK------YVHLSFDKLRGNSYEEAGKGNKPSAELRKRDDGYEEIEIYNEQNFYSIE 79
           ++PG       +V   FDKL G+S+E A   NK  A + KRD+G EE+EI N+ NFYS+ 
Sbjct: 53  QQPGASNESQGFVRYHFDKLVGDSFENASNKNKRYANIVKRDNGVEEVEIMNQSNFYSVS 112

Query: 80  LEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXXXXXXXXXXX 139
           L IG+ +QNVTVLLDTGSSDLWV+   NP C   D                         
Sbjct: 113 LSIGSNAQNVTVLLDTGSSDLWVTGSNNPLCSRGDSNSDA-------------------- 152

Query: 140 XXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSF 199
                VDC+++GTF+PS S ++ SN T+FSISY D+++ASGTWG D   L DL+VT LSF
Sbjct: 153 -----VDCAKFGTFNPSTSDTWSSNETSFSISYADSSYASGTWGQDTLKLQDLDVTGLSF 207

Query: 200 AVANQSNSTVGVMGIGLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNAYSLFLN 259
           AVAN +NSTVGV+GIGL  L+ TY G N+ +   YQYENFP+ LK+ G    NAYSL+LN
Sbjct: 208 AVANYTNSTVGVLGIGLPSLEVTYSGSNNVAGTRYQYENFPLLLKNSGATKANAYSLYLN 267

Query: 260 EPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIR- 318
           + D+  GSVLFG VDH+KYSG LYT+P++N  R  G   P+EFD                
Sbjct: 268 DLDSRTGSVLFGGVDHNKYSGTLYTIPLVNTLRAAGFSQPVEFDVTLQGMGISDDEHGNV 327

Query: 319 NLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDF 378
            LT T+ PALLDSGTTL Y+P  L  LIA    A Y+  TGYY M CP  + D+++ FDF
Sbjct: 328 TLTTTKIPALLDSGTTLVYLPSALVSLIADEYDAVYNSRTGYYVMNCPDSDEDSQIVFDF 387

Query: 379 GGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQ 438
           GGF I                 C LG++P +S  AI GD+FL HAYVVYDL+N EISMAQ
Sbjct: 388 GGFHI--STNLTTYIIQAVGGICVLGILPQSSGTAILGDSFLQHAYVVYDLDNLEISMAQ 445

Query: 439 AAFNNSDSQIEVISDSIPSAVRAQGYSSTWSTNQAI 474
           A+F   D  +EVIS SIPSAV+A GYSSTWST  +I
Sbjct: 446 ASFETDDENVEVISSSIPSAVKAPGYSSTWSTFSSI 481

>TPHA0A01580 Chr1 (315749..317551) [1803 bp, 600 aa] {ON} Anc_8.318
           YLR120C
          Length = 600

 Score =  422 bits (1084), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 223/463 (48%), Positives = 291/463 (62%), Gaps = 22/463 (4%)

Query: 13  LLGSQAVALSDVD-EKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKRDDGYEEIEIYN 71
           L G++   L+  D  +   ++   FDK  G+SY+ + K NKP  ++ KRD GYEEIE+ N
Sbjct: 25  LFGNKKPQLTKRDGSEIDNFIKFKFDKSYGDSYKNSSKRNKPKLDIVKRD-GYEEIELKN 83

Query: 72  EQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXXX 131
           E +FYSI+L IGTP+QNVTVL+DTGSSDLWV+  +NP C   D T               
Sbjct: 84  ESSFYSIKLSIGTPAQNVTVLIDTGSSDLWVTGSDNPLCSSDDAT--------------- 128

Query: 132 XXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGD 191
                        +DCS YGTFD   S+SF SN+T+F+I+YGD ++A G WG D   L D
Sbjct: 129 --FTGSDGSSQSSIDCSLYGTFDIDDSSSFTSNDTSFAITYGDGSYALGNWGQDVLSLQD 186

Query: 192 LNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDR 251
           ++VT LSFAVAN +NSTVGV+GIGL  L++TY G + A S  YQY+N P+ L++ G +  
Sbjct: 187 IDVTGLSFAVANYTNSTVGVLGIGLPSLEATYSG-SLAGSNPYQYDNLPLVLRNSGAVKS 245

Query: 252 NAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXXX 311
            AYSLFLN+ D+ +GS+LFG VDHSKY G L T+P++N  ++ G Q+P EFD        
Sbjct: 246 YAYSLFLNDEDSSEGSILFGGVDHSKYEGTLNTLPLVNYQKSSGFQSPYEFDITLQGLGI 305

Query: 312 XXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENND 371
                   +++TQ  ALLDSGTTL+Y+P TLT L+A  + A YS   GYY+M CPS ++ 
Sbjct: 306 STSSKNTTVSDTQIVALLDSGTTLTYLPVTLTSLLAAELNASYSARLGYYTMSCPSSSDS 365

Query: 372 TRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLEN 431
           T + FDFGGF I                 C LG+IP + + AI GD+FL HAYVVYDLEN
Sbjct: 366 TEIVFDFGGFHI--NVPLTSFIVTSSMNVCILGIIPRSGDQAILGDSFLQHAYVVYDLEN 423

Query: 432 YEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSSTWSTNQAI 474
            EIS+AQA + +S   IE I  S+PSAVRA  YS+TWST   I
Sbjct: 424 LEISLAQAKYGSSSEDIEAIVSSVPSAVRAASYSNTWSTAATI 466

>Kwal_26.7254 s26 (280683..282395) [1713 bp, 570 aa] {ON} YLR120C
           (YPS1) - GPI-anchored aspartic protease [contig 47] FULL
          Length = 570

 Score =  419 bits (1078), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 231/495 (46%), Positives = 297/495 (60%), Gaps = 32/495 (6%)

Query: 9   ISGFLLGSQAVALSDVD-EKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKRDDGYEEI 67
           ISG L+ S AV+L +++ +   KYV +SFDKLRG++ E+A  G  P AEL KR DG E I
Sbjct: 12  ISG-LVSSTAVSLQEIEPQDVSKYVRISFDKLRGDTAEDARVGLMPRAELVKRADGSETI 70

Query: 68  EIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDS-------------- 113
           +I N+ NFYS+E+ +G+P+QNVT+L+DTGSSD+WV    NP+C  S              
Sbjct: 71  KIKNQNNFYSVEVGVGSPAQNVTLLIDTGSSDMWVMGSNNPFCEGSSRSSKHVLLGENIG 130

Query: 114 --DDTKP-----------VXXXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTS 160
             D+T                                       + CS YGTF    S+S
Sbjct: 131 LEDETVKKDFFSSFRSLLTATATSTVSASAVAPSRTSVAASDATLSCSSYGTFATGSSSS 190

Query: 161 FRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQ 220
           F+SNNT F I YGD T+A GTWG D+  L D+ V++LS AVAN+SNST GV+GIGL GL+
Sbjct: 191 FKSNNTDFYIQYGDLTYALGTWGHDDVTLQDITVSDLSMAVANESNSTFGVLGIGLTGLE 250

Query: 221 STYVG-VNSASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYS 279
            T VG + S+S  AY Y+N P  L  QG I +NAYSLFL++ DA+ GSVLFGAVDHSKY+
Sbjct: 251 VTNVGSLVSSSRSAYTYQNLPALLVDQGKIHQNAYSLFLDDLDAEHGSVLFGAVDHSKYT 310

Query: 280 GQLYTVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMP 339
           G LYTVP++N+Y++ G  +PI+ D                 T T  PALLDSGTTL+Y+P
Sbjct: 311 GNLYTVPLVNIYKSSGFPDPIQLDVTLQGLGMSANKTNITFTTTPIPALLDSGTTLTYLP 370

Query: 340 YTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXX 399
            ++ Q IA  + AQYS   GYY + C   ++   L FDFGGF I                
Sbjct: 371 SSMVQSIARRLSAQYSYDVGYYVLECSEVSDSDELVFDFGGFHIKSKLQNFLIKASSNF- 429

Query: 400 TCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAV 459
            C LG++P +S+ AI GDNFL  AYVVYDLEN E+SMAQA ++     IEVIS +IP AV
Sbjct: 430 -CALGLVPQSSSRAILGDNFLTAAYVVYDLENLEVSMAQANYDGGSEDIEVISSTIPGAV 488

Query: 460 RAQGYSSTWSTNQAI 474
           +A GYSSTWS+   I
Sbjct: 489 KAPGYSSTWSSRIPI 503

>NCAS0C03300 Chr3 (647716..649395) [1680 bp, 559 aa] {ON} 
          Length = 559

 Score =  416 bits (1070), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 225/456 (49%), Positives = 296/456 (64%), Gaps = 34/456 (7%)

Query: 25  DEKPGKYVHLSFDKLRGNSYEEAGK-GNKPSAELRKRDDG-YEEIEIYNEQNFYSIELEI 82
           +E P K+V+L F+K  G+ Y+ A     KP  EL KRD   YEE+E+ N+Q+FYS+E+++
Sbjct: 27  NELPNKFVNLRFNKKYGDHYDTASTDSRKPKLELVKRDGSDYEEVELTNQQSFYSVEVDV 86

Query: 83  GTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXXXXXXXXXXXXXX 142
           GTPSQ VTVLLDTGSSD WV   +NPYC  SDDT                          
Sbjct: 87  GTPSQRVTVLLDTGSSDFWVMGSDNPYC--SDDTSTTG---------------------- 122

Query: 143 XXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVA 202
             +DCSE+GTFD S S++F +N TAF+I YGD +FA GTWGTD   + D+ +  LS AVA
Sbjct: 123 --IDCSEFGTFDSSSSSTFHNNGTAFNIHYGDGSFALGTWGTDTVSIDDITLDALSLAVA 180

Query: 203 NQSNSTVGVMGIGLAGLQSTYVGVNSASSG-AYQYENFPMALKSQGIIDRNAYSLFLNEP 261
           N SNS++GV+G+GLAGL++TY   ++  SG  YQY NFP+ALK+ GI+  NAYSL+LN+P
Sbjct: 181 NSSNSSMGVIGLGLAGLETTYSSSHAVKSGQTYQYANFPLALKNAGIVAANAYSLYLNDP 240

Query: 262 DADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXX-XXXXXXXXXIRNL 320
           +   G++LFGAVDHS YSGQLYT+P++N+Y   G +N +EFD                 +
Sbjct: 241 EETTGNILFGAVDHSLYSGQLYTIPLVNIYSGSGFKNAVEFDVTLNGIGIVDSSGSATTV 300

Query: 321 TNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPS-ENNDTRLNFDFG 379
           + T   ALLDSGTTL+Y P     L+A  +GAQYS   GYY++ C + ++  T+L FDFG
Sbjct: 301 STTPIIALLDSGTTLTYFPTQYVSLLAAQLGAQYSSSNGYYTISCDAMQDTTTKLVFDFG 360

Query: 380 GFQIXXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQA 439
           GF I                TC+L +IP  S++AI GD FL +AYVVYDL+N EISMAQA
Sbjct: 361 GFHI--NATLADFVVQSGTSTCFLSIIPQNSSSAILGDTFLNNAYVVYDLDNLEISMAQA 418

Query: 440 AFN-NSDSQIEVISDSIPSAVRAQGYSSTWSTNQAI 474
            ++ +SD  IEVIS S+PSAV+A GYS+TWST  +I
Sbjct: 419 KWDQSSDEDIEVISSSVPSAVKAPGYSNTWSTTMSI 454

>Smik_4.388 Chr4 complement(705092..706885) [1794 bp, 597 aa] {ON}
           YDR144C (REAL)
          Length = 597

 Score =  418 bits (1074), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 229/497 (46%), Positives = 296/497 (59%), Gaps = 30/497 (6%)

Query: 8   LISGFLLGSQAV----ALSDVDEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKRDDG 63
           +++  LL S  V     +S   E    YV ++F +  G+S+E A    K  A L  R D 
Sbjct: 9   VVNALLLHSSMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATNDTKARARLVTRGDD 68

Query: 64  YEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYC------------- 110
           YE +E+ N+ +FYS+EL+IGTP Q VTVL+DTGSSDLWV+  +NPYC             
Sbjct: 69  YELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFK 128

Query: 111 -IDSDDTKPVXXXX-------XXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFR 162
            ++ D+   V                                ++C+ YGTFD SKS++F 
Sbjct: 129 HVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFE 188

Query: 163 SNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQST 222
           SN T FSI+YGD+TFASGTWG D   L +LNVT LSFAVAN++NSTVGV+GIGL GL+ST
Sbjct: 189 SNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLEST 248

Query: 223 YVGVN-SASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQ 281
           Y GV+ S++  +Y Y NFPM LK+ G I   AYSLF N  D+  G++LFGAVDH KY+G 
Sbjct: 249 YSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGD 308

Query: 282 LYTVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRN---LTNTQFPALLDSGTTLSYM 338
           LYT+P++N  +NRG ++PI+F                N   LT T+ P LLDSGTT+SYM
Sbjct: 309 LYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYM 368

Query: 339 PYTLTQLIAGAVGAQYSQYTGYYSMRCPSE-NNDTRLNFDFGGFQIXXXXXXXXXXXXXX 397
           P  L ++IA  VGA YS   GYY M C +E   ++ L FDFGGF I              
Sbjct: 369 PADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSR 428

Query: 398 XXTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPS 457
              C LG+ P +  A I GDNFLV  YVVYDL+N EISMA A F++    I+ I DS+PS
Sbjct: 429 SNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTIKDSVPS 488

Query: 458 AVRAQGYSSTWSTNQAI 474
           A++A GYSSTWST ++I
Sbjct: 489 ALKAPGYSSTWSTYESI 505

>YDR144C Chr4 complement(744311..746101) [1791 bp, 596 aa] {ON}
           MKC7GPI-anchored aspartyl protease, member of the yapsin
           family of proteases involved in cell wall growth and
           maintenance; shares functions with Yap3p and Kex2p
          Length = 596

 Score =  417 bits (1071), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 219/470 (46%), Positives = 286/470 (60%), Gaps = 26/470 (5%)

Query: 31  YVHLSFDKLRGNSYEEAGKGNKPSAELRKRDDGYEEIEIYNEQNFYSIELEIGTPSQNVT 90
           YV ++F K  G+S+E A    K    L  RDD YE +E+ N+ +FYS+EL+IGTP Q VT
Sbjct: 36  YVKMNFQKKYGSSFENALDDTKGRTRLMTRDDDYELVELTNQNSFYSVELDIGTPPQKVT 95

Query: 91  VLLDTGSSDLWVSSPENPYC--------------IDSDDTKPVXXXX-------XXXXXX 129
           VL+DTGSSDLWV+  +NPYC              ++ D    V                 
Sbjct: 96  VLVDTGSSDLWVTGSDNPYCSTKKKDTTGSSFKQVNKDALASVVESVFTEISYDTTIVTS 155

Query: 130 XXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDL 189
                          +DC+ YGTF+ SKS++F SNNT FSI+YGDTTFASGTWG D   L
Sbjct: 156 EATATFDSTASTSQLIDCATYGTFNTSKSSTFNSNNTEFSIAYGDTTFASGTWGHDQLSL 215

Query: 190 GDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVN-SASSGAYQYENFPMALKSQGI 248
            DLN+T LSFAVAN++NSTVGV+GIGL GL+STY GV+ S+   +Y Y NFPM LK+ G+
Sbjct: 216 NDLNITGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGV 275

Query: 249 IDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXX- 307
           I   AYSLF N+ D+  G++LFGAVDH KY+G LYT+P++N  ++RG ++PI+F      
Sbjct: 276 IKSTAYSLFANDSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQHRGYKDPIQFQVTLQG 335

Query: 308 --XXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRC 365
                      +  LT T+ P LLDSGTT+SYMP  L +++A  VGA YS   GYY M C
Sbjct: 336 LGTSKGDKEDNLTTLTTTKIPVLLDSGTTISYMPTELVKMLADQVGATYSSAYGYYIMDC 395

Query: 366 PSE-NNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAY 424
             E   ++ + FDFGGF +                 C LG+ P +    I GDNFL + Y
Sbjct: 396 IKEMEEESSIIFDFGGFYLSNWLSDFQLVTDSRSNICILGIAPQSDPTIILGDNFLANTY 455

Query: 425 VVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSSTWSTNQAI 474
           VVYDL+N EISMAQA F++    IE+I  ++PSA++A GYSSTWST ++I
Sbjct: 456 VVYDLDNMEISMAQANFSDDGEYIEIIESAVPSALKAPGYSSTWSTYESI 505

>Skud_4.403 Chr4 complement(715972..717744) [1773 bp, 590 aa] {ON}
           YDR144C (REAL)
          Length = 590

 Score =  415 bits (1066), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 223/498 (44%), Positives = 300/498 (60%), Gaps = 32/498 (6%)

Query: 3   LLPAALISGFLLGSQAVALSDVDEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKRDD 62
           LL ++ +S   + S ++A S+       YV ++F+K  G+S+E A       A L +R+D
Sbjct: 14  LLYSSTVSADSIASASIATSE------SYVIMNFEKKYGDSFENASNDRNAGAHLVRRED 67

Query: 63  GYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYC------------ 110
            YE +++ NE +FYS+EL+IGTP Q +TVL+DTGSSDLWV+   NPYC            
Sbjct: 68  DYELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSF 127

Query: 111 --IDSDDTKPVXXXXXXXXXXXXXXXXXXXXXX-------XXXVDCSEYGTFDPSKSTSF 161
             I  D+   V                                ++C  YGTFD SKS++F
Sbjct: 128 KQIHKDNPASVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFDSSKSSTF 187

Query: 162 RSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQS 221
            SN T FSI+YGD+TFASGTWG D  +L +LNVT LSFAVAN++NSTVGV+GIGL GL+S
Sbjct: 188 ESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLES 247

Query: 222 TYVGVN-SASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSG 280
           TY GV+ S+   +Y Y NFPM LK+ G I  +AYSLF N+ +++ G++LFGAVDH KY+G
Sbjct: 248 TYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTG 307

Query: 281 QLYTVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRN---LTNTQFPALLDSGTTLSY 337
            LYT+P++N+ +N G ++PI+F              + N   LT T+ PALLDSGTT+SY
Sbjct: 308 DLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISY 367

Query: 338 MPYTLTQLIAGAVGAQYSQYTGYYSMRCPSE-NNDTRLNFDFGGFQIXXXXXXXXXXXXX 396
           +P  L +L+A  VGA YS   GYY M C  E   D  + FDFGGF I             
Sbjct: 368 LPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDS 427

Query: 397 XXXTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIP 456
               C LG  P +    I GDNFLV  Y+VYDL+N EISMA A F+++D  I+VI  ++P
Sbjct: 428 SSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDVIESAVP 487

Query: 457 SAVRAQGYSSTWSTNQAI 474
           SA++A  YS+TWST ++I
Sbjct: 488 SALKAPNYSNTWSTYESI 505

>Suva_2.305 Chr2 complement(539604..541397) [1794 bp, 597 aa] {ON}
           YDR144C (REAL)
          Length = 597

 Score =  406 bits (1044), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 220/472 (46%), Positives = 281/472 (59%), Gaps = 28/472 (5%)

Query: 31  YVHLSFDKLRGNSYEEAGKGNKPSAELRKRDDGYEEIEIYNEQNFYSIELEIGTPSQNVT 90
           YV + F K  G+S+E A    K  A L KR D YE +++ N+ +FYS++L+IGTPSQ VT
Sbjct: 36  YVRIQFQKKYGDSFENASSNKKTEARLVKRGDDYEVVDLSNQNSFYSVDLDIGTPSQKVT 95

Query: 91  VLLDTGSSDLWVSSPENPYC--------------IDSDDTKPVXXXXXXXXXXXXX---- 132
           VL+DTGSSDLWV+   NPYC               D D+   +                 
Sbjct: 96  VLVDTGSSDLWVTGSNNPYCSTKSGHTSSSSKERKDEDNILSLVQSVVQSVASEISYDTT 155

Query: 133 -------XXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTD 185
                              +DC+ YG FD SKS++F+SN T FSI+YGD TFASGTWG D
Sbjct: 156 ITDTDATATQDSTSSALQTIDCTTYGVFDSSKSSTFQSNKTDFSITYGDLTFASGTWGHD 215

Query: 186 NFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVN-SASSGAYQYENFPMALK 244
             +L +LNVT LSFAVAN++NSTVGV+GIGLAGL+STY G   S++  +Y Y NFPM LK
Sbjct: 216 QLNLNNLNVTGLSFAVANETNSTVGVLGIGLAGLESTYSGATLSSAQESYTYNNFPMVLK 275

Query: 245 SQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDX 304
           + G I   AYSLFLNE +A  GS+LFGAVDH KYSG LYT+P++N  ++ G ++PI+F  
Sbjct: 276 NSGAIKSAAYSLFLNETNAKHGSILFGAVDHGKYSGDLYTIPIINTLQDHGYKDPIQFQV 335

Query: 305 XXX-XXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSM 363
                           +T T+ PALLDSGTT+SYMP  L +++A  +GA YS   GYY M
Sbjct: 336 TLQGLGLAKGDSESTTITTTKIPALLDSGTTISYMPVELMEMLADKLGASYSSKVGYYLM 395

Query: 364 -RCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVH 422
                 ++D  + FDFGGF I                 C LG  P + +  I GDNFL +
Sbjct: 396 DCITDTDDDINVVFDFGGFYISGNLSSYQLSADSSSDVCILGFAPQSDSTVILGDNFLSN 455

Query: 423 AYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSSTWSTNQAI 474
           AYVVYDL+N EISMAQ   +     I+VI DS+PSAV+A  YSSTWST+ +I
Sbjct: 456 AYVVYDLDNMEISMAQVDLSGRSEDIDVIEDSVPSAVKAPSYSSTWSTDGSI 507

>NDAI0G02620 Chr7 (599890..601662) [1773 bp, 590 aa] {ON}  YGL258W-A
          Length = 590

 Score =  404 bits (1037), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 220/481 (45%), Positives = 306/481 (63%), Gaps = 32/481 (6%)

Query: 4   LPAALISGFLLG-----SQAVALSDVDEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELR 58
           + + +IS  LL      SQA A S  +  P KY+ L+F+K  G+S+  +   N PSA+L 
Sbjct: 1   MTSRIISHILLSLPYFISQASASSKDNTSPPKYLALNFEKRYGDSFLNSSSSNGPSAQLI 60

Query: 59  KRDDGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKP 118
           KRDDGYE++ + N+Q+FYS+E+E+GTPSQ +TVLLDTGSSD WV+S +NPYC        
Sbjct: 61  KRDDGYEQVTLTNQQSFYSVEVEMGTPSQKLTVLLDTGSSDFWVTSSDNPYC-------- 112

Query: 119 VXXXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFA 178
                                     +DCS YGTFD SKS++F+SN+T F ISYGD +FA
Sbjct: 113 ---------GTTSTEGSLYGGETQDTIDCSTYGTFDSSKSSTFQSNDTDFLISYGDGSFA 163

Query: 179 SGTWGTDNFDLGD-LNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNSASSG-AYQY 236
            GTWGTD   L D L++ ++S AVA+ +NS++GV+GIGL  L++TY    S +   +Y Y
Sbjct: 164 EGTWGTDVIKLDDSLSLNDVSVAVASSTNSSMGVLGIGLRPLETTYSSTKSVNEKTSYMY 223

Query: 237 ENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGI 296
           +NFP++LK  G+I+  AYSL+LN+P +  G++LFG VDHSKY+GQLYTVPML+       
Sbjct: 224 DNFPISLKKSGLIESTAYSLYLNDPSSKSGNILFGGVDHSKYTGQLYTVPMLS--STTSY 281

Query: 297 QNPIEFDXXXX-XXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYS 355
           + P+EFD               + LT TQF  LLDSGTT SY+P  L  +I   +GA Y 
Sbjct: 282 KTPVEFDVTLNGIGIIDSSGNKKTLTATQFYGLLDSGTTFSYLPSALVAMIGEELGASYD 341

Query: 356 QYTGYYSMRCPSEN-NDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTSNAAI 414
              GYY++ C +E+ +DT++ FD GGF I                TC L ++P      +
Sbjct: 342 SNIGYYTIDCSAEDSDDTKIVFDMGGFHI--NTTLSDFVIQISTSTCILSIVP-QDGKVV 398

Query: 415 FGDNFLVHAYVVYDLENYEISMAQAAFNNS-DSQIEVISDSIPSAVRAQGYSSTWSTNQA 473
            GD+FL +AY+VYDL+NYEI+MAQAA++++ ++ I+VIS +IPSA+RA GYSSTWST+++
Sbjct: 399 LGDSFLNNAYIVYDLDNYEIAMAQAAWDSTREANIDVISTTIPSAIRAPGYSSTWSTSRS 458

Query: 474 I 474
           I
Sbjct: 459 I 459

>Smik_12.187 Chr12 complement(370001..371524) [1524 bp, 507 aa] {ON}
           YLR121C (REAL)
          Length = 507

 Score =  394 bits (1011), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 217/477 (45%), Positives = 285/477 (59%), Gaps = 49/477 (10%)

Query: 1   MQLLPAALISGFLLGSQAVALSDVDEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKR 60
           M++L AA +S  +L S AV     +   GKYV + F K          KGN  S+ L KR
Sbjct: 1   MKVLLAAAVSLTVLSSLAVGRVLPE---GKYVKMPFVK----------KGNSESSVLSKR 47

Query: 61  DDGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVX 120
             G+E   + NEQ+FYS+EL IGTPSQN+TVLLDTGS+DLWV    NPYC          
Sbjct: 48  SSGHENFVLANEQSFYSVELAIGTPSQNLTVLLDTGSADLWVPGKGNPYC---------- 97

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTA-FSISYGDTTFAS 179
                                   +DC +YG FD SKS++F++N ++ F  +YGD TFA 
Sbjct: 98  ---------------------GSVMDCDQYGVFDKSKSSTFKANKSSPFYAAYGDGTFAE 136

Query: 180 GTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVG-VNSASSGAYQYEN 238
           G +G D     +L+++ L FAVAN+SNST GV+GIGL+ L+ TY G V      +Y+Y+N
Sbjct: 137 GAFGQDKLKYNNLDLSGLPFAVANESNSTFGVLGIGLSTLEVTYSGKVAVMDKRSYEYDN 196

Query: 239 FPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQN 298
           FP+ LK  G ID  AYSLFLN+     GS+LFGAVDHSKY GQLYT+P++NMY+++G Q+
Sbjct: 197 FPLFLKHSGAIDATAYSLFLNDESQASGSILFGAVDHSKYEGQLYTIPLVNMYKSQGYQH 256

Query: 299 PIEFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYT 358
           P+ FD                LT T+FPALLDSGTTL+Y+P     L+A ++ A YS+  
Sbjct: 257 PVAFDVTLQGLGLQTDKRNTTLTTTKFPALLDSGTTLTYLPSQAVALLAKSLNASYSKTL 316

Query: 359 GYYSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTSNA-AIFGD 417
           GYY   CPS +N T + FDFGGF+I                TC L +IP   NA AI GD
Sbjct: 317 GYYEYTCPSSDNKTSIAFDFGGFRI--NAPLSDFTMQTSVGTCALALIPQAGNATAILGD 374

Query: 418 NFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSSTWSTNQAI 474
           +FL +AYVVYDL+NYEIS+AQA +  +   IE I  ++P A RA  Y++TWST  ++
Sbjct: 375 SFLRNAYVVYDLDNYEISLAQAKYGKAKENIEAIKSTVPGATRAPSYNNTWSTYASV 431

>KAFR0H02300 Chr8 (439083..440648) [1566 bp, 521 aa] {ON} Anc_8.319
           YLR121C
          Length = 521

 Score =  392 bits (1006), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 222/477 (46%), Positives = 297/477 (62%), Gaps = 38/477 (7%)

Query: 1   MQLLPAALISGFLLGSQAVALSDV---DEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAEL 57
           M LL   + S F + + +++L  +   D K   YV+L F K  G+S+E    G+   + L
Sbjct: 1   MILLAYLVESLFFIPNYSLSLPQIGGGDSKQPDYVNLKFKKTYGDSFE----GSTTWSAL 56

Query: 58  RKRDDGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTK 117
            KR  GYE +++ N QNFYS++L+IGTPSQ +TVL+DTGSSDLWV+  +NPYC+      
Sbjct: 57  AKRTRGYELVDLVNRQNFYSVDLDIGTPSQTITVLVDTGSSDLWVTGSDNPYCV------ 110

Query: 118 PVXXXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTF 177
                                       DC+ YGTFD ++S+++ SN+T FSI+YGDT+F
Sbjct: 111 ---------------SVKSNLVSSTNKFDCNTYGTFDKNQSSTWSSNDTLFSITYGDTSF 155

Query: 178 ASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNSASSGAYQYE 237
           A GTWG D   L DL+V+ LSFAVAN +NSTVGV+GIGL GL+ TY+   +A    YQY+
Sbjct: 156 ARGTWGQDKLHLDDLDVSGLSFAVANVTNSTVGVLGIGLPGLEVTYI---NAPRNRYQYD 212

Query: 238 NFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQ 297
           NFPM LK+ G    N YSL L+ P+A+ G+VLFGAVDHSKY+G LYT+P++N  +  G  
Sbjct: 213 NFPMILKNSGATHSNLYSLHLDHPEAEHGTVLFGAVDHSKYTGSLYTIPLVNTLKTHGFS 272

Query: 298 NPIEFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQY 357
           +P +F+                LTNT+  ALLDSGTTL+Y+P  L Q+IA ++GA++S  
Sbjct: 273 DPAKFEVTLQGVGIVANNTQTTLTNTKIAALLDSGTTLTYLPQALVQVIADSIGARWSSR 332

Query: 358 TGYYSMRCPS-ENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPLT-SNAAIF 415
            GYY + C + EN+DT L FDFGGF I                 C L +I  T SN+AI 
Sbjct: 333 YGYYIVSCRAVENSDTTLVFDFGGFHI--NGKLTDFIVETFGNVCLLTIIEETGSNSAIL 390

Query: 416 GDNFLVHAYVVYDLENYEISMAQAAFNNSDSQ-IEVISDS--IPSAVRAQGYSSTWS 469
           GDNFL++AYVV+DLEN EISMAQA  N  D Q IE+++ +  + SAV A GYSSTW+
Sbjct: 391 GDNFLINAYVVFDLENNEISMAQALHNVDDDQDIEIVTSNAGVASAVTALGYSSTWT 447

>YLR121C Chr12 complement(388744..390270) [1527 bp, 508 aa] {ON}
           YPS3Aspartic protease, member of the yapsin family of
           proteases involved in cell wall growth and maintenance;
           attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 508

 Score =  387 bits (993), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 212/472 (44%), Positives = 283/472 (59%), Gaps = 49/472 (10%)

Query: 1   MQLLPAALISGFLLGSQAVALSDVDEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKR 60
           M+L  AA+ +  +L S A      D   GKYV + F K          K N  + EL KR
Sbjct: 1   MKLQLAAVATLAVLTSPAFGRVLPD---GKYVKIPFTK----------KKNGDNGELSKR 47

Query: 61  DDGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVX 120
            +G+E+  + NEQ+FYS+EL IGTPSQN+TVLLDTGS+DLWV    NPYC          
Sbjct: 48  SNGHEKFVLANEQSFYSVELAIGTPSQNLTVLLDTGSADLWVPGKGNPYC---------- 97

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTA-FSISYGDTTFAS 179
                                   +DC +YG FD +KS++F++N ++ F  +YGD T+A 
Sbjct: 98  ---------------------GSVMDCDQYGVFDKTKSSTFKANKSSPFYAAYGDGTYAE 136

Query: 180 GTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVG-VNSASSGAYQYEN 238
           G +G D     +L+++ LSFAVAN+SNST GV+GIGL+ L+ TY G V      +Y+Y+N
Sbjct: 137 GAFGQDKLKYNELDLSGLSFAVANESNSTFGVLGIGLSTLEVTYSGKVAIMDKRSYEYDN 196

Query: 239 FPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQN 298
           FP+ LK  G ID  AYSLFLN+     GS+LFGAVDHSKY GQLYT+P++N+Y+++G Q+
Sbjct: 197 FPLFLKHSGAIDATAYSLFLNDESQSSGSILFGAVDHSKYEGQLYTIPLVNLYKSQGYQH 256

Query: 299 PIEFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYT 358
           P+ FD                LT T+ PALLDSGTTL+Y+P     L+A ++ A YS+  
Sbjct: 257 PVAFDVTLQGLGLQTDKRNITLTTTKLPALLDSGTTLTYLPSQAVALLAKSLNASYSKTL 316

Query: 359 GYYSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTSNA-AIFGD 417
           GYY   CPS +N T + FDFGGF+I                TC L +IP   NA AI GD
Sbjct: 317 GYYEYTCPSSDNKTSVAFDFGGFRI--NAPLSDFTMQTSVGTCVLAIIPQAGNATAILGD 374

Query: 418 NFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSSTWS 469
           +FL +AYVVYDL+NYEIS+AQA +      +EVI  ++PSA+RA  Y++TWS
Sbjct: 375 SFLRNAYVVYDLDNYEISLAQAKYGTGKENVEVIKSTVPSAIRAPSYNNTWS 426

>ZYRO0F10252g Chr6 complement(828774..830429) [1656 bp, 551 aa] {ON}
           weakly similar to YYIL015W uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 551

 Score =  387 bits (994), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 214/473 (45%), Positives = 291/473 (61%), Gaps = 21/473 (4%)

Query: 1   MQLLPAALISGFLLGSQAVALSDVDEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKR 60
           M+ L  +L++  LL + +  L      P  Y  LSF+KLRG ++E+A  GN         
Sbjct: 1   MKFL-TSLVTSVLLSTASAGLV----SPPVY-KLSFNKLRGETFEKA-VGNS-------- 45

Query: 61  DDGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVX 120
            +G+   +I N+QNFYS+EL++GTP+QNV VLLDTGSSDLW++   NPYC  S     + 
Sbjct: 46  -NGHANFDIKNQQNFYSVELKVGTPAQNVLVLLDTGSSDLWITGSGNPYCSPSTRNSHLG 104

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASG 180
                                   +DCS+YGTF+   S +F+SN++ F ++YGD +FA G
Sbjct: 105 SAGSNSSTNNGPSSTANFPSSSATIDCSQYGTFNLDGSETFKSNDSTFYLTYGDGSFAKG 164

Query: 181 TWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYV-GVNSASSGAYQYENF 239
            WG D+  L  LNV+++SFAVAN+SNSTVGV G+GL G ++T   GVN      YQY+NF
Sbjct: 165 LWGMDHVYLDGLNVSDVSFAVANESNSTVGVFGVGLPGEEATVTPGVN---GNHYQYKNF 221

Query: 240 PMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNP 299
           P  LK  G++ +NAYSL+LN PD++ G++LFGAVDHSKYSG LYT+P++N Y ++G+  P
Sbjct: 222 PQVLKDNGVVQKNAYSLYLNSPDSNSGNILFGAVDHSKYSGNLYTLPIVNTYADQGVA-P 280

Query: 300 IEFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTG 359
            EFD                +++ +  ALLDSGTTL Y+P  L   +A ++G ++S  TG
Sbjct: 281 REFDVTVQGITVGNSSSNSTVSSDKTLALLDSGTTLMYLPTALADELAKSLGGKFSPSTG 340

Query: 360 YYSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNF 419
           YY +  PSEN+DT++ FDFGGF I                   LG++    + AIFGD F
Sbjct: 341 YYLIPKPSENDDTKITFDFGGFHIETKLSNYILQGSGPQDVAILGILRTEGDRAIFGDVF 400

Query: 420 LVHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSSTWSTNQ 472
           LV AYVVYDLE+YEIS+AQA FN+  S IE IS S+P A RA GYS T++ NQ
Sbjct: 401 LVDAYVVYDLEDYEISLAQANFNSGSSDIEAISGSVPGASRAPGYSQTYTGNQ 453

>Skud_12.193 Chr12 complement(371627..373120) [1494 bp, 497 aa] {ON}
           YLR121C (REAL)
          Length = 497

 Score =  385 bits (989), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 214/472 (45%), Positives = 284/472 (60%), Gaps = 48/472 (10%)

Query: 1   MQLLPAALISGFLLGSQAVALSDVDEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKR 60
           M+++ AA +S  +L +  +AL  +  +  KYV + F K       + G GN     L KR
Sbjct: 1   MKVISAAAVSLAVLNT--LALGSILPRE-KYVKIPFVK------NQDGAGN----VLGKR 47

Query: 61  DDGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVX 120
            +G+E+  + NEQ+FYS+EL IGTPSQ++TVLLDTGS+DLWV S  NPYC          
Sbjct: 48  SNGHEKFVLANEQSFYSVELAIGTPSQSLTVLLDTGSADLWVPSKGNPYC---------- 97

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTA-FSISYGDTTFAS 179
                                   +DC +YG FD +KS++F++N ++ F  +YGD TFA 
Sbjct: 98  ---------------------GSVMDCDQYGVFDKTKSSTFKANKSSPFYAAYGDGTFAQ 136

Query: 180 GTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVG-VNSASSGAYQYEN 238
           G +G D      L+++ LSFAVAN+SNST GV+GIGL  L+ TY G V      +Y+Y+N
Sbjct: 137 GAFGQDRLKYNGLDLSGLSFAVANESNSTFGVLGIGLPALEVTYSGKVAVVDKKSYEYDN 196

Query: 239 FPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQN 298
           FP+ LK  G ID  AYSLFLN+     GS+LFGAVDHSKY G+LYTVP++N+YR++G Q+
Sbjct: 197 FPLFLKRSGAIDATAYSLFLNDESQSSGSILFGAVDHSKYEGRLYTVPLVNLYRSQGYQH 256

Query: 299 PIEFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYT 358
           P+ FD                LT T+ PALLDSGTTL+Y+P     L+A ++ A YS+  
Sbjct: 257 PVAFDVTLHGIGLQTDRHNTTLTATKIPALLDSGTTLTYLPSQAVALLAKSLNATYSKAL 316

Query: 359 GYYSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTSNA-AIFGD 417
           GYY   CPS +NDT + FDFGGF I                TC L +IP   NA AI GD
Sbjct: 317 GYYEYACPSSDNDTSVAFDFGGFHI-NAPVSDFTMQTSVGGTCVLAVIPQAGNATAILGD 375

Query: 418 NFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSSTWS 469
           +FL +AYVVYDL+NYE+S+AQA +      IE I  ++PSA RA GY+STWS
Sbjct: 376 SFLRNAYVVYDLDNYEVSLAQAKYGTGAEDIEAIKSTVPSATRAPGYNSTWS 427

>ZYRO0G02904g Chr7 (220115..221710) [1596 bp, 531 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 531

 Score =  374 bits (959), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 212/516 (41%), Positives = 293/516 (56%), Gaps = 23/516 (4%)

Query: 21  LSDVDEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKRDDGYEEIEIYNEQNFYSIEL 80
           L + +    K V  SF+K +G ++         S EL KRD      ++ NEQNFYSI+L
Sbjct: 27  LEEEEASSPKLVKFSFNKHQGRTF-------TASEELSKRDKDVT-FDLKNEQNFYSIKL 78

Query: 81  EIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSD--------DTKPVXXXXXXXXXXXXX 132
            +GTP Q V VLLDTGSSDLW+   +NPYC +S                           
Sbjct: 79  SVGTPGQEVVVLLDTGSSDLWIPGSDNPYCKESSSFSISNQGKENGAEGPFQTLPGGVTA 138

Query: 133 XXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDL 192
                       +DC E+GTF+   S +F SN+T FS+SYGDT++A GTWG D+ ++ D+
Sbjct: 139 TNMSGGSTASATLDCKEFGTFNREDSKTFHSNDTEFSVSYGDTSYAIGTWGYDSININDV 198

Query: 193 NVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGV-NSASSGAYQYENFPMALKSQGIIDR 251
           N+TN+S  VAN++NS+VG+MGIGL+ L++TY GV N  +   ++Y NFPM LK QG I++
Sbjct: 199 NLTNVSIGVANKTNSSVGIMGIGLSNLENTYTGVENVKNRNTHKYLNFPMLLKEQGFIEK 258

Query: 252 NAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXXX 311
           N YSLFLN  +A +GS+LFGAVDHSKYSGQLYTVPMLN+Y+ +G+++P++          
Sbjct: 259 NVYSLFLNRREAFEGSILFGAVDHSKYSGQLYTVPMLNLYQQQGLKDPLQLQVTLQGVGI 318

Query: 312 XXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENND 371
                    + T  PALLDSGTTL Y+P  +  ++A  + A + +  GYY   C S  ++
Sbjct: 319 EANNMTNTTSTTPVPALLDSGTTLVYLPDKMLAMLAEQLNAHWDRGIGYYVTDC-SRVDN 377

Query: 372 TRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLEN 431
           T L F+FGGF I                +C LG+ P    AAI GD F+ HAY+V+DL++
Sbjct: 378 TNLYFNFGGFNI-VSNMSTYVVSRSNENSCVLGLQPGGPEAAILGDMFMQHAYIVFDLDD 436

Query: 432 YEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSSTWSTNQAIXXXXXX--XXXXXXXXX 489
           +EISMAQA +    +Q+E ++  +PSA++A GYS T+S +Q I                 
Sbjct: 437 FEISMAQANYAGGKNQLEAVTQQVPSAMKAPGYSHTFSGSQGITGGGNIFYATSYSSSSG 496

Query: 490 XXXXXXXXXXRNAVGDTLAPSPLFLLFATII-SFFI 524
                     RNA  D LAP+P+   FA  I SF I
Sbjct: 497 SSTSTRTWSGRNAAVD-LAPAPMLAFFAHFIYSFLI 531

>KNAG0G02410 Chr7 complement(550827..552419) [1593 bp, 530 aa] {ON} 
          Length = 530

 Score =  372 bits (954), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 205/454 (45%), Positives = 278/454 (61%), Gaps = 42/454 (9%)

Query: 31  YVHLSFDKLRGNSYEEAGKGNKPSAELRKRDDGYEEIEIYNEQNFYSIELEIGTPSQNVT 90
           YV + F+K  G++Y  A K  +P   L KR+ GYEEI + N+Q+F+S+EL++GTP+QNVT
Sbjct: 21  YVGMRFEKKFGDNYAGATKWQRPQMRLAKRNTGYEEITLTNQQSFFSVELDVGTPAQNVT 80

Query: 91  VLLDTGSSDLWVSSPENPYCI----DSDDTKPVXXXXXXXXXXXXXXXXXXXXXXXXXVD 146
           VL+DTGSSDLW++  +NPYC+       D+ P                          VD
Sbjct: 81  VLVDTGSSDLWITGADNPYCLTYSGSGADSIP----------------------RRDRVD 118

Query: 147 CSEYGTFDPSKSTSFRSNNTA--FSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQ 204
           CSEYGTF    S+++  N++A  F I+YGDTTFASG WG D+  L D+NVT +SFAVAN+
Sbjct: 119 CSEYGTFSLEDSSTWSQNSSAPPFYITYGDTTFASGVWGQDHLHLQDVNVTGVSFAVANR 178

Query: 205 SNSTVGVMGIGLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDAD 264
           +NSTVGVMGIGL GL++T  G     S  Y Y NFP  LK+ G      YSL+LN+ + +
Sbjct: 179 TNSTVGVMGIGLPGLETTNSG-----SRPYTYANFPQVLKNSGATQSALYSLYLNDLEEE 233

Query: 265 KGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRN---LT 321
           +GS+LFGAVDHSKY+G +YT+P++N  ++ G   PI+FD               +   +T
Sbjct: 234 RGSILFGAVDHSKYTGSMYTLPIINRLQSYGYTTPIQFDITLQGIGLSSSESNGDEVTIT 293

Query: 322 NTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGF 381
           +T+ PALLDSGTT++Y+P  +   IA  +GA  S   G Y + C +   +  L +DFGGF
Sbjct: 294 STKMPALLDSGTTMTYLPSNIVSQIAQQLGASMSARFGQYVLPCSNVPENMHLVYDFGGF 353

Query: 382 QIXXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAF 441
            I                 C LG+ P  SN AI GD FL  AYVVYDLEN +I +AQA F
Sbjct: 354 HINSNLTNYIVQASQTL--CILGLFPRDSNTAILGDTFLTDAYVVYDLENLQIGLAQAKF 411

Query: 442 --NNSDSQIEVISDS--IPSAVRAQGYSSTWSTN 471
             ++SD++I++++ S  IPSA RA  YSSTWST+
Sbjct: 412 GVSDSDAKIDIVTGSAGIPSAQRAPDYSSTWSTS 445

>KAFR0B06530 Chr2 (1355295..1356911) [1617 bp, 538 aa] {ON} 
          Length = 538

 Score =  371 bits (952), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 217/480 (45%), Positives = 287/480 (59%), Gaps = 43/480 (8%)

Query: 7   ALISGFLLGSQAV-ALSDVDEKPGKYVHLSFDKLRGNSYEEAGKG----------NKPSA 55
           A +S   LG+  +  +S   +    ++ L F+KL G S++ A K           N   +
Sbjct: 11  AYVSTAALGNMVLPEISRFSQHNNGFLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQS 70

Query: 56  ELRKR-DDGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDS- 113
           EL KR    Y+E+EI N+Q+FYS++L IGTP QNVTV +DTGSSDLWV+   NPYC  S 
Sbjct: 71  ELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGST 130

Query: 114 -DDTKPVXXXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISY 172
             DT P                           +CS+YGTF+ +KS+++ SNN+ F I Y
Sbjct: 131 FSDTVP----------------------SRELFNCSQYGTFNTNKSSTWSSNNSRFFIQY 168

Query: 173 GDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNSASSG 232
           GDTTFASGTWG D   +  LNVT L+FAVAN SNS+  V+GIGL  L++TY G NS+ S 
Sbjct: 169 GDTTFASGTWGRDVMSINGLNVTGLTFAVANASNSSNSVLGIGLTQLETTYNGSNSSHS- 227

Query: 233 AYQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYR 292
            Y Y NFP+ LK+ G+ +  +YSLFLNE DA+ GS+LFGAVDHSKYSG LYT+P++N Y+
Sbjct: 228 -YTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYK 286

Query: 293 NRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGA 352
           +RG  NPIEF                 +T T+  A+LDSGT+L+ +P T+   IA ++  
Sbjct: 287 DRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNG 346

Query: 353 QYSQYTGYYSMRCPSENN-DTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTSN 411
           +YS     Y + C   N+ +T L FDFGGF I                 C LG+  +  N
Sbjct: 347 RYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTI--KGTLSNFILEIEDDICILGLSSVDEN 404

Query: 412 AAIFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVI--SDSIPSAVRAQGYSSTWS 469
           + I GD FL  AYVVYDLEN +ISMAQA F+NS S I+VI  +  +PSA++A GYSSTW+
Sbjct: 405 SVILGDTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWT 464

>Ecym_4251 Chr4 complement(520455..521963) [1509 bp, 502 aa] {ON}
           similar to Ashbya gossypii AGL192W
          Length = 502

 Score =  369 bits (947), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 203/449 (45%), Positives = 265/449 (59%), Gaps = 45/449 (10%)

Query: 31  YVHLSFDKLRGNSYEEAGKGNKPSAELRKRDDGYEEIEIYNEQNFYSIELEIGTPSQNVT 90
           YV    DK RGN +  + KG  P  EL+KRDD Y +++I+NEQ FYS+ L IGTP+Q VT
Sbjct: 31  YVRFDLDKTRGNDFRSSEKGVMPFGELKKRDDEYVDVKIHNEQTFYSVNLSIGTPAQEVT 90

Query: 91  VLLDTGSSDLWV------SSPENPYCIDSDDTKPVXXXXXXXXXXXXXXXXXXXXXXXXX 144
           VL+DTGSSDLW+        P+N     SD T+P+                         
Sbjct: 91  VLVDTGSSDLWIIGADVDCGPDN-----SDSTEPL------------------------- 120

Query: 145 VDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQ 204
            DC EYG FD SKS+S+++N+T F ISYGDT+FASG WGTD  DLGDLN   L+FAVA  
Sbjct: 121 -DCFEYGAFDKSKSSSWKNNHTEFYISYGDTSFASGEWGTDKLDLGDLNADGLTFAVATA 179

Query: 205 SNSTVGVMGIGLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDAD 264
           SNS+V V+GIGL G++ T     ++    Y+Y+N P+ LK  G+ID+ AYSL+LN+ DA 
Sbjct: 180 SNSSVAVLGIGLTGIEVT----RASGDNGYEYDNLPIVLKRNGVIDKTAYSLYLNDLDAT 235

Query: 265 KGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQ 324
            GSVLFGAVDHSKY+G L TVP++N+    G   PIE                  ++ T+
Sbjct: 236 SGSVLFGAVDHSKYTGTLATVPLVNVNARYGFPKPIELHITLNGLGFSSGKKRGTISATK 295

Query: 325 FPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCP-SENNDTRLNFDFGGFQI 383
            PALLDSGTTLSY P  L   IA  VGA ++     + + C  ++ N+  L ++FGG +I
Sbjct: 296 VPALLDSGTTLSYFPTELAAAIASNVGAVWNARLRKFLIPCSQAKRNNIDLIYNFGGVEI 355

Query: 384 XXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAFNN 443
                            C LG++P +SN  I GD FL   Y VYDLE  E+S+AQAA+  
Sbjct: 356 -TSPLVNYLSETNVEDVCLLGIVPTSSNDIILGDVFLTSVYTVYDLEALEVSIAQAAYGA 414

Query: 444 SDSQ--IEVISDSIPSAVRAQGYSSTWST 470
           S  +  IEVI  ++P A +A GYS+TWST
Sbjct: 415 SAEKENIEVIKSTVPGATKAPGYSNTWST 443

>Suva_10.212 Chr10 complement(396611..398848) [2238 bp, 745 aa] {ON}
           YLR121C (REAL)
          Length = 745

 Score =  368 bits (944), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 207/444 (46%), Positives = 262/444 (59%), Gaps = 48/444 (10%)

Query: 30  KYVHLSFDKLRGNSYEEAGKGNKPSAELRKRDDGYEEIEIYNEQNFYSIELEIGTPSQNV 89
           KYV + F K          + N P +EL KR  G E   + NEQ+FYS+EL +GTPSQNV
Sbjct: 28  KYVRIPFAK----------RQNGPGSELGKRAGGDENFVLSNEQSFYSVELALGTPSQNV 77

Query: 90  TVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXXXXXXXXXXXXXXXXVDCSE 149
           TVLLDTGS+DLWV S  NPYC                                  ++C +
Sbjct: 78  TVLLDTGSADLWVPSNANPYC-------------------------------GSAMNCDQ 106

Query: 150 YGTFDPSKSTSFRSNNTA-FSISYGDTTFASGTWGTDNFDL-GDLNVTNLSFAVANQSNS 207
           YG FD + S++F +N++A F  SYGD TFA G +G D     G L+++ LSFAVAN+SNS
Sbjct: 107 YGVFDKANSSTFTANHSAPFYASYGDGTFAEGVFGQDKLHYSGGLDLSGLSFAVANKSNS 166

Query: 208 TVGVMGIGLAGLQSTYVG-VNSASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDADKG 266
           TVGV+GIGL  L+ TY G V  A   +YQY+NFP+ LK  G ID  AYSLFLN+     G
Sbjct: 167 TVGVLGIGLPMLEVTYSGKVAVADKRSYQYDNFPLFLKRSGAIDATAYSLFLNDETQTSG 226

Query: 267 SVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQFP 326
           SVLFGAVDHSKY GQLYT+P++N+Y+ +G Q P+ FD                LT T+ P
Sbjct: 227 SVLFGAVDHSKYLGQLYTIPLVNLYKAQGYQRPVAFDVTLQGLGLQTRAHNTTLTTTRIP 286

Query: 327 ALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCP-SENNDTRLNFDFGGFQIXX 385
           ALLDSGTTL+Y+P     L+A ++ A +S+  GYY   CP S +N T + FD GGF I  
Sbjct: 287 ALLDSGTTLTYLPADAVALMAKSLNATFSKELGYYEYACPTSGDNATSVVFDLGGFHI-- 344

Query: 386 XXXXXXXXXXXXXXTCYLGMIPLTSNA-AIFGDNFLVHAYVVYDLENYEISMAQAAFNNS 444
                         TC L ++P   NA AI GD+FL  AYVVYDL+NYE+S+AQA + + 
Sbjct: 345 NAPLSDFTMQTNVGTCVLAIVPQAGNATAILGDSFLRSAYVVYDLDNYEVSLAQAKYGSG 404

Query: 445 DSQIEVISDSIPSAVRAQGYSSTW 468
              IE I  S+P A RA GY+STW
Sbjct: 405 KEDIEAIRSSVPGATRAPGYNSTW 428

>KNAG0E03220 Chr5 complement(647282..648904) [1623 bp, 540 aa] {ON} 
          Length = 540

 Score =  359 bits (921), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 200/487 (41%), Positives = 279/487 (57%), Gaps = 25/487 (5%)

Query: 3   LLPAALISGFLLGSQAVALSDVDEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKRDD 62
           +L   L++G  LG   +A S     P KYV + F K R  S+   G        L +R D
Sbjct: 1   MLLEQLVAGSFLGGAVLASSQA--SPNKYVQMGFHKSR--SFSSGGD------SLARRAD 50

Query: 63  GYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCI----------- 111
            Y  +++ N+Q +YS+EL +GTP QNV+VL+DTGSSDLW++SP+NPYCI           
Sbjct: 51  DYLSVDVENQQLYYSVELYVGTPPQNVSVLIDTGSSDLWLTSPDNPYCIGFKQPGSAKFA 110

Query: 112 ---DSDDTKPVXXXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAF 168
                     V                          DC+  GTF+ S+S+SF+SNNT F
Sbjct: 111 LEEKEAANATVLTAQNAEGPTRSSKAAKATGGHLDQFDCALLGTFNNSESSSFKSNNTDF 170

Query: 169 SISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNS 228
              Y D TFASG WGTD   +GD++V+++S AV N +NST  V+GIG+  L+S+  G  +
Sbjct: 171 LTGYADNTFASGFWGTDVVRIGDVDVSDVSLAVVNLTNSTSPVLGIGMPVLESSNAGRLA 230

Query: 229 A-SSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPM 287
           A ++ +Y+Y+NFP+ LK++G+I++ AYSLFLN+ DA +GSVLFGAVDHSKY   L+TVPM
Sbjct: 231 AETNSSYEYDNFPVQLKNKGVIEKIAYSLFLNDSDATEGSVLFGAVDHSKYENGLFTVPM 290

Query: 288 LNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIA 347
           +N Y+++G+Q+PIEF              +  +T T FP LLDSG+T SY+P TL  ++A
Sbjct: 291 VNTYKDQGVQHPIEFYVTMYGLGFKKDGFLNTITTTNFPVLLDSGSTTSYLPDTLVSMLA 350

Query: 348 GAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIP 407
            A+ A +S+    Y+++CPSE + T L+FD GGF I                   +    
Sbjct: 351 SALNATFSEKINGYTLKCPSEEDATFLSFDLGGFLIDVPLSDLVAKRHKNQCVLMVKGQG 410

Query: 408 LTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSST 467
                 I GD FL  AYVVYDLE+YEIS+ QA+  ++   IEVI  ++P AVRA  Y   
Sbjct: 411 EGEGGYILGDTFLSSAYVVYDLESYEISIGQASTGDAAEDIEVIKSTVPGAVRAPFYDRP 470

Query: 468 WSTNQAI 474
           W+    I
Sbjct: 471 WTGGTVI 477

>KLTH0G12386g Chr7 (1052977..1054719) [1743 bp, 580 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 580

 Score =  358 bits (919), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 220/516 (42%), Positives = 289/516 (56%), Gaps = 45/516 (8%)

Query: 1   MQLLPAA-LISGFLLGSQAVALSDVDE---KPGKYVHLSFDKLRGNSYEEAGKGNKPSAE 56
           M+LL  +  ++   L S AV +S  DE      K+V +SFDKLRG++ E+A  G      
Sbjct: 1   MKLLSTSTFLAACGLASAAV-VSSRDEGAQSASKFVKVSFDKLRGDTAEDATAGAVAHGV 59

Query: 57  LRKRDDGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYC------ 110
           L KR DG E + I N+Q FYS+EL +G+P+QNVT+L+DTGSSD+WV    NPYC      
Sbjct: 60  LAKRADGSETVVIKNQQTFYSVELGVGSPAQNVTLLIDTGSSDMWVMGSNNPYCEGGSSG 119

Query: 111 ----------IDSDDTKPVXXXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKST- 159
                     +DS D +                              ++ G   PS+++ 
Sbjct: 120 NSKHVLLGDHVDSRDEEVNRDWFSTLRSFLTATATATATATATATGSADSGGNAPSRTSV 179

Query: 160 ---------------------SFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLS 198
                                SF+SNNTAF I YGD+T+A GTWG DN  L D+ ++ +S
Sbjct: 180 NSQYATLTCSSYGTFATDSSSSFQSNNTAFYIEYGDSTYALGTWGRDNVTLQDITLSGIS 239

Query: 199 FAVANQSNSTVGVMGIGLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNAYSLFL 258
            AVAN+SNST GV+GIGLA L+ T VG  +    +Y YEN P  + S+GII +NAYSLFL
Sbjct: 240 MAVANESNSTFGVLGIGLAALEVTNVGTLATRGNSYTYENLPAKMVSEGIIHKNAYSLFL 299

Query: 259 NEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIR 318
           +  DA +GSVLFGAVDHSKY+G LYT+P+ N Y++ G  +PI+ +               
Sbjct: 300 DSLDAKEGSVLFGAVDHSKYTGSLYTLPLSNSYKSMGYSDPIQLEVTLQGFGMTANNTNS 359

Query: 319 NLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDF 378
             T T   ALLDSGTTL+Y+P TL + +A   GA+Y    GYY + C    +   L FDF
Sbjct: 360 TFTTTPLTALLDSGTTLTYLPTTLVRQVAAKYGARYDSSYGYYLLSCSDVKDTDELVFDF 419

Query: 379 GGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQ 438
           GGF I                 C LG+IP +S++ I GDNFL  AYVVYDL+N EIS+AQ
Sbjct: 420 GGFHI--NSKVENFLIRATSNICALGLIPQSSSSLILGDNFLTAAYVVYDLDNLEISLAQ 477

Query: 439 AAFNNSDSQIEVISDSIPSAVRAQGYSSTWSTNQAI 474
           A ++   S IEVIS S+PSAV+   YSSTWST+  I
Sbjct: 478 ANYDGGSSNIEVISSSVPSAVKGPSYSSTWSTSVPI 513

>TBLA0A03910 Chr1 complement(977504..979294) [1791 bp, 596 aa] {ON}
           Anc_8.318 YLR120C
          Length = 596

 Score =  357 bits (916), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 202/480 (42%), Positives = 273/480 (56%), Gaps = 42/480 (8%)

Query: 27  KPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKR------DDGYEEIEIYNEQNFYSIEL 80
           KP K++ L FD+  G SYE++  G   +  L KR      +  YE++ + N+  FYS+EL
Sbjct: 43  KP-KFLELKFDRHYGESYEDSTLGKDGAVHLEKRTFDSAYNGSYEDVILTNQLTFYSVEL 101

Query: 81  EIGTPSQNVTVLLDTGSSDLWVSSPENPYC-IDSDDTKPVXXXXXXXXXXXXXXXXXXXX 139
           +IGTP+Q VTV++DTGSSDLW++   NP+C    DDT+                      
Sbjct: 102 DIGTPAQKVTVVVDTGSSDLWITETSNPFCSTGDDDTEDSVWSPFLLKDKIDPRVLKHKG 161

Query: 140 XXXXXVD-----------------------------CSEYGTFDPSKSTSFRSNNTAFSI 170
                +D                             C+E+GTF+  KS++F++N+T F I
Sbjct: 162 KRTTSIDVTATATTGSINISIDLGSNFTLPPEFLINCTEFGTFNTKKSSTFKNNHTDFFI 221

Query: 171 SYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVG-VNSA 229
           SYGD TFASG WG D     D+NVT LSF VAN +NSTVGV+GIGL  L+STY G VNS 
Sbjct: 222 SYGDNTFASGYWGRDVLSFQDINVTGLSFGVANVTNSTVGVLGIGLPELESTYFGTVNSV 281

Query: 230 SSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLN 289
           +  +Y Y NFP  LK+ GII++ AYSLFLN+ D+ +GS+L GAVD SK++ +LYTVPMLN
Sbjct: 282 NESSYIYNNFPQVLKNSGIINKTAYSLFLNKSDSTQGSLLLGAVDTSKFADKLYTVPMLN 341

Query: 290 MYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGA 349
           +  ++G  +P  F                 + +++ P LLDSGTT+ Y+P ++ + I   
Sbjct: 342 INPSKGYTDPSAFLVLMQKMTRYKYGQGHLVPSSRIPVLLDSGTTMVYLPRSIVEQIMRH 401

Query: 350 VGAQYSQYTGYYSMRCPSEN--NDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIP 407
             AQY +    Y ++CPS N  N T  +FDFGGFQI                 C  GMIP
Sbjct: 402 EEAQYVEELDLYQIKCPSPNKKNQTSFSFDFGGFQIKASLSDFIVPTDNGQ--CIFGMIP 459

Query: 408 LTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSST 467
              N  I GD+FL HAYVVYDLE+YEISMAQA ++  +     I  ++PSAVRA+ YS+T
Sbjct: 460 QDMNVGILGDSFLTHAYVVYDLEDYEISMAQAVYDGGEPNYIPIVSTVPSAVRAKYYSAT 519

>ZYRO0F10318g Chr6 complement(835672..837132) [1461 bp, 486 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 486

 Score =  348 bits (893), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 198/464 (42%), Positives = 270/464 (58%), Gaps = 45/464 (9%)

Query: 30  KYVHLSFDKLRGNSYEEAGKGNKPSAELRKRDDGYEEIEIYNEQNFYSIELEIGTPSQNV 89
           K + LSF+K         G  N          +    +   N   FYS+EL +GTP+Q +
Sbjct: 31  KIIQLSFNK-------HGGAANNKDILTPTSQNTDISVNATNRYIFYSVELSVGTPAQKL 83

Query: 90  TVLLDTGSSDLWVSSPENPYC-----IDSDDT-KPVXXXXXXXXXXXXXXXXXXXXXXXX 143
           +VLLDTGSSDLWV   +N +C      DS+ T KP+                        
Sbjct: 84  SVLLDTGSSDLWVPGADNLFCENHAVSDSNSTDKPLKSPTLPSPQPT------------- 130

Query: 144 XVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVAN 203
            +DC++YGTFD SKS+SF++N+++  I YGD ++A G +G D  ++  L++ N+S  VA+
Sbjct: 131 -IDCNQYGTFDYSKSSSFKANDSSLLIRYGDQSYALGRFGQDTVEMNSLSIPNVSLGVAH 189

Query: 204 QSNSTVGVMGIGLAGLQSTYVGVNSA-SSGAYQYENFPMALKSQGIIDRNAYSLFLNEPD 262
           Q+N T GV+GIGLAGL++T  G +S  +S +Y YENFP  LKSQGIID NAYSLFLN P 
Sbjct: 190 QANVTQGVLGIGLAGLETTNTGFSSTLNSKSYTYENFPQVLKSQGIIDANAYSLFLNSPG 249

Query: 263 ADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXX------------XXXX 310
           A +G +LFG VDHSKY+G LYTVP++N        NPI+F                    
Sbjct: 250 ASQGGILFGGVDHSKYTGPLYTVPIINT---GAPGNPIQFQVTLQGVGISLDKSNGTNTN 306

Query: 311 XXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENN 370
                    LT ++FP LLDSGTTL  +P  +T  +A  +GA Y+  T YY ++CPS+N+
Sbjct: 307 AADSTSNVTLTASKFPVLLDSGTTLMTLPRPVTDQMAKQLGATYNSETSYYQLKCPSQND 366

Query: 371 DTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLE 430
           +TRL  DFGGFQ+                 C LG+ P  +++   GD FLV AYVVYDL+
Sbjct: 367 NTRLILDFGGFQVNAKITNHITRSQNGE--CLLGITPSDTDSGTLGDVFLVDAYVVYDLD 424

Query: 431 NYEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSSTWSTNQAI 474
           NYEIS+AQA F++S   IE IS S+PSA +A GYS+TW+ +++I
Sbjct: 425 NYEISLAQADFSDSAQSIEPISSSVPSATKAPGYSNTWTGSESI 468

>CAGL0M04191g Chr13 complement(461446..463251) [1806 bp, 601 aa]
           {ON} similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 601

 Score =  347 bits (891), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 179/328 (54%), Positives = 221/328 (67%), Gaps = 5/328 (1%)

Query: 145 VDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQ 204
           ++C++YGTFD SKS+++ SN+TAF I YGD+TFASGTWG DN  L DLNVT LSFAVAN+
Sbjct: 192 INCAKYGTFDTSKSSTWHSNDTAFMIQYGDSTFASGTWGMDNLHLSDLNVTGLSFAVANR 251

Query: 205 SNSTVGVMGIGLAGLQSTYVGVNSASSGA--YQYENFPMALKSQGIIDRNAYSLFLNEPD 262
           +NSTVGV+GIGL  L+ TY G  +A SG   YQY+NFP+ L   G I  N+YSLFLN   
Sbjct: 252 TNSTVGVLGIGLPALEVTYSG-RTAVSGQRPYQYDNFPLVLLRNGAIKSNSYSLFLNNAS 310

Query: 263 ADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTN 322
           A+ GSVLFGAVDHSKY G LYT+PM+N Y ++G +NPI+F+                +T 
Sbjct: 311 AETGSVLFGAVDHSKYLGDLYTIPMVNTYASQGYKNPIQFEVTLNGLGISSSSDNTTITT 370

Query: 323 TQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQ 382
           T+ PALLDSGTTL+Y+P  L   I   + A YS   GYY   CPS+++DT + FDFGGF 
Sbjct: 371 TKIPALLDSGTTLTYLPQALVTRIVQKLQATYSNRAGYYVFSCPSQSDDTEVVFDFGGFH 430

Query: 383 IXXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAFN 442
           I                +C LG++P +    I GD+FL  AYVVYDLENYEISMAQA + 
Sbjct: 431 I--NAPITNFIIGSSGDSCILGIMPQSGGGIILGDSFLNSAYVVYDLENYEISMAQANYA 488

Query: 443 NSDSQIEVISDSIPSAVRAQGYSSTWST 470
                IEVIS S+P AVRA G+SSTWST
Sbjct: 489 GGQEDIEVISSSVPGAVRAPGFSSTWST 516

 Score =  100 bits (248), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 64/88 (72%), Gaps = 3/88 (3%)

Query: 31  YVHLSFDKLRGNSYEEAGKGNKPSAELR--KRDDGYEEIEIYNEQNFYSIELEIGTPSQN 88
           YV L FDK  G ++E A +G +  A++R  KR +GYEE++I N+ +FYS+ LE+GTP Q+
Sbjct: 27  YVKLDFDKYYGETFETAKRG-RSQADIRVNKRANGYEEVQITNQNSFYSVTLEVGTPPQS 85

Query: 89  VTVLLDTGSSDLWVSSPENPYCIDSDDT 116
           V VL+DTGSSDLW++  +NPYC  S  T
Sbjct: 86  VVVLVDTGSSDLWITGSDNPYCRGSTGT 113

>TBLA0D00140 Chr4 (31269..33092) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  347 bits (891), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 209/493 (42%), Positives = 271/493 (54%), Gaps = 61/493 (12%)

Query: 30  KYVHLSFDKLRGNSYEEAGKG-----NKPSAELRKRDDGYEEIEIYNEQNFYSIELEIGT 84
           K + L  +K  G+S    G       + PSA L KR+DG+E IEI N+Q FYS++L +GT
Sbjct: 28  KVLRLDINKFYGDSKFNLGSEIDEDISTPSARLVKREDGHEIIEIQNQQAFYSVDLMLGT 87

Query: 85  PSQNVTVLLDTGSSDLWVSSPENPYCI--------------DSDDTKPVXXXXXXXXXXX 130
           P Q VTVL+DTGSSDLWV+   NPYCI              DS    P+           
Sbjct: 88  PPQKVTVLVDTGSSDLWVTGNNNPYCIDGTSSKAVSSNIEDDSQTKNPISKVVGTTINKI 147

Query: 131 XX----------------------XXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAF 168
                                               +DCS YGTFDPSKS++F SN+T F
Sbjct: 148 RKYFSHNLPDLSFLEDSGSGKYNSSQLKDVTPQDAHIDCSTYGTFDPSKSSTFVSNDTNF 207

Query: 169 SISYGDTTFASGTWGTDNFDLGD-LNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVN 227
            I YGD TFASGTWG D+ +  D LN+T+ SF VA+ +NST+ V+G+GL  L+ TY G+ 
Sbjct: 208 MIRYGDRTFASGTWGRDSIEFSDHLNLTDFSFGVADLTNSTISVLGMGLPRLEVTYSGL- 266

Query: 228 SASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPM 287
           S     Y Y NFPMALK  G+IDR  YSL+LN+  A  GSVLFGAVDHSKY G L T+P+
Sbjct: 267 SLDRSPYTYANFPMALKQSGLIDRMVYSLYLNKAGASTGSVLFGAVDHSKYHGSLNTIPL 326

Query: 288 LNMYRNRGIQNPIEFDXXXX-XXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLI 346
           +++    GI  PI F+               +   +T  PALLDSGTT++Y+P  L   +
Sbjct: 327 ISL-SGSGI--PIAFNVALQGLGMSSDSQGTQTFLSTPLPALLDSGTTMTYLPDALVATV 383

Query: 347 AGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMI 406
           A  +GA + +  G Y + CPS ++D   NFDFGGFQI                 C L + 
Sbjct: 384 ASTLGASFDEAQGLYLLDCPSGSDDREFNFDFGGFQI--SVPLSNFILEALPDVCVLTLF 441

Query: 407 PLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAFN----------NSDSQI--EVISDS 454
              +  AI GD+FL  AYVVYDLEN EISMAQA ++          N+D+++  EV++ +
Sbjct: 442 ESHAERAILGDSFLTEAYVVYDLENLEISMAQARYDDDNDSDIEKYNADNKVLLEVVTSN 501

Query: 455 IPSAVRAQGYSST 467
           IPSA +A GYSST
Sbjct: 502 IPSANQAPGYSST 514

>AGL192W Chr7 (337445..338944) [1500 bp, 499 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR121C (YPS3),
           YDR144C (MKC7) and YLR120C (YPS1); Tandem gene
           duplication in Saccharomyces cerevisiae
          Length = 499

 Score =  342 bits (878), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 193/464 (41%), Positives = 260/464 (56%), Gaps = 36/464 (7%)

Query: 11  GFLLGSQAVALSDVD-EKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKRDDGYEEIEI 69
           G +L +     S V+ E+  ++V + FDK RG S+ EA  G      L KR+D + +IEI
Sbjct: 9   GAVLATNVACASLVEREEAAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRND-WVDIEI 67

Query: 70  YNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXX 129
            N+Q FYS+ L IGTP Q V VL+DTGSSDLWV       C  ++   P           
Sbjct: 68  DNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVG-AGVRCGPNNYPNP----------- 115

Query: 130 XXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDL 189
                          ++C E+G+FD S+S++++ NNT F I YGD+T+A GTWGTD  DL
Sbjct: 116 -------------NQLNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDL 162

Query: 190 GDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNSASSGAYQYENFPMALKSQGII 249
           G  NV  L+FAVA+ SNS+V V+GIGL  +++T     S+    YQY+N PM LK   +I
Sbjct: 163 GQANVDGLTFAVAHASNSSVAVLGIGLPAMETTM----SSQQFGYQYDNLPMVLKRNNVI 218

Query: 250 DRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXX 309
            +  YS+F+NE +A  GSVLFGAVDHSKY G L TVP++N    R +  P+E        
Sbjct: 219 KKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAI 278

Query: 310 XXXXXX---XIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCP 366
                     ++ L  ++ PALLDSGTTL+Y P  L   +A A GA++      Y + C 
Sbjct: 279 GLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQLADRLARAAGARWHSEEVGYIVDCN 338

Query: 367 SEN-NDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAYV 425
           S   + T   +DFGGFQI                TC  G++P +S+  I GD FL  AYV
Sbjct: 339 SRRLHQTAYIYDFGGFQI-RSPLSDYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTRAYV 397

Query: 426 VYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSSTWS 469
           V+DLE  E+SMAQA +     QIEVI+ ++P AVRA GY+  W 
Sbjct: 398 VFDLEALEVSMAQANYEGGKEQIEVIAGAVPRAVRAPGYNDPWK 441

>Skud_12.192 Chr12 complement(369422..371131) [1710 bp, 569 aa] {ON}
           YLR120C (REAL)
          Length = 569

 Score =  343 bits (881), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 181/332 (54%), Positives = 229/332 (68%), Gaps = 6/332 (1%)

Query: 145 VDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQ 204
           ++C E+GTF  S S++FRSNNT FSISYGD TFASGT+GTD  DL DLNVT LSFAVAN+
Sbjct: 184 MNCQEFGTFTTSDSSTFRSNNTYFSISYGDGTFASGTFGTDILDLSDLNVTGLSFAVANE 243

Query: 205 SNSTVGVMGIGLAGLQSTYVGVNSASS-GAYQYENFPMALKSQGIIDRNAYSLFLNEPDA 263
           +NST+GV+GIGL  L+ TY G  ++SS   Y Y+NFPM LK+ G I  NAYSL+LN+ DA
Sbjct: 244 TNSTMGVLGIGLPELEVTYSGSTASSSRRPYTYDNFPMVLKNSGAIKTNAYSLYLNDSDA 303

Query: 264 DKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXXXX-XXXXIRNLTN 322
             G++LFGAVDHSKY+G LYTVP++N     G  +PI+FD               + LT 
Sbjct: 304 KHGTILFGAVDHSKYAGTLYTVPIVNTLSASGFSSPIQFDVTINGIGISYPDNSQKTLTT 363

Query: 323 TQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQ 382
           TQ PALLDSGTTL+Y+P  +  +IA  + AQYS   GYY + CPS +N T++ FDFGGF 
Sbjct: 364 TQIPALLDSGTTLTYLPQAVVAMIADELDAQYSSRLGYYVLDCPSNSNSTQIVFDFGGFH 423

Query: 383 IXXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAFN 442
           I                 C LG+I  T +  I GD+FL +AYVVYDL+N EISMAQA +N
Sbjct: 424 I---NASLSSFILNAGNICLLGIIA-TDDTTILGDSFLTNAYVVYDLDNLEISMAQAQYN 479

Query: 443 NSDSQIEVISDSIPSAVRAQGYSSTWSTNQAI 474
            ++  IEVI+ SIPSA++A GY+STWST+ +I
Sbjct: 480 ITNENIEVITSSIPSAIKAPGYTSTWSTSASI 511

 Score =  112 bits (280), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 49/86 (56%), Positives = 62/86 (72%)

Query: 25  DEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKRDDGYEEIEIYNEQNFYSIELEIGT 84
           D+   K+V L F KL G++ ++ G   KP   L KR DGYEEI I N+Q+FYS++LE+GT
Sbjct: 32  DDSNSKFVKLPFHKLYGDTRDDVGTDKKPEVRLLKRADGYEEIIITNQQSFYSVDLEVGT 91

Query: 85  PSQNVTVLLDTGSSDLWVSSPENPYC 110
           P QNVTVL+DTGSSDLW+    NPYC
Sbjct: 92  PPQNVTVLVDTGSSDLWIMGSNNPYC 117

>Kwal_33.14239 s33 (582768..584723) [1956 bp, 651 aa] {ON} YDR144C
           (MKC7) - aspartyl protease related to Yap3p [contig 105]
           FULL
          Length = 651

 Score =  341 bits (875), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 200/469 (42%), Positives = 268/469 (57%), Gaps = 15/469 (3%)

Query: 9   ISGFLLGSQAVALSDVDEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKRDDGYEEIE 68
           IS F  G  +V  +  +   G YV  +F K  G+S+  A  G++P  +L +RD G  +  
Sbjct: 7   ISAFAAGLVSVVAAS-ESSNGDYVSFNFGKSLGSSFHGARGGSRP-GKLHRRDSGSSDSA 64

Query: 69  I---YNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXX 125
           +    NE+ FYS++L IGTP Q++TVL DTGSSDLWVSS  NP+C ++D           
Sbjct: 65  LSVLKNEEVFYSVKLNIGTPPQDITVLFDTGSSDLWVSSNSNPFC-EADGVNRRADLKSS 123

Query: 126 XXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFR-SNNTAFSISYGDTTFASGTWGT 184
                              VDC+E+GTF+P+KS++FR   N  F I YGD TFA+G W  
Sbjct: 124 STYSVAPSTTIDGFEVAPTVDCAEFGTFNPNKSSTFRPQGNDTFMIMYGDGTFANGLWAK 183

Query: 185 DNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNSASSGAYQYENFPMALK 244
           D   L   +++NL FAVAN S+S VGV+G+GL GL+S+    +   S   QY NFP+ LK
Sbjct: 184 DTLSLDGHDISNLQFAVANMSDSDVGVLGVGLTGLESSADPFDDEPS---QYPNFPVVLK 240

Query: 245 SQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDX 304
              +I + AYSL++N  DA+ GSVLFGAVDHSKY+G LYT+P++N      +   +EFD 
Sbjct: 241 QNNVISKMAYSLYINSLDAEAGSVLFGAVDHSKYTGGLYTIPLVNALAQYFVDEILEFDV 300

Query: 305 XXXXXXXXXXXXI--RNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYS 362
                          + LT  QFPAL+DSGTTL Y+   L   IA ++GA  S     Y+
Sbjct: 301 TVQGLGIESKKNCFQKTLTTAQFPALMDSGTTLIYIDPDLADAIADSLGATMSDDYELYT 360

Query: 363 MRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVH 422
             CP++++DT+L FDFGGFQI                 C LG++P  SN  I GD FL  
Sbjct: 361 FECPAKDDDTQLVFDFGGFQI-TNPLSNYVLETDDEKVCGLGVVPSYSN--ILGDEFLAS 417

Query: 423 AYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSSTWSTN 471
           AYVV+DLEN E+S+ QA  N     IE I  ++P A +A GYSSTW+ N
Sbjct: 418 AYVVFDLENLELSIGQANLNPGPEDIEPIISTVPGAQKAPGYSSTWTFN 466

>NCAS0B03560 Chr2 complement(629374..631134) [1761 bp, 586 aa] {ON} 
          Length = 586

 Score =  337 bits (865), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 176/332 (53%), Positives = 221/332 (66%), Gaps = 7/332 (2%)

Query: 145 VDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQ 204
           +DCS+YGTFD ++S++F++N T+F  SYGD+TFASGTW  D  +LG LN+T LSFAVAN 
Sbjct: 195 IDCSQYGTFDKNQSSTFQTNFTSFLTSYGDSTFASGTWAHDVLNLGGLNITGLSFAVANM 254

Query: 205 SNSTVGVMGIGLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDAD 264
           SNSTVGV+GIGL GL++TY G   ++S  YQY NFPM LK  G ID  +YSLFL++ DA 
Sbjct: 255 SNSTVGVLGIGLPGLETTYSG---STSKLYQYNNFPMLLKQSGAIDSTSYSLFLDDLDAK 311

Query: 265 KGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQ 324
           +GSVLFGAVDH+KY G LYTVPM+N+  ++G  NPI+FD                +T  +
Sbjct: 312 QGSVLFGAVDHTKYVGNLYTVPMVNILASKGYPNPIQFDVTLAGIGIQNDSKNYTVTTNK 371

Query: 325 FPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIX 384
           FPALLDSGTT+SY P  + Q IA  +GA+YS   G+Y+M C   ++ T   FDFGGF I 
Sbjct: 372 FPALLDSGTTISYFPQEVVQTIARQLGARYSSALGFYAMSCNGVSSSTNFVFDFGGFHI- 430

Query: 385 XXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQA--AFN 442
                          TC L M P  S   + GD FL HAYVVYDL+NYEIS+AQA     
Sbjct: 431 -TGPVSDFLLPTSGNTCVLAMAPQESQHILLGDIFLTHAYVVYDLDNYEISLAQANTGTQ 489

Query: 443 NSDSQIEVISDSIPSAVRAQGYSSTWSTNQAI 474
           N DS I++ISDS+PSA++A  YS TWS    I
Sbjct: 490 NLDSNIQIISDSVPSAIKAPLYSETWSKAMPI 521

 Score =  112 bits (279), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 52/97 (53%), Positives = 67/97 (69%)

Query: 23  DVDEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKRDDGYEEIEIYNEQNFYSIELEI 82
           +  ++  KYV L F+KL G+SYE+A    KP   L KRD  YE + I NEQ+FYS+EL I
Sbjct: 28  ETTDQSSKYVILPFNKLVGDSYEDATPDKKPHFALVKRDGSYENVAIKNEQSFYSVELLI 87

Query: 83  GTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPV 119
           GTPSQ +TVL+DTGSSDLW+   +NPYC  + + K V
Sbjct: 88  GTPSQKITVLVDTGSSDLWIMGSDNPYCASTSNGKNV 124

>ZYRO0F10230g Chr6 complement(826246..827988) [1743 bp, 580 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 580

 Score =  334 bits (856), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 164/320 (51%), Positives = 223/320 (69%), Gaps = 3/320 (0%)

Query: 145 VDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQ 204
           +DCS YGTFD ++S++++SNNTAF ISYGD +FASG WG D+ +LG LN++++S AVAN 
Sbjct: 199 IDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAND 258

Query: 205 SNSTVGVMGIGLAGLQSTYVGVNSASSG-AYQYENFPMALKSQGIIDRNAYSLFLNEPDA 263
           +NSTVGV+GIGL GL++TY    S  SG  + Y NFPM LK +GI  +N YSL+LN PDA
Sbjct: 259 TNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDA 318

Query: 264 DKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNT 323
             GS+LFGAVD SK+ G LYT+P+LN+Y++RG+  PI+FD                L+ T
Sbjct: 319 HNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQTSTTTLSTT 378

Query: 324 QFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQI 383
           + PALLDSG+TL+Y+P  L +++A  +GA++S+   YY M CPS++++T++ F+FGGF I
Sbjct: 379 KIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNI 438

Query: 384 XXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAFNN 443
                           TC L ++P   ++AI GD FLVHAYVVYDLE++EISMAQA F+ 
Sbjct: 439 --ETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDV 496

Query: 444 SDSQIEVISDSIPSAVRAQG 463
           +   IEV+S SIP A  A G
Sbjct: 497 NHEDIEVVSSSIPQATAAAG 516

 Score =  110 bits (276), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 52/109 (47%), Positives = 73/109 (66%), Gaps = 2/109 (1%)

Query: 2   QLLPAALISGFLLGSQAVALSDVDEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKRD 61
           Q+L   L++   +   A    +V+E+  K V LSFDK  G +YEE+  G + +    KRD
Sbjct: 5   QILKCTLLAN--VARSAAFSQEVEEQTPKIVKLSFDKRHGENYEESLLGKRDALPFVKRD 62

Query: 62  DGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYC 110
           DG  E+ + N QNFYS++LE+G+PSQ +TVLLDTGSSDLW++  +NPYC
Sbjct: 63  DGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYC 111

>NDAI0J01030 Chr10 (235967..237925) [1959 bp, 652 aa] {ON} 
          Length = 652

 Score =  330 bits (845), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 176/336 (52%), Positives = 223/336 (66%), Gaps = 8/336 (2%)

Query: 145 VDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQ 204
           +DC EYGTF+ S+S++F++N T+FSISYGD+TFASGTW  D  +L DLNVT LSFAVAN 
Sbjct: 242 LDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVANM 301

Query: 205 SNSTVGVMGIGLAGLQSTYVGVNSASS-GAYQYENFPMALKSQGIIDRNAYSLFLNEPDA 263
           +NSTVGV+GIGL  L+STY G + A+    YQY NFPM LK  G I    YSLFL++ D 
Sbjct: 302 TNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDLDE 361

Query: 264 DKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNT 323
             GSVLFGA+DHSKY+GQLYTVPM+N+ RN G  NPI+FD                LT T
Sbjct: 362 SHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERNLTLTTT 421

Query: 324 QFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQI 383
           +  ALLDSGTT+SY P ++ +L+A  + AQYS   G+Y++ C S +++T L FDFGGF I
Sbjct: 422 KLAALLDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFHI 481

Query: 384 XXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQA---- 439
                           TC L M P  S   I GD FL HAYVVYDL+NY I++AQA    
Sbjct: 482 --SGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALAQADTST 539

Query: 440 AFNNSDSQIEVISDS-IPSAVRAQGYSSTWSTNQAI 474
           +  +S S IE+I++S IP A+RA  YS TW+ N+ +
Sbjct: 540 SNQSSSSDIELITNSTIPRAIRAPLYSETWTANRPV 575

 Score =  108 bits (269), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 70/94 (74%), Gaps = 4/94 (4%)

Query: 30  KYVHLSFDKLRGNSYEEAGKGNKPSAELRKRDD----GYEEIEIYNEQNFYSIELEIGTP 85
           KYV L F+K  G+S+E A + NKP  +L KRD+    GYE+++I N+Q+FYS+EL IGTP
Sbjct: 56  KYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTP 115

Query: 86  SQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPV 119
            Q+VTVL+DTGS+DLWV+   NP+C  S +++ V
Sbjct: 116 PQHVTVLVDTGSADLWVTGSMNPFCQSSLNSRNV 149

>KLTH0F06754g Chr6 (590569..592872) [2304 bp, 767 aa] {ON} weakly
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 767

 Score =  332 bits (852), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 203/482 (42%), Positives = 272/482 (56%), Gaps = 24/482 (4%)

Query: 4   LPAALISGFLLGSQAVALSDVDEKPGK-YVHLSFDKLRGNSYEEAGKGNKPSAELRKRDD 62
           +P A+++ FL    A+ +  V    G  YV + F K +G SY++A  G +P A+L+KR  
Sbjct: 11  VPCAMLALFL----ALFVPCVIASSGMGYVAIDFAKAKGISYQDARVGARP-AKLQKRAL 65

Query: 63  GYEEI---EIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPV 119
              E    E+ N   FYS+ L+IGTP Q VTVL DTGSSDLWVSS +NPYC + D T+  
Sbjct: 66  SQGETLNSELVNNNVFYSVGLDIGTPPQQVTVLFDTGSSDLWVSSNDNPYCSNGDSTESY 125

Query: 120 XX----XXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSN-NTAFSISYGD 174
                                        +DC++YGTF+  +STS  +N +  F +SY D
Sbjct: 126 ANYRADLKSSSALTAAPTTTISGITIAPTIDCAQYGTFNADRSTSLFANYSKPFFVSYND 185

Query: 175 TTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQST--YVGVNSASSG 232
            ++A G W  D   +   ++++L FAVA  SNSTVGV+G+GL GL+ST  Y   N +S  
Sbjct: 186 DSYALGYWARDKLVVDGDDISSLEFAVAEISNSTVGVLGVGLQGLESTVHYRSPNISS-- 243

Query: 233 AYQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYR 292
              Y NFPM LK  G ID+ AYSL+LN  DA  GSVLFG VDHSKY+G LYT+P++N Y+
Sbjct: 244 --IYPNFPMVLKENGAIDKIAYSLYLNSLDAPSGSVLFGGVDHSKYTGGLYTLPLVNTYK 301

Query: 293 NRGIQNPIEFDXXXXXXXXXXXXXIRN--LTNTQFPALLDSGTTLSYMPYTLTQLIAGAV 350
           + G++ P++FD              R    T T+  AL+DSGTTL Y    +   IA  V
Sbjct: 302 DYGVKTPVQFDVTVQGIGIESEKACRQETFTTTKIAALMDSGTTLMYTAPEIVNKIALYV 361

Query: 351 GAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTS 410
            A +S   G +  RCPS+ +DT+  FDFGGFQI                 C LG+I  ++
Sbjct: 362 NASFSPGYGLFMFRCPSDGDDTQFIFDFGGFQI-KSPLSNYILRTDDENICGLGLIS-SN 419

Query: 411 NAAIFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSSTWST 470
              IFGD FL  AYVVYDLEN E+S+AQA +N    +IE I   IP A RA  Y +TW +
Sbjct: 420 QGTIFGDEFLASAYVVYDLENLELSLAQANWNPGSPEIEKIVSEIPRAQRASQYWNTWVS 479

Query: 471 NQ 472
           ++
Sbjct: 480 DE 481

>KAFR0B05710 Chr2 complement(1177594..1179321) [1728 bp, 575 aa]
           {ON} Anc_8.318 YLR120C
          Length = 575

 Score =  322 bits (826), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 164/326 (50%), Positives = 217/326 (66%), Gaps = 4/326 (1%)

Query: 149 EYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNST 208
           EYGTF+ + S+++ SN+T+F ISYGD++ A G WG D   + D++V+ +SFAVAN +NST
Sbjct: 186 EYGTFNTNDSSTWSSNHTSFFISYGDSSVAEGVWGQDVLSISDVDVSGVSFAVANYTNST 245

Query: 209 VGVMGIGLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSV 268
           VGV+GIGL+GL++TY G +S+ S  Y YEN PM LKS G+ID  AYSLFLNE     G++
Sbjct: 246 VGVLGIGLSGLETTYSGTSSSES--YIYENLPMLLKSSGVIDTIAYSLFLNEKSDTTGNL 303

Query: 269 LFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQFPAL 328
           LFGAVDHSKYSG LYT+P++N+Y + G +NP+EFD                +   + PAL
Sbjct: 304 LFGAVDHSKYSGSLYTLPIVNVYASEGYKNPLEFDVTMYGLGISTSDSNTTIATMKIPAL 363

Query: 329 LDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXXXXX 388
           LDSGTT+ Y P TL +L+A  +GA YS   G+Y+M C S ++DT   FDFGGF I     
Sbjct: 364 LDSGTTIVYFPETLLELVADQLGASYSDELGFYAMSCVSSSDDTEFVFDFGGFHITVPLS 423

Query: 389 XXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQI 448
                       C L M      + I GD FL +AYVVYDLENYEISMAQA +++ D  I
Sbjct: 424 DFLIRVSGSE--CILAMAAQDDESIILGDYFLTNAYVVYDLENYEISMAQANYDSEDEDI 481

Query: 449 EVISDSIPSAVRAQGYSSTWSTNQAI 474
           EVIS ++PSAV+A  YS++WS+  +I
Sbjct: 482 EVISSTVPSAVKAASYSNSWSSTGSI 507

>KNAG0I00910 Chr9 (171104..172813) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score =  318 bits (816), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 168/336 (50%), Positives = 215/336 (63%), Gaps = 12/336 (3%)

Query: 145 VDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQ 204
           V CS YGTFD SKS++F+SNNTAF+ISYGDT++ASG+WG D   +  LNV+ +SFAVAN 
Sbjct: 157 VQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANY 216

Query: 205 SNSTVGVMGIGLAGLQST---------YVGVNSASSGAYQYENFPMALKSQGIIDRNAYS 255
           SNS++GV+GIGL GL+ T            + +ASS  YQY NFPM LK+ GII + AYS
Sbjct: 217 SNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYS 276

Query: 256 LFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXX 315
           LFLN+P   +GSVLFGAVDHSKY+G LYTVP++++Y +     P+EFD            
Sbjct: 277 LFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGVDKDG 336

Query: 316 XIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLN 375
               +  T  PALLDSGTT+SY P  L   IA    A Y   +G+Y+M C  + ++T L 
Sbjct: 337 SQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLV 396

Query: 376 FDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEIS 435
           FDFGGF I                TC L + P   N  + GD FL +AYVVYDLEN E+S
Sbjct: 397 FDFGGFHI--TAPLDDFVVQQSSQTCVLAIGPQQENWVVLGDVFLSNAYVVYDLENLEVS 454

Query: 436 MAQAAFNNS-DSQIEVISDSIPSAVRAQGYSSTWST 470
           MAQA F++S    +EVIS ++PSAV+A  YS+ WS+
Sbjct: 455 MAQANFDSSLPESVEVISSTVPSAVKAASYSNPWSS 490

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 34/56 (60%), Positives = 43/56 (76%), Gaps = 2/56 (3%)

Query: 57  LRKRD--DGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYC 110
           L KRD  DGY  +++ N+ +FYS++LEIGTP Q VTVL+DTGSSDLWV   +NP C
Sbjct: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLC 60

>KAFR0E03940 Chr5 (779476..781392) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  319 bits (818), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 192/453 (42%), Positives = 262/453 (57%), Gaps = 32/453 (7%)

Query: 26  EKPGKYVHLSFDKLRGNSYEEA--GKGNKPSAELRKRDDGYEEIEIYNEQNFYSIELEIG 83
           E PG +V + F K  G S  ++   KGN     L KR  G +E+E+ NE  FY+I++EIG
Sbjct: 23  EAPG-FVGVQFSKRYGKSISDSSLAKGN-----LVKRSSGTDEVELINESVFYAIDMEIG 76

Query: 84  TPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXXXXXXXXXXXXXXX 143
           TP Q+VTVL+DTGSSD WV S  NPYC     T  +                        
Sbjct: 77  TPKQSVTVLVDTGSSDFWVPSSTNPYCESKSATSTIASSDL------------------- 117

Query: 144 XVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVAN 203
            +DC+ YGTF  S S+SF  NNT F   Y D + A+G WG D  D G   ++++S AVA+
Sbjct: 118 -IDCTTYGTFSVSDSSSFVYNNTDFQTQYADGSSATGFWGHDVVDFGGQELSDISIAVAD 176

Query: 204 QSNSTVGVMGIGLAGLQSTYVGVNSASSGA--YQYENFPMALKSQGIIDRNAYSLFLNEP 261
           Q++S+ GV+GIGL GL+STY G  +ASS    YQY+NFP+ L  + +I  NAYSL+L+  
Sbjct: 177 QTDSSFGVLGIGLTGLESTYSGSAAASSSTGRYQYDNFPIRLVQENVIQANAYSLYLDPA 236

Query: 262 DADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLT 321
               G++LFG VDH+KYSG L T+P++N     G  +PI+                  +T
Sbjct: 237 TGSSGTILFGGVDHNKYSGDLNTIPLINTLEANGYTSPIKLQVTLNGLGVSDGSSTSTVT 296

Query: 322 NTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGF 381
            TQ PALLDSGTTL+Y+P  +  L+A  +GA YS  +  Y + C + + D+ + +DFGGF
Sbjct: 297 TTQIPALLDSGTTLTYLPTAMFDLLAEQIGATYSSTSNGYVLSCANVDEDSMIVYDFGGF 356

Query: 382 QIXXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAF 441
           QI                 C L +   +S+ A  GD FL HAYVVYDL+N EISMAQ  +
Sbjct: 357 QIQTPLAGSLYQLSDDQ--CELAIGSTSSSYATLGDLFLTHAYVVYDLDNKEISMAQINY 414

Query: 442 NNSDSQIEVISDSIPSAVRAQGYSSTWSTNQAI 474
           N +   IE+ISDS+P A +A GY +TW+T+++I
Sbjct: 415 NATTEDIEIISDSVPGATKAAGYYNTWTTSESI 447

>ZYRO0F10274g Chr6 complement(831057..832775) [1719 bp, 572 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 572

 Score =  313 bits (801), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 170/333 (51%), Positives = 219/333 (65%), Gaps = 5/333 (1%)

Query: 145 VDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQ 204
           +DCS+YGTFD +KS SFRSN T F ISYGD +FASG WGTD+ +  ++N+  +SFAVAN+
Sbjct: 178 MDCSQYGTFDVNKSKSFRSNKTEFYISYGDGSFASGYWGTDSVNFANMNLEGVSFAVANE 237

Query: 205 SNSTVGVMGIGLAGLQSTYVGVNSASS-GAYQYENFPMALKSQGIIDRNAYSLFLNEPDA 263
           +NSTVGV GIGL   ++TY    S +    Y+Y+NFP  LKS+G I++ AYSLFLN  DA
Sbjct: 238 TNSTVGVFGIGLPENEATYTPDPSLNDFHPYEYQNFPQVLKSKGAINKAAYSLFLNSLDA 297

Query: 264 DKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNT 323
             G +LFGAVD SKY G LYT+P+LN    +  +NP+EFD                 T T
Sbjct: 298 SSGDILFGAVDRSKYKGDLYTLPLLNSDPTK-YKNPMEFDVTLQGVGFTNGSSKTTFTTT 356

Query: 324 QFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQI 383
           + PALLDSGT+L Y+P  L + IA  +G  Y++  GYY + CPSEN+D++L FDFGGF I
Sbjct: 357 KIPALLDSGTSLIYLPDALAKGIAHKLGGSYNEDIGYYVIGCPSENDDSQLVFDFGGFTI 416

Query: 384 XXXXXX--XXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAF 441
                              C LG++P +   AI GD FL  AYVVYDL++YE+S+AQA+F
Sbjct: 417 KNNLSNYLLGSPDDGDDSQCVLGILP-SDVQAILGDVFLADAYVVYDLDDYEVSLAQASF 475

Query: 442 NNSDSQIEVISDSIPSAVRAQGYSSTWSTNQAI 474
           +NS   I++ISDSIP A RA GYS TWST  +I
Sbjct: 476 DNSKEDIQIISDSIPGAKRAPGYSKTWSTPASI 508

 Score = 83.2 bits (204), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 39/87 (44%), Positives = 57/87 (65%), Gaps = 3/87 (3%)

Query: 24  VDEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKRDDGYEEIEIYNEQNFYSIELEIG 83
           +++     V LSF+K  G +YEE+    +    L  R++      + N+QNFYS++L +G
Sbjct: 22  IEQTSSPMVKLSFNKWHGPTYEESSLERR---SLETRNNKEFNFIVENQQNFYSVDLLVG 78

Query: 84  TPSQNVTVLLDTGSSDLWVSSPENPYC 110
           TP QN+TVLLDTGSSDLW+++  NPYC
Sbjct: 79  TPGQNITVLLDTGSSDLWLTAKNNPYC 105

>TBLA0E02630 Chr5 complement(665115..667184) [2070 bp, 689 aa] {ON} 
          Length = 689

 Score =  310 bits (793), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 169/337 (50%), Positives = 219/337 (64%), Gaps = 13/337 (3%)

Query: 145 VDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGD-LNVTNLSFAVAN 203
           ++C  YGTFD   S++++SN T F+I Y DT+FASG WG D     D LNVT LSFAVAN
Sbjct: 282 INCDAYGTFDIENSSTYQSNQTGFAIRYADTSFASGDWGRDVLTFSDGLNVTGLSFAVAN 341

Query: 204 QSNSTVGVMGIGLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDA 263
           Q+NSTVGV+GIGL  L+ TY GV   ++  Y Y+NFP+ LK+ G I ++AYSL+LN+  A
Sbjct: 342 QTNSTVGVLGIGLPQLEVTYAGV-YQTTKPYTYDNFPLVLKNSGAIHKSAYSLYLNKQSA 400

Query: 264 DKGSVLFGAVDHSKYSGQ-LYTVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRN--- 319
             G+VLFGA+DHS+Y G  LYT+P++N   + G   PIEFD              RN   
Sbjct: 401 KNGNVLFGAIDHSQYQGDTLYTIPLVNSDTSSGYSKPIEFDVTLQGLGVSDN---RNGNF 457

Query: 320 -LTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDF 378
            +T TQ  ALLDSGTTL+Y P  +  L+A  + A YS+  GYY M CP   ++T+L FDF
Sbjct: 458 TVTTTQIVALLDSGTTLTYFPKDMLNLLAKRINASYSEALGYYVMNCPDSRDNTQLVFDF 517

Query: 379 GGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQ 438
           GGF I                 C LG++P   N+AI GD FL HAYVVY+L++ EISMAQ
Sbjct: 518 GGFHIKTNLTNFVLSSASGK--CVLGLLPYNGNSAILGDIFLTHAYVVYNLDDLEISMAQ 575

Query: 439 AAFNN-SDSQIEVISDSIPSAVRAQGYSSTWSTNQAI 474
           A FNN +D  IEVIS +IP+AV+A GYS T+S +++I
Sbjct: 576 ANFNNGNDEDIEVISSTIPNAVKAPGYSYTYSVSKSI 612

 Score = 92.0 bits (227), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 39/62 (62%), Positives = 52/62 (83%)

Query: 49  KGNKPSAELRKRDDGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENP 108
           K +KP  +L KR DGYE+I+I N+Q+FYS+ L+IGTP+Q++TVL+DTGSSDLWV+   NP
Sbjct: 73  KNSKPYIKLIKRHDGYEKIQIINQQSFYSVNLQIGTPAQSITVLVDTGSSDLWVTGSNNP 132

Query: 109 YC 110
           YC
Sbjct: 133 YC 134

>TBLA0H01290 Chr8 (290515..292518) [2004 bp, 667 aa] {ON} Anc_8.318
           YLR120C
          Length = 667

 Score =  308 bits (788), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 164/332 (49%), Positives = 219/332 (65%), Gaps = 5/332 (1%)

Query: 145 VDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGD-LNVTNLSFAVAN 203
           ++C  YGTFD   S++F+SN T+F+I Y DT++A+G WG D     D LNVT LSFAVAN
Sbjct: 261 INCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVAN 320

Query: 204 QSNSTVGVMGIGLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDA 263
           Q+NSTVGV+GIGL  L+ TY GV   S+  Y Y+NFP+ LK+ G I ++ YSL+LN+ +A
Sbjct: 321 QTNSTVGVLGIGLPQLEVTYSGV-YQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQNA 379

Query: 264 DKGSVLFGAVDHSKYSGQ-LYTVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTN 322
             G+VLFGAVDHS+Y G  LYTVP++N   + G   PIEFD                +T 
Sbjct: 380 KNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGVTDNTNNYTVTT 439

Query: 323 TQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQ 382
           TQ  ALLDSGTTL+Y P  +  L+A  + A YS   GYY M CP  +++T++ FDFGGF 
Sbjct: 440 TQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGFH 499

Query: 383 IXXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAFN 442
           I                 C LG++P   N+AI GD FL HAYVVY+L++ EISMAQA ++
Sbjct: 500 INANLTNFVLSSASGK--CVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQANYD 557

Query: 443 NSDSQIEVISDSIPSAVRAQGYSSTWSTNQAI 474
           NS+  IEVI+ ++P+AV+A GYS T+ST+++I
Sbjct: 558 NSNEDIEVITSTVPNAVKAPGYSYTYSTSKSI 589

 Score = 94.0 bits (232), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 40/62 (64%), Positives = 52/62 (83%)

Query: 49  KGNKPSAELRKRDDGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENP 108
           K +KP   L KR+DGYEEI+I N+Q+FYS+ L IGTP+Q++TVL+DTGSSDLWV+  +NP
Sbjct: 80  KESKPYVNLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNP 139

Query: 109 YC 110
           YC
Sbjct: 140 YC 141

>SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {ON}
           some similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 542

 Score =  302 bits (774), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 170/414 (41%), Positives = 240/414 (57%), Gaps = 26/414 (6%)

Query: 57  LRKRDDGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDT 116
           L KR+     + + NEQ FY+ +L +GTP QN+TVLLDTGSSDLWV+  +NPYC+ ++ T
Sbjct: 41  LWKRNQNSLALNLKNEQIFYAADLNVGTPPQNLTVLLDTGSSDLWVTGSDNPYCLSNETT 100

Query: 117 KPVXXXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTT 176
                                       VDCS YGTF+   S +F  +++ F I+Y D T
Sbjct: 101 -----------------TEPSKNITKSVVDCSRYGTFEKDNSLTFSQSDSRFQINYADNT 143

Query: 177 FASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNSASSGAYQY 236
           FA+G W  D    GD  + ++ FAVAN++NSTVGV+GIG   L+S   G   A +  YQ 
Sbjct: 144 FANGYWAKDVVSFGDNFIADMQFAVANETNSTVGVLGIGFERLESVK-GYEGAPNTYYQ- 201

Query: 237 ENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGI 296
            NFP+ALK+ G+ID+ AYSL+LN  D+  GS+LFG +D +KY+G LYT P++N++ +  +
Sbjct: 202 -NFPLALKNNGVIDKTAYSLYLNSLDSSSGSILFGGIDSNKYTGDLYTFPLVNIHPSV-V 259

Query: 297 QNPIEFDXXXXXXXXXXXXXIRN-LTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYS 355
             P +F               ++ L +T++PALLDSGTTL   P      +A  V A Y+
Sbjct: 260 NKPAKFHVTVQGIGVQSSGSEQSILMSTKYPALLDSGTTLLVAPQEFADSMANYVNATYN 319

Query: 356 QYTGYYSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIF 415
              G Y+M CP EN+DT   FDFG  +I                 C  G++P T +  I 
Sbjct: 320 DLEGIYTMTCPPENDDTEFLFDFGDLKIKVPLKNFILAPEDNEY-CGFGVLP-TVDTMIL 377

Query: 416 GDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSSTWS 469
           GD FL  AYVVYDLE+YE+S+AQA +N+ +S+I+ I  ++P A +A   ++TWS
Sbjct: 378 GDMFLSAAYVVYDLESYEVSLAQANWNSDESEIQAIRHTVPGATKAT--AATWS 429

>KLLA0E04049g Chr5 (366535..368304) [1770 bp, 589 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 589

 Score =  302 bits (773), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 167/330 (50%), Positives = 213/330 (64%), Gaps = 3/330 (0%)

Query: 145 VDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQ 204
           +DCSE+GTFD SKS+S++SN+T F ISY D TFA G WG D   L D+NVT LSFAV+N 
Sbjct: 189 LDCSEFGTFDTSKSSSWQSNDTRFYISYADGTFADGDWGVDEIHLDDVNVTGLSFAVSNY 248

Query: 205 SNSTVGVMGIGLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDAD 264
           ++S  GV+GIGL G +STY G   ++   YQY+NFP+ L+  G+I++NAYS+FLN+ DAD
Sbjct: 249 TDSQFGVLGIGLTGSESTYSG-QLSTYNRYQYDNFPIVLQRNGVIEKNAYSVFLNDLDAD 307

Query: 265 KGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQ 324
            GS+LFGAVDHSKY+G LYTVPM+N  R+ G    I                   +T T+
Sbjct: 308 SGSILFGAVDHSKYTGTLYTVPMVNALRSIGYTEQIRLSITLQGIGVTSSYGNETVTQTK 367

Query: 325 FPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIX 384
           +PALLD+G T  Y P +L   IA +V A YS  +GYY + C S  +D  L FDFGGF I 
Sbjct: 368 YPALLDTGATFCYFPSSLAAAIASSVSATYSSSSGYYFVDCDS-GSDYDLVFDFGGFHII 426

Query: 385 XXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAFNNS 444
                           C LG++P + N    GD FL  AYVVYDLE  EIS+AQA++ + 
Sbjct: 427 SPLSDYIVTTSSSSQ-CVLGILPQSDNEITLGDAFLTSAYVVYDLEELEISLAQASYTSG 485

Query: 445 DSQIEVISDSIPSAVRAQGYSSTWSTNQAI 474
           D +IEVI DS+PSAV A GYSSTWST  ++
Sbjct: 486 DEKIEVIRDSVPSAVAAPGYSSTWSTAASL 515

 Score =  107 bits (268), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 62/90 (68%)

Query: 21  LSDVDEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKRDDGYEEIEIYNEQNFYSIEL 80
           +S V E   K+V +SFDKLRGN   EA    +    L+KR DGY ++EI N+  FYS++L
Sbjct: 26  VSQVGEANKKHVFMSFDKLRGNDASEASLSKRRVGHLKKRADGYVDVEIDNQNTFYSVDL 85

Query: 81  EIGTPSQNVTVLLDTGSSDLWVSSPENPYC 110
           EIGTP+Q V VL+DTGSSDLWV    NP+C
Sbjct: 86  EIGTPAQKVGVLIDTGSSDLWVPGSGNPFC 115

>KNAG0I00900 Chr9 (169003..170598) [1596 bp, 531 aa] {ON} 
          Length = 531

 Score =  295 bits (755), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 173/480 (36%), Positives = 253/480 (52%), Gaps = 26/480 (5%)

Query: 3   LLPAALISGFLLGSQAVALSDVDEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKRDD 62
           +L   LI    LG+ A+A   V + P KYV + FDK        +  G+   A   KRD 
Sbjct: 8   MLLKELIVSLCLGTAAIA--SVVKLPKKYVQMGFDK-----SCTSATGDMVFA---KRDG 57

Query: 63  GYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYC------------ 110
            Y  +++ NE+  Y+++L +GTP QN+TV ++ GS+D W++SP+NPYC            
Sbjct: 58  DYVLVDLINEKILYTVQLAVGTPPQNITVSINIGSADPWMTSPDNPYCEIKKHSGYEKQV 117

Query: 111 -IDSDDTKPVXXXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFS 169
             ++  +                            +DC+ YGTF+ S S+SF++N T F+
Sbjct: 118 GANTSVSLLSSLSNDRVTMSGTVTTGTSSSMVQPIIDCTNYGTFNHSSSSSFKNNGTNFT 177

Query: 170 ISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYV-GVNS 228
           + Y D T AS  WGTD   +  L + ++SF VAN  N+T GV GIG   L++T +     
Sbjct: 178 MFYADKTGASRFWGTDVVRVELLEILDMSFGVANVFNATEGVFGIGFPSLETTNMFNARI 237

Query: 229 ASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPML 288
               +Y+Y NFP AL +QG +D+ AYSLFLN+  A KGSVLFGAVDHSKY   L+TVP++
Sbjct: 238 DPYSSYEYANFPQALNNQGSVDKVAYSLFLNDSHAMKGSVLFGAVDHSKYRNDLFTVPLV 297

Query: 289 NMYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAG 348
           N +R++G+ +P  F+              +N  + +F  +LDSG T+S +P  L   +  
Sbjct: 298 NDFRDKGMDHPHYFNVFNARRGCPNKRRPQNRRHDEFIVVLDSGATVSSLPTKLVDQLVQ 357

Query: 349 AVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPL 408
           ++ A + +    Y+++CPS+ + +  +FD G F I                 C L + P 
Sbjct: 358 SLNATFDEELNSYTLKCPSKKDTSVASFDIGRFHIDGPLSNFVRKYEKNK--CILRLDPA 415

Query: 409 TSNAAIFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSSTW 468
            +   I  DNFL  AYVV+DLE+YEISM QA    +  QIE I   +P  VRA  Y  TW
Sbjct: 416 DNQPYILCDNFLSRAYVVHDLESYEISMGQANTEYAPEQIEAIKSKVPGTVRAPSYDKTW 475

>CAGL0E01771g Chr5 complement(175652..177211) [1560 bp, 519 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 519

 Score =  289 bits (739), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 167/425 (39%), Positives = 240/425 (56%), Gaps = 9/425 (2%)

Query: 49  KGNKPSAELRKRDDGYEEIE-IYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPEN 107
           K  K S EL KR D    I  + N    Y++++ +GTP QN+TV LDTGSSDLW  S  N
Sbjct: 23  KTPKISDELTKRADNDSFIAPLLNGGELYTVQIAVGTPPQNLTVQLDTGSSDLWFVSASN 82

Query: 108 PYCIDSDDTKPVXXXXXXXXXXX-XXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNT 166
           PYC ++    P                           ++C++YG F+ S S+++  N+T
Sbjct: 83  PYCKNNKKFAPKKQDLMPITSDDGFPTSPNQVPKALRNINCNKYGFFNASGSSTYSRNDT 142

Query: 167 AFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGV 226
            FS+SYGD TFASG WGTD   L  + V N++F +A+ SNST  V GIGL G +STY   
Sbjct: 143 NFSLSYGDETFASGPWGTDTISLNGVKVENVTFGLASFSNSTNPVFGIGLPGDESTYAMF 202

Query: 227 NSASSGA--YQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYT 284
           +  ++G    QY NFP+ LK QG ID+ AYS++LN   + +GS+LFGAVDHSKYSG LYT
Sbjct: 203 SEDTNGTTNTQYSNFPLQLKQQGKIDKVAYSIYLNSTKSKQGSILFGAVDHSKYSGPLYT 262

Query: 285 VPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQ 344
           +P++N + +  ++NP E +                L +   PALLD+GTT +YMP ++ Q
Sbjct: 263 LPIVNRFGHL-VENPYELEVTLSGLGLQRATSNITLFDQLLPALLDTGTTYTYMPSSVAQ 321

Query: 345 LIAGAVGAQYSQYTGYYSM-RCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYL 403
            +A        + T    + +CPS+ ++  + F+F G QI                 CYL
Sbjct: 322 YLANQTNGVIDKKTSLIKLAKCPSKKSNDTIVFNFSGAQIKIKMVDFVEKHKGK---CYL 378

Query: 404 GMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQG 463
             +   S+  + GD+F+ H Y V+DL++ EIS+AQA FN++   IE IS ++PSAV+A  
Sbjct: 379 PCVSQESSFFLLGDSFMRHVYTVFDLDDKEISIAQANFNSTKEDIEEISSTVPSAVKAPQ 438

Query: 464 YSSTW 468
           Y S++
Sbjct: 439 YYSSY 443

>Suva_9.13 Chr9 (14409..15803) [1395 bp, 464 aa] {ON} YIR039C (REAL)
          Length = 464

 Score =  286 bits (731), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 163/422 (38%), Positives = 231/422 (54%), Gaps = 8/422 (1%)

Query: 57  LRKRDDGYEE--IEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSD 114
           + KR + +    I +++  + Y +E+EIGTP Q     LDTGSSD+  +  ++ YC    
Sbjct: 45  ISKRSEAFNSTLINMFSSAHIYVVEMEIGTPPQAAYFQLDTGSSDMCANEADSSYCESFT 104

Query: 115 DTKPVXXXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGD 174
           D   +                           CS +GTF P+ S++F+ N T F+ISY D
Sbjct: 105 DESNIWTSNYELTATASEISSTATSSKAYNTPCSYWGTFSPNVSSTFKYNETIFNISYAD 164

Query: 175 TTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQST--YVGVNSASSG 232
             + +GT+GTD   LG++ ++N +F V+N +  + G++G+ L  ++ T       S+++ 
Sbjct: 165 NMYYAGTYGTDVVSLGNITLSNFTFGVSNDTKMSYGILGVSLPSVEETDDIEDALSSNTT 224

Query: 233 AYQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYR 292
            + YENFPMALKSQG I++ AYSLFLNEP A  GS+LFGAVD SKYSGQLYT+PML  Y 
Sbjct: 225 PFVYENFPMALKSQGKIEKIAYSLFLNEPSARFGSILFGAVDKSKYSGQLYTLPMLQAYN 284

Query: 293 NRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGA 352
                    F               + ++  QFP L DSGT+ S +P  +   I  +   
Sbjct: 285 TLDALYSGMFVTAQSAAIIDSKSGNKTVSEVQFPVLFDSGTSTSVLPTEIADAIGRSFDG 344

Query: 353 QYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTSNA 412
           +YS     Y   C S+ N+T+L+ DFGGF I                 C L ++P +   
Sbjct: 345 KYSSDDEGYIFDC-SKVNNTQLSIDFGGFNISANISNFVTPLTKDH--CVLQILP-SDTV 400

Query: 413 AIFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSSTWSTNQ 472
           ++ GD FLV  YVVYDLEN+E+S+AQA+FNN +  IE+ISDS+P A  A GYSSTW  N 
Sbjct: 401 SVLGDAFLVDTYVVYDLENHEVSVAQASFNNEEEDIEIISDSVPGATPAPGYSSTWRYNG 460

Query: 473 AI 474
            I
Sbjct: 461 YI 462

>SAKL0C02970g Chr3 (285647..287425) [1779 bp, 592 aa] {ON} some
           similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 592

 Score =  290 bits (741), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 178/475 (37%), Positives = 241/475 (50%), Gaps = 36/475 (7%)

Query: 24  VDEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKRDDGYEEIEIYNEQNFYSIELEIG 83
           ++ +  K+V + F K +G ++  +   NK    L KR D YE + +  ++  Y +EL +G
Sbjct: 21  IEPETSKHVSIPFKKAKGKTFSGSADSNKWRNRLSKRGDDYENLGLKTDKLAYYVELSLG 80

Query: 84  TPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXX---------------------- 121
           TP Q   V LDTGSSDLWV    NPYC+ S+ T                           
Sbjct: 81  TPGQKFEVQLDTGSSDLWVYDSHNPYCMPSETTHNEKVYGEAAYGETAFDQTALDQFETL 140

Query: 122 XXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGT 181
                                  +DC+ +GTF+ + S+SF +N+T F ISY D+T A G 
Sbjct: 141 LASATEDDPSYTQTEAVPSSEATIDCASFGTFNYTLSSSFSANDTEFYISYLDSTAAYGI 200

Query: 182 WGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNSASSGAYQYENFPM 241
           W  D   LGDL ++++ FAVA   +    V G+G  G +ST     S+    Y+Y NFP+
Sbjct: 201 WAQDVLKLGDLEISDMPFAVAVVGDVQTPVFGVGFPGTEST---AGSSVKEPYEYANFPV 257

Query: 242 ALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGI--QNP 299
            LKSQG + +  YSLFL+  D+  GS L GAVDHSKYSG LYT+PM +           P
Sbjct: 258 LLKSQGYVKKVVYSLFLDAQDSSSGSFLLGAVDHSKYSGGLYTLPMYSGTDGDDTLSSTP 317

Query: 300 IEFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTG 359
             F               + +  T+    LDSG+T +  P    +LIA ++GA YS    
Sbjct: 318 SRFIITLQGLGISDKGENKTVATTRSLVYLDSGSTGTVFPSEYAELIADSLGASYSGDYE 377

Query: 360 YYSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGM----IPLTSNAAIF 415
            Y M+CPS+++DT   +DFGGF I                 C L +    IP      + 
Sbjct: 378 AYVMKCPSKDDDTNFVYDFGGFTISSPLSNYMEATGDDS-VCVLDIDTDDIPYI----VL 432

Query: 416 GDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSSTWST 470
           GD FLV AYVVYDLE+YEIS+AQA ++     IEV+SDSIPSAV+A  YSSTWST
Sbjct: 433 GDAFLVSAYVVYDLEDYEISIAQANYDGGSENIEVVSDSIPSAVKAPFYSSTWST 487

>KAFR0I01700 Chr9 complement(346265..347923) [1659 bp, 552 aa] {ON} 
          Length = 552

 Score =  286 bits (733), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 172/491 (35%), Positives = 258/491 (52%), Gaps = 44/491 (8%)

Query: 6   AALISGFLLGSQAVALSDVDEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKRDDGYE 65
           A+L S  ++      LS       KY+ L F      ++E++ +       L+KRD  Y 
Sbjct: 16  ASLTSALIVDKNVEQLS---SNENKYLKLDF---ASETFEKSSR-----LPLQKRDT-YA 63

Query: 66  EIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYC---IDSDDTKPVXXX 122
            + I + + +Y ++L +GTP QNVT+L+DT SSD+WV+SP+NP C   I  D+ +     
Sbjct: 64  TVNI-SAEFYYVVQLSVGTPGQNVTLLVDTCSSDIWVTSPDNPLCDGDIFYDNVEKTAKH 122

Query: 123 XXXXXXXXXXXX-------------------XXXXXXXXXXVDCSEYGTFDPSKSTSFRS 163
                                                    VDC  +GTF+P+ S+++ +
Sbjct: 123 VVVAAAEESTVSDGDSNGLLDGEPVSTTPFESSVIYPAEGLVDCGFFGTFNPNDSSTWST 182

Query: 164 NNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTY 223
           N+T F I+Y D + A G WG D   +G L+++ + FAVAN +NS++GV+GIGL G ++TY
Sbjct: 183 NHTDFVITYSDNSTAEGVWGQDVLSIGGLDISGVPFAVANYTNSSLGVLGIGLPGSETTY 242

Query: 224 VGVNSASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLY 283
           +      + +Y Y+N PM LK  G+ID  AYSL L   +     +LFGAVDHSKYSG LY
Sbjct: 243 L------TNSYMYDNLPMVLKKSGVIDSAAYSLLLAAYNNYTSGLLFGAVDHSKYSGSLY 296

Query: 284 TVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLT 343
           T+PM+N+Y +RG ++P+EFD                +   + PALLDSG+T  + P TL 
Sbjct: 297 TIPMINIYESRGYESPVEFDVTIYGLGISSTDSNTTIATMKTPALLDSGSTAIFFPTTLL 356

Query: 344 QLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYL 403
            L A  + A YS+  G Y++  P    +    FDFGGF I                   L
Sbjct: 357 NLAAEQLNATYSEEKGLYTI--PYSPANISFVFDFGGFHINLPIRELCSVSYGEPEYI-L 413

Query: 404 GMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQG 463
            ++    N  + G+ FL  AYVV+D ENYEISM Q++++ ++  IE I  ++P AV+   
Sbjct: 414 NIVAHNENRIVLGEAFLARAYVVFDFENYEISMGQSSYDYAEEDIEAIISTVPGAVKVAS 473

Query: 464 YSSTWSTNQAI 474
           YS++WS+  +I
Sbjct: 474 YSNSWSSFGSI 484

>Suva_16.14 Chr16 (11240..12862) [1623 bp, 540 aa] {ON} YIR039C
           (REAL)
          Length = 540

 Score =  282 bits (722), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 176/478 (36%), Positives = 248/478 (51%), Gaps = 29/478 (6%)

Query: 1   MQLLPAALISGFLLGSQAVALSDVDEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELR-- 58
           MQL P   ++ FL  SQAV  S  +     YV L   KL           N P+  L+  
Sbjct: 1   MQLFPFLSLTLFLTYSQAVFGSSSN----SYVKLLVQKL----------ANIPNINLQGA 46

Query: 59  ----KRDDGYEE--IEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCID 112
               KR + +    I +++    Y +++EIGTP Q   + LDTGSSD+ ++  +  YC  
Sbjct: 47  SGISKRSEAFNSTLINMFSSAGMYVVKMEIGTPPQTAYLQLDTGSSDMCINEADAAYCES 106

Query: 113 SDDTKPVXXXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISY 172
             D   +                           CS +GTF P+ S++F+ N T F+++Y
Sbjct: 107 LADENNISTSNYELTATAIEILSTAAPSAAYNAPCSYWGTFSPNSSSTFKYNETIFNLTY 166

Query: 173 GDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNSASSG 232
           GD ++ +GT+GTD   LG++ ++N +F V+N + +  G++G+ L   + T    ++ SS 
Sbjct: 167 GDNSYYAGTYGTDVVSLGNITLSNFTFGVSNDTTNNGGILGVSLPSAEVTDDTEDALSSN 226

Query: 233 A--YQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNM 290
              + Y NFPMALKSQG I + AYSLFLNEP A  GS+LFGAVD S+YSGQLYT+PML  
Sbjct: 227 TTPFIYNNFPMALKSQGKIKKIAYSLFLNEPSARFGSILFGAVDKSEYSGQLYTLPMLQA 286

Query: 291 YRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAV 350
           Y      +   F               + ++  QFP L DSGT+ S +P  +   I  + 
Sbjct: 287 YNTLDATDAGMFVTAQSVAILDSKSGNKTVSEVQFPVLFDSGTSTSVLPTKIADAIGRSF 346

Query: 351 GAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTS 410
             +YS     Y   C   NN T L+FDFGGF I                 C L ++P + 
Sbjct: 347 DGKYSSDDQGYIFDCAKVNN-TLLSFDFGGFNISANISNFVTPAKDH---CILQILP-SD 401

Query: 411 NAAIFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSSTW 468
              + GD FLV  YVVYDLEN+E+S+AQA+F+N +  I +ISDS+P A  A GYSSTW
Sbjct: 402 TIFVLGDAFLVDTYVVYDLENHEVSVAQASFDNKEEDIGIISDSVPGATPAPGYSSTW 459

>CAGL0E01815g Chr5 complement(181154..182713) [1560 bp, 519 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 519

 Score =  280 bits (717), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 163/431 (37%), Positives = 248/431 (57%), Gaps = 15/431 (3%)

Query: 49  KGNKPSAELRKRDDGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENP 108
           K  K S++L KRDD Y  + + N+ + Y ++L +GTP QN+TV LDTGSSDLW  S +NP
Sbjct: 23  KSPKASSDLVKRDDEYVNVPLKNDGDLYLVQLAVGTPPQNITVQLDTGSSDLWFPSADNP 82

Query: 109 YCIDSDDTKPVXXXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAF 168
           +C ++    P                          ++C +YG F+ S+S++F+ N++ F
Sbjct: 83  FCKENKKYAPKGKDVQPLDDSGYPSASNQVPKSSRTLNCKKYGVFNSSESSTFKRNDSEF 142

Query: 169 SISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNS 228
            +SY D +FA+G WG+D     +LN++N++FA+ + +NS+ GV+G+GL  ++STY G  +
Sbjct: 143 LLSYADMSFATGNWGSDVVSFNELNISNVNFALGSFANSSNGVLGVGLPDVESTYDGPYA 202

Query: 229 AS----SGAYQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYT 284
            S    S ++QY NFP+ LK  G+ID+ AYSL+LN   +  GSVLFGAVDH++Y+G LYT
Sbjct: 203 GSRKNISDSHQYANFPITLKQNGVIDKIAYSLYLNSSKSKFGSVLFGAVDHNRYNGPLYT 262

Query: 285 VPMLN-MYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLT 343
           +P+ N +++N    +P + +                L + +  ALLDSGTTL+ +   + 
Sbjct: 263 LPLANSLFQN--FTDPFQLEITMNGLGLQGNDANITLYDKKSAALLDSGTTLTVVSKHIG 320

Query: 344 QLIAGAVGAQYSQYTGYYSM-RCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCY 402
            LIA  V    +       + +CPS+  + +L F+F G ++                 CY
Sbjct: 321 DLIAAQVNGTIAGKDQCIRLPKCPSKKENKKLIFNFSGAEV---AVDINQMMNKHKGKCY 377

Query: 403 L--GMIPLTSN-AAIFGDNFLVHAYVVYDLENYEISMAQAAFNNS-DSQIEVISDSIPSA 458
           L   +   TSN A IFGDNFL   Y+VY+LE+ EIS+A A FN+S    IE I  ++PSA
Sbjct: 378 LQFAVHEDTSNDAIIFGDNFLRSVYLVYNLEDKEISIAPANFNSSLPENIEPIKSTVPSA 437

Query: 459 VRAQGYSSTWS 469
           +RA  Y +T+S
Sbjct: 438 IRAPQYYNTYS 448

>Kwal_56.23902 s56 complement(767431..769320) [1890 bp, 629 aa] {ON}
           YLR120C (YPS1) - GPI-anchored aspartic protease [contig
           171] FULL
          Length = 629

 Score =  283 bits (724), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 154/330 (46%), Positives = 197/330 (59%), Gaps = 5/330 (1%)

Query: 145 VDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQ 204
           + CSEYGTF    S+SF+SN T F I YGD ++A G WG D+  L D+ V+++S AVAN 
Sbjct: 194 ISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANI 253

Query: 205 SNSTVGVMGIGLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDAD 264
           SNST GV+GIGL GL+ T     S S  AY Y+NFP  L  QG I ++AYSLF+N+ +A 
Sbjct: 254 SNSTFGVLGIGLPGLEVTNALAESPSD-AYTYKNFPAMLVDQGKIRKSAYSLFVNDLNAT 312

Query: 265 KGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQ 324
            GSVLFGAVDHSKY+G L T+P++N  ++  +  PI+FD                +T T 
Sbjct: 313 HGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHGLGITLNDTNTTITTTP 372

Query: 325 FPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIX 384
           FPALLDSGTT +++P  L   IA  + A+Y    G+Y  +C   ++   L FDFGGF I 
Sbjct: 373 FPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIK 432

Query: 385 XXXXXXXXXX----XXXXXTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAA 440
                               C L +IP      I GDNFL  AYVVYDLEN EISMAQA 
Sbjct: 433 SKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQAN 492

Query: 441 FNNSDSQIEVISDSIPSAVRAQGYSSTWST 470
            +     IE I  ++PSAV+A GYSSTW++
Sbjct: 493 LDGGSEDIEEIVSTVPSAVKAPGYSSTWTS 522

 Score = 97.8 bits (242), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 64/102 (62%)

Query: 9   ISGFLLGSQAVALSDVDEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKRDDGYEEIE 68
           ++G +  +   A +   +   K+V LSFDKLRG+  E A  G  P  +  KRDDG    E
Sbjct: 12  LAGLVSSTAISAEAKYSQDESKFVKLSFDKLRGDLVENARAGQIPRVKRVKRDDGTASFE 71

Query: 69  IYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYC 110
           I N+  FYS+ + +G+P+Q+VT+L+DTGSSD+WV    NPYC
Sbjct: 72  IDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYC 113

>CAGL0E01793g Chr5 complement(178411..179961) [1551 bp, 516 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 516

 Score =  275 bits (703), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 163/429 (37%), Positives = 238/429 (55%), Gaps = 11/429 (2%)

Query: 53  PSAE-LRKRDDGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCI 111
           PSA  L KR D    + + N+ + Y ++L +GTP Q V+V LDTGS+DLW S  +NPYC 
Sbjct: 25  PSASVLEKRADDLSPVPLRNDVDQYIVQLAVGTPPQMVSVQLDTGSADLWFSGADNPYCK 84

Query: 112 DSDDTKPVXXXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSIS 171
            +    P                          +DC +YG F+ S S++F++N+T   + 
Sbjct: 85  TNKKKAPKSKDLQPVDNSGFPTNPDQIGKKARNLDCKKYGFFNMSSSSTFKNNDTDIFLY 144

Query: 172 YGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNSASS 231
           Y D +F  GTWGTD   LG LN++ ++FAVA  SNS+ GV+G+ L   +STY   ++ ++
Sbjct: 145 YEDLSFVRGTWGTDVVSLGGLNISGVNFAVAEISNSSSGVLGVSLPSEESTYSINSNGTT 204

Query: 232 GA--YQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLN 289
            A  YQY N P+ LK QGIID+  YS++LN+  +  GS+LFGAVDHSKY+G LYT+P++N
Sbjct: 205 NATNYQYSNLPLQLKEQGIIDKVTYSIYLNDTKSKYGSILFGAVDHSKYTGTLYTLPLVN 264

Query: 290 MYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGA 349
              +  +  P E D                L + +  AL+DSGTT+S  P  + +++A  
Sbjct: 265 SEYDV-VNKPYELDITLNGIGYQSMSSNMTLYDQKVAALIDSGTTISEFPDEIVEVVAKQ 323

Query: 350 VGAQYS-QYTGYYSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIP- 407
           + A       G    +CPS+ ++ +L F+ GG  I                 CYL +IP 
Sbjct: 324 MNATVDPNGNGIRLAKCPSKKDNAKLLFNLGGALI---YVDIKEFTTKVKGKCYLEIIPS 380

Query: 408 -LTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAFNNS-DSQIEVISDSIPSAVRAQGYS 465
              S+  I GDNF+   Y V+DLE  E+S+AQA FN+S  +QIE I  ++PSAV+A  Y 
Sbjct: 381 GAESDLVILGDNFMRSVYTVFDLEANEVSIAQANFNSSLPAQIEEIKSTVPSAVKAPQYY 440

Query: 466 STWSTNQAI 474
           +T+S   +I
Sbjct: 441 NTFSAIASI 449

>CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 482

 Score =  270 bits (689), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 156/419 (37%), Positives = 225/419 (53%), Gaps = 11/419 (2%)

Query: 57  LRKRDDGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDT 116
           L KRDD   ++E+ N    Y+++L +GTP QN+TV LDTGSSDLW +S  NPYC ++   
Sbjct: 31  LNKRDDKGLQLELENGGLLYAVQLSVGTPPQNITVQLDTGSSDLWFTSEANPYCKNNRKH 90

Query: 117 KPVXXXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTT 176
            P                          +DC  +G F+ SKS+++++N T F++SY DTT
Sbjct: 91  SPKKSQIEPLNDADYPTSPNQIPKSLRDIDCKAFGFFNTSKSSTYKNNGTNFTLSYADTT 150

Query: 177 FASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQST-YVGVNSASSG--A 233
           FASG WG D      + V N++F +A  SNST  V GI L   ++T  +  N +  G  +
Sbjct: 151 FASGPWGVDTLSFNGVKVDNVTFGLAAFSNSTTPVFGISLPARETTNQLAANGSRIGPNS 210

Query: 234 YQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLN-MYR 292
           Y+Y NFPM LK QGI+ + AYS++LN+  +  GS+LFGAVD SKY G LYT+P++N +Y+
Sbjct: 211 YEYSNFPMLLKEQGIVKKIAYSVYLNDTRSKYGSILFGAVDQSKYIGTLYTLPLVNSLYK 270

Query: 293 NRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGA 352
              +  P +F+                L + +   LLD+G T S +P  +  L+A  V  
Sbjct: 271 Q--VSKPFQFEITLNGIGLQTADKNYTLYDQKLATLLDTGVTTSVLPAKVAALVASKVNG 328

Query: 353 QYSQYTGYYSM-RCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTS- 410
                 G+  + +CP++     + F+FGG +I                 CYL M      
Sbjct: 329 TIDDDNGFIKLDKCPNKKEKRTVVFNFGGAEISIDIRDLTRKIKGK---CYLQMQARDDI 385

Query: 411 NAAIFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSSTWS 469
             A  GD FL H YVVY+LE+ EIS+A A FN S   I+ I  ++P AV+A  Y +T+S
Sbjct: 386 EFAALGDIFLRHVYVVYNLEDEEISIANANFNYSTPDIQEIVSTVPGAVKAPQYYNTYS 444

>CAGL0E01881g Chr5 (188277..189803) [1527 bp, 508 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
          Length = 508

 Score =  268 bits (684), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 162/458 (35%), Positives = 243/458 (53%), Gaps = 30/458 (6%)

Query: 31  YVHLSFDKLRGNSYEEAGKGNKPSAELRKRDDGYEEIEIYNEQNFYSIELEIGTPSQNVT 90
           Y+ L F K+  NS              ++ DD Y  +++ NEQ FY +E+ IG+  QN+T
Sbjct: 15  YLRLPFTKITDNSLA------------KRADDDYLNVQLDNEQIFYGVEVSIGSDKQNMT 62

Query: 91  VLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXXXX---XXXXXXXXXXXXVDC 147
           +L+DTGSSD WV   +NPYC  +   KP                              DC
Sbjct: 63  LLVDTGSSDFWVLGAQNPYCKSNRGKKPKKKDQPSSVDPGRNGYPTKAEAIPYAERTFDC 122

Query: 148 SEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNS 207
           S++ TF+ S S +F+SN+T F I+YGD ++  GTWGTD   L    + N++FAVA  +N+
Sbjct: 123 SDFKTFNSSSSNTFKSNDTDFFITYGDGSYVEGTWGTDQVALAGQTLENVTFAVAELTNN 182

Query: 208 TVGVMGIGLAGLQS-----TYVGVNSASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPD 262
           + G++GIGL  L+S     T    N++S     Y NFP +LK   +I++  YS++LN  +
Sbjct: 183 SYGLLGIGLPELESSITIDTAQLTNTSSVKKNPYMNFPESLKLNKLINKVVYSIYLNRTN 242

Query: 263 ADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNP----IEFDXXXXXXXXXXXXXIR 318
              GS+LFGAVDH++Y G L TVP++   R+ G   P    +  +             I 
Sbjct: 243 DKFGSILFGAVDHNRYDGNLTTVPLVFSNRDFGTPRPNELMVTLNGMSFEATDGNVTQIL 302

Query: 319 NLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSM-RCPSENNDTRLNFD 377
           N T ++FPALLD+G+T +++P  +   +A +    Y Q      + +C S+ + T LNF 
Sbjct: 303 NAT-SKFPALLDTGSTDTHLPVDVYNALAESTNGTYDQTQNKIRIPKCLSKKDKTILNFS 361

Query: 378 FGGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMA 437
            GG  I                 CY+ + P  S+ AI GD+ + +AY+V+DLE+ EIS+A
Sbjct: 362 LGGVNIGVPYKEMVKKIKGK---CYINVAPTGSDFAILGDDVIRYAYMVFDLEDREISLA 418

Query: 438 QAAFNNS-DSQIEVISDSIPSAVRAQGYSSTWSTNQAI 474
           QA+FN++    IEV+  +IP A RA  YS T+S   A+
Sbjct: 419 QASFNDTLPEDIEVVVSTIPGATRASAYSETYSPTFAV 456

>CAGL0E01859g Chr5 complement(185870..187387) [1518 bp, 505 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7
          Length = 505

 Score =  266 bits (681), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 161/449 (35%), Positives = 235/449 (52%), Gaps = 30/449 (6%)

Query: 31  YVHLSFDKLRGNSYEEAGKGNKPSAELRKRDDGYEEIEIYNEQN--FYSIELEIGTPSQN 88
           YV L F+K  G+             +L KRD   +++++ N Q    Y+I+L +GTP QN
Sbjct: 14  YVALDFEKSHGD-------------DLVKRD--VQDVKLINSQKAMLYNIQLSVGTPPQN 58

Query: 89  VTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXXXXXXXXXXXXXXXXVDCS 148
           +T  LDTGSSDLW     NPYC  +    P                          +DC+
Sbjct: 59  ITAQLDTGSSDLWFPDSTNPYCKANKKQAP--KSIASLDAGTRPTSPAQVPKSLRNLDCA 116

Query: 149 EYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNST 208
           E+G F+ S ST+F SN T F ISY D+++A G W TDN  L  LN++ L+F +A  SNS+
Sbjct: 117 EFGLFNSSASTTFNSNKTEFFISYLDSSYAEGVWATDNLYLNGLNISGLNFGLAYFSNSS 176

Query: 209 VGVMGIGLAGLQSTY-VGVNSASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDADKGS 267
             V+G+GL  L+++Y   +    S  +QY NFP  LK +G I +  YSL+LN+  +  G 
Sbjct: 177 NSVLGVGLTPLEASYDTDIKQDDSPRFQYPNFPQILKQKGAISKVTYSLYLNDTKSKYGQ 236

Query: 268 VLFGAVDHSKYSGQLYTVPMLN--MYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQF 325
           +LFG VDHSKY GQLYT+P++N    ++ G+   +E                  L   + 
Sbjct: 237 ILFGGVDHSKYVGQLYTIPLVNSKYQKSPGVIADLEVTLNGLGIRDNTTNTNTTLYTQKL 296

Query: 326 PALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSM-RCPSENNDTRLNFDFGGFQIX 384
           PAL DSGT+ SY+PYT+ Q+IA  V       T    + +CPS+ +   + F+F G +I 
Sbjct: 297 PALFDSGTSYSYVPYTMAQVIASQVNGTIDNKTEAIRLPKCPSKKDTREVVFNFNGVEI- 355

Query: 385 XXXXXXXXXXXXXXXTCYLGMI---PLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAF 441
                           CYL ++   P      + GD FL   Y V+DLE  E+S+A+A F
Sbjct: 356 --AIPLKQFYQKKSGKCYLDLMVAPPNNGPGLLLGDTFLRQVYTVFDLEAQELSIARANF 413

Query: 442 NNS-DSQIEVISDSIPSAVRAQGYSSTWS 469
           N+S  + +E I  ++PSA++A  Y +T+S
Sbjct: 414 NSSLPADVEEIKSTVPSAIKAPQYYNTFS 442

>KAFR0B06700 Chr2 complement(1396587..1398182) [1596 bp, 531 aa]
           {ON} 
          Length = 531

 Score =  267 bits (683), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 177/446 (39%), Positives = 243/446 (54%), Gaps = 47/446 (10%)

Query: 25  DEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKRDDGYEEIEIYNEQNFYSIELEIGT 84
           +E    +V ++F++L G S + A   +K S    KR + YE++ + NE  FYS++L IG+
Sbjct: 25  EESSSGFVSMNFNRLYGASPDTAV--SKRSMSHIKRSENYEQVRLKNEACFYSMDLAIGS 82

Query: 85  PSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXXXXXXXXXXXXXXXX 144
             QNVTVL+DTGSSDLWV  P++                                     
Sbjct: 83  NHQNVTVLVDTGSSDLWVPGPDS------------------------------------- 105

Query: 145 VDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQ 204
              + YG F P  STS + N T FS  Y D T A G W  D   LGD  V+N++FAV N 
Sbjct: 106 --SASYGVFSPKDSTSLKFNGTEFSTQYADGTTAYGEWCYDTVALGDTTVSNVTFAVVND 163

Query: 205 SNSTVGVMGIGLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDAD 264
           ++S  GV+G+GL GL++TY    +A S  YQY+NFP+ L  QG+I  NAYSL+LN+ DA 
Sbjct: 164 TDSNFGVLGLGLTGLEATYT---NALSSPYQYDNFPVKLVRQGLIQANAYSLYLNKADAS 220

Query: 265 KGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQ 324
            G+VLFGAVDH+KY+G L+T+P +N   + G  + IEF                 LT ++
Sbjct: 221 SGNVLFGAVDHAKYTGTLHTIPFVNTLESLGYNSVIEFHVTLDGMDLSTNDGQTTLTTSK 280

Query: 325 FPALLDSGTTLSYMPYTLTQLIAGAVGAQYS-QYTGYYSMRCPSENNDTRLNFDFGGFQI 383
           FP L+DSG T SY+P  L Q IA  +GA YS +Y GY  + CPSE++DT ++++FGGF I
Sbjct: 281 FPVLVDSGNTFSYLPDNLLQQIASQIGATYSNEYVGYV-LTCPSEDDDTVISYNFGGFNI 339

Query: 384 XXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAFNN 443
                           TC L + P  S     GD FL + Y         +S+AQA + +
Sbjct: 340 DTPLSGSVTELGDDSNTCILMIAPSGSEFGQLGDTFLENVYASSTWTIESLSLAQAQYTD 399

Query: 444 SDSQIEVISDSIPSAVRAQGYSSTWS 469
              +IE+IS SIP A++A GYS  WS
Sbjct: 400 E-EEIEIISSSIPGAIKAAGYSDIWS 424

>KNAG0I01200 Chr9 (226271..228304) [2034 bp, 677 aa] {ON} 
          Length = 677

 Score =  268 bits (684), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 163/432 (37%), Positives = 229/432 (53%), Gaps = 44/432 (10%)

Query: 49  KGNKPSAELRKRDDGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENP 108
           K  + S +L +R+DG + + +  +  FYSI+L IGTPSQ VTVLLDTGSSDLWV+   NP
Sbjct: 25  KRVRQSPQLVRREDG-DSVHLGKQTGFYSIDLAIGTPSQKVTVLLDTGSSDLWVTGANNP 83

Query: 109 YCIDSDDTKPVXXXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAF 168
           YC  S                                +C EYGTFD  +S++F+  N+A 
Sbjct: 84  YCQTS-----------------------------LSSECKEYGTFDYGQSSTFQDRNSAL 114

Query: 169 SISYGDTTFASGTWGTDNFDL--GDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTY-VG 225
            I+Y D T   G WG D  +L  G + + N    VA+ S+S  GV+G+G  GL++T  V 
Sbjct: 115 KINYQDGTKVDGRWGVDTLELNNGAIQLQNTMIGVADSSDSVAGVIGLGFPGLETTNNVQ 174

Query: 226 VNSASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTV 285
            N  S   Y Y NFPM LK QG+ D   +++ L+  ++  G +LFGAVD  KY G LYT+
Sbjct: 175 ANGES---YTYANFPMQLKQQGVTDATVFAIALD--NSYGGDILFGAVDEGKYIGGLYTL 229

Query: 286 PMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIR-NLTNTQFPALLDSGTTLSYMPYTLTQ 344
           P++N   +RG   PI  +              +   ++T   AL+DSG+T+ Y+P  +  
Sbjct: 230 PVVN---SRGTATPIRMEVTLQGIGVDSDGGDQETFSSTPMLALVDSGSTMVYLPELIAT 286

Query: 345 LIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXXXXXX-XXXXXXXXXXTCYL 403
            I   VGA+Y   +  Y++ C +   +  L FDFGGF I                  C  
Sbjct: 287 AIYNKVGARYDGSSEMYTIDCGTNVENDNLIFDFGGFHISTPVSNYIITDQRSSNGQCLF 346

Query: 404 GMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQI-EVISDSIPSAVRAQ 462
           G++  + N  + GD FL  AYVV+DL++YEISMAQ   NN D  + +V S +IP+A +A 
Sbjct: 347 GILSQSGNTVVLGDTFLSSAYVVFDLDHYEISMAQGNSNNGDGNVKDVTSGTIPNARKAP 406

Query: 463 GYSSTWSTNQAI 474
            YS TWSTN  +
Sbjct: 407 MYSQTWSTNAPV 418

>YIR039C Chr9 complement(430498..432111) [1614 bp, 537 aa] {ON}
           YPS6Putative GPI-anchored aspartic protease, member of
           the yapsin family of proteases involved in cell wall
           growth and maintenance
          Length = 537

 Score =  258 bits (658), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 161/405 (39%), Positives = 224/405 (55%), Gaps = 12/405 (2%)

Query: 69  IYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCID-SDDTKPVXXXXXXXX 127
           + N    Y +++EIGTP Q + + LDTGSSD+ V++ +  YC   SD +           
Sbjct: 60  VINGIGVYVVKMEIGTPPQTLYLQLDTGSSDMIVNNADIAYCKSMSDGSDYASTDNYELT 119

Query: 128 XXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNF 187
                              CS +GTFD S S++F +N T F+ +YGD T+ +GT+GTD  
Sbjct: 120 ATFNGLPSTTISSEAYNTLCSYWGTFDASNSSTFENNATFFNNTYGDGTYYAGTYGTDVV 179

Query: 188 DLGDLNVTNLSFAVANQS-NSTVGVMGIGLAGLQSTYVGVNSA---SSGAYQYENFPMAL 243
              ++ + + +F V+N +  +  G++GI L   + T  G+  A   +   + Y+NFPM L
Sbjct: 180 SFENITLNDFTFGVSNDTIGNPSGILGISLPIAEFT-DGIEYALALNRTPFIYDNFPMEL 238

Query: 244 KSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFD 303
           K+QG I++ AYSLFLN PDA  GS+LFGAVD SKY+GQLYT+PML  +   G  NP    
Sbjct: 239 KNQGKINKIAYSLFLNGPDAHFGSILFGAVDKSKYTGQLYTLPMLQAFNTLG-SNPGMII 297

Query: 304 XXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSM 363
                         + +++ QFP +LDSGTT SY+P  + + I  +   +YS     Y  
Sbjct: 298 TAQSVAILDSESGNKTVSDIQFPVMLDSGTTFSYLPTEIAEAIGKSFDGEYSSDDQGYIF 357

Query: 364 RCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHA 423
            C S+ NDT L+ DFGGF I                 C L  +  + +  + GD FLV A
Sbjct: 358 DC-SKVNDTLLSVDFGGFNISANISNFVTSAKDR---CVLN-VKQSESTYMLGDAFLVDA 412

Query: 424 YVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSSTW 468
           YVVYDLENYEIS+AQA+FNN +  IEVISD++P A  A GY STW
Sbjct: 413 YVVYDLENYEISIAQASFNNQEEDIEVISDTVPGATPAPGYFSTW 457

>CAGL0E01837g Chr5 complement(183237..184802) [1566 bp, 521 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3
          Length = 521

 Score =  252 bits (643), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 155/446 (34%), Positives = 239/446 (53%), Gaps = 23/446 (5%)

Query: 31  YVHLSFDKLRGNSYEEAGKGNKPSAELRKRDD-GYEEIEIYNEQNFYSIELEIGTPSQNV 89
           YV L F K              P ++L KRD    E  ++  +++ Y +E+ +GTP Q V
Sbjct: 17  YVKLDFTK-------------TPGSDLAKRDVVDPEAAQLTFDKDQYIVEVAVGTPPQKV 63

Query: 90  TVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXXXXXXXXXXXXXXXXVDCSE 149
            + +DTGSSDL+V    NPYC ++ +                             +DC +
Sbjct: 64  LLQIDTGSSDLFVIEESNPYCKNNKNKA-PKKKDLESPGDDYPRTPNQVPKSDRTLDCKK 122

Query: 150 YGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTV 209
           YG ++ ++S++F SN T   I+YGD  F  GTWGTD+  +G+LN++NLS  V+  +N++ 
Sbjct: 123 YGFYNRNESSTFNSNGTDLFITYGDNGFVRGTWGTDSVSVGNLNLSNLSIGVSPMTNTST 182

Query: 210 GVMGIGLAGLQSTY-VGVNSASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSV 268
           G++G+GL G +ST+    N      YQY NFP+ LK +G+I++ AYS++LNE  +  GS+
Sbjct: 183 GILGVGLPGEESTFNYSSNVTGPSNYQYSNFPIRLKEEGLIEKIAYSIYLNETGSKYGSI 242

Query: 269 LFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQFPAL 328
           LFGAVDHSKY G LYT P++N     G  +P +F+                L + + P L
Sbjct: 243 LFGAVDHSKYQGPLYTFPLVNSKYKEG-SDPFQFEITMNGVGLVGKTDNITLYDQKLPTL 301

Query: 329 LDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSM-RCPSENNDTRLNFDFGGFQIXXXX 387
           LDSG+T+S +P  +  L+A  V            + +CPS+ ++ +L F+F G +     
Sbjct: 302 LDSGSTISLLPRDVADLVAQQVNGTVDGKGNCIKLPKCPSKKDNQKLIFNFSGAEF---S 358

Query: 388 XXXXXXXXXXXXTCYLGMIPLTS-NAAIFGDNFLVHAYVVYDLENYEISMAQAAFNNS-D 445
                        CYL    L   N A+ GDNF+ + Y V++L++ E+S+AQA +N+S  
Sbjct: 359 VNVTDFMEKHKGKCYLQFSALDGINFALLGDNFMNNVYTVFNLDDKELSLAQANYNSSLK 418

Query: 446 SQIEVISDSIPSAVRAQGYSSTWSTN 471
             IE I D++PSAV A  Y +T+S +
Sbjct: 419 PDIEEIKDTVPSAVLAPQYYNTFSAD 444

>CAGL0E01419g Chr5 (132904..134679) [1776 bp, 591 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
          Length = 591

 Score =  252 bits (643), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 139/343 (40%), Positives = 202/343 (58%), Gaps = 20/343 (5%)

Query: 145 VDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQ 204
           +DC     FD  KS+SF+SN+T F  SYGD ++ASG WGTD+  LG+L++ ++ FAVAN 
Sbjct: 167 LDCQSLSLFDLEKSSSFKSNSTPFFTSYGDNSYASGLWGTDDVRLGNLSIADVFFAVANF 226

Query: 205 SNSTVGVMGIGLAGLQ------------STYVGVNSASS-----GAYQYENFPMALKSQG 247
           SNS+ GV+G+GL  L+            S Y+ VN++ +         Y NFP  LK + 
Sbjct: 227 SNSSTGVLGVGLPALESYNPALSDNFNVSDYLPVNASDADIDNISKPTYANFPQILKQKN 286

Query: 248 IIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXX 307
           +I++ AYSLFLN+ +A  G +LFGAVDHSKY+G L T+P++N     GI +  + +    
Sbjct: 287 VIEKVAYSLFLNDTNATNGQILFGAVDHSKYTGSLSTLPLVNSLYVEGINDTTQLEITLD 346

Query: 308 XXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMR-CP 366
                       + N + PALLDSGTT+SY+P  L  L+A  +       TG+  ++ CP
Sbjct: 347 GMGLKNSQGQFTIYNQKMPALLDSGTTVSYLPIDLHSLVAKQLKGIVDPQTGFIELKNCP 406

Query: 367 SENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAYVV 426
           ++N++T+L F+FGG  I                 CY+  +P      + GDNFL +AY+V
Sbjct: 407 AKNDNTQLVFNFGGAFI--SIKYTEFIEKSDDDNCYVTFMPQGEPGILLGDNFLRNAYIV 464

Query: 427 YDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSSTWS 469
           YDLE+ EIS+AQA FN     IE I  ++PSAV+A GYS++++
Sbjct: 465 YDLEDMEISIAQANFNGGAENIEAIVKNVPSAVKAPGYSASFT 507

 Score = 82.0 bits (201), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 68/116 (58%), Gaps = 11/116 (9%)

Query: 1   MQLLPAALISGFLLGSQAVALSDVDEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKR 60
           M+L   AL++G +    AVA         KY+ L F+K R +  EE    +  + +LRKR
Sbjct: 1   MKLKNVALVAGCV---NAVAAE-------KYLKLDFEKHRADIDEELPLTHSAARQLRKR 50

Query: 61  -DDGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDD 115
             D      +  ++N+YSI LE+GTP QNV++LLDTGSSD+WV    N YC +SD+
Sbjct: 51  ASDDSVAFPLVAQENYYSINLEVGTPPQNVSLLLDTGSSDMWVIGSNNGYCKNSDN 106

>NCAS0A12460 Chr1 complement(2461028..2462650) [1623 bp, 540 aa]
           {ON} Anc_7.182
          Length = 540

 Score =  242 bits (617), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 159/425 (37%), Positives = 221/425 (52%), Gaps = 32/425 (7%)

Query: 58  RKRDDGYEEIEIYN-EQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDT 116
           R    G+ EIE+ + EQ +Y+  LEIGTP QN+TVL D+GSSDLWV    NPYC      
Sbjct: 43  RNSGSGHLEIELQHIEQTYYATTLEIGTPPQNLTVLFDSGSSDLWVMDASNPYC------ 96

Query: 117 KPVXXXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTA-FSISYGDT 175
                                       +DCS + TF+ S S+SF++  T+ F   Y D 
Sbjct: 97  --------ESQYTGSQTYNGSSINQASTIDCSSFMTFNKSLSSSFKTKGTSRFYAYYSDK 148

Query: 176 TFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTV-GVMGIGLAGLQSTYVGVNSASSGAY 234
           TFA G+W T+   +  ++V++L F + N   + V GV+GIG    +S   G ++A +  Y
Sbjct: 149 TFADGSWATEKLTMNGVDVSSLQFGLGNCVTTPVSGVLGIGFPRRESVK-GYDNAPNEFY 207

Query: 235 QYENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNR 294
              NFP  LK+QGIID  AYS+FLN+ ++D GS+LFGA+D SKY+G L T PMLN+Y + 
Sbjct: 208 --PNFPQVLKNQGIIDVVAYSMFLNKLESDTGSILFGAIDTSKYTGDLVTFPMLNIYPDV 265

Query: 295 GIQNPIEFDXXXXXXXXXXXXXIR--NLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGA 352
               P                  +      ++ P LLDSGTTL   P  +  ++A  + A
Sbjct: 266 -TDKPATLMVILQGLGAQDNANCKAETFVTSKIPVLLDSGTTLMGAPKEIADMMADFMNA 324

Query: 353 QYSQYTGYYSMRCPSENN--DTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTS 410
            +S+  G Y M CP++    +T   FDFGG QI                 C   ++P  S
Sbjct: 325 TFSEDEGIYIMECPTKETLANTDYIFDFGGVQIKVPLSNFILSAQSEGGPCGFAVLPDDS 384

Query: 411 NAAIFGDNFLVHAYVVYDLENYEISMAQAAFNNS----DSQIEVISD-SIPSAVRAQGYS 465
           N  + GD FL  AYVV+DL+NY+IS+A A  +N+    DS I + SD +IP+A  A    
Sbjct: 385 NTMVLGDIFLSSAYVVFDLDNYQISLAAANLDNNVSLEDSIINIPSDGNIPNAKMAT--V 442

Query: 466 STWST 470
             WST
Sbjct: 443 DPWST 447

>Smik_65.1 Chr65 (2..1027) [1026 bp, 342 aa] {ON} YIR039C (REAL)
          Length = 342

 Score =  236 bits (601), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 131/305 (42%), Positives = 180/305 (59%), Gaps = 5/305 (1%)

Query: 164 NNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTY 223
           N+T F  +YGD T+  GT+GTD   LG++ + + SF VAN + +  G++GI L   ++T+
Sbjct: 1   NDTQFDETYGDGTYYRGTYGTDVVSLGNITLESFSFGVANNTENQGGILGISLPAGENTH 60

Query: 224 VGVNSASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLY 283
               + ++  ++YENFPMALKS G I++ AYSLFLNEP A  GS+LFGAVD SKYSGQLY
Sbjct: 61  SLGGAYNTTPFEYENFPMALKSHGKIEKIAYSLFLNEPKAHFGSILFGAVDKSKYSGQLY 120

Query: 284 TVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLT 343
           T+PML  Y      +P  F               + ++  +FP L DSGTT S +P  + 
Sbjct: 121 TLPMLQAYDTLDSVSPGMFVTAQSVAVLNGDSGNKTVSKVRFPVLFDSGTTYSSLPTEVA 180

Query: 344 QLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYL 403
             I  +   +YS     Y+  C S+  DT L+ DFGGF I                 C L
Sbjct: 181 HAIGKSFDGKYSSGDQGYTFDC-SKVKDTLLSIDFGGFNISANISNFVTRTKDH---CLL 236

Query: 404 GMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQG 463
             I    +  + GD FLV AYVV+DLE++E+S+AQA+F++   +IEVISD +P A+RA G
Sbjct: 237 N-IEAADSGFVLGDAFLVDAYVVFDLESHEVSIAQASFDDKKEEIEVISDRVPGAIRAPG 295

Query: 464 YSSTW 468
           YSSTW
Sbjct: 296 YSSTW 300

>ZYRO0F10296g Chr6 complement(833615..835201) [1587 bp, 528 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 528

 Score =  241 bits (614), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 140/328 (42%), Positives = 185/328 (56%), Gaps = 7/328 (2%)

Query: 146 DCSEYGTFDPSKSTSFRSNNT-AFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQ 204
           +C+    F+   S +F  N T  + I Y D ++ASG WGTD+  LGDL V N+SFAVAN 
Sbjct: 191 NCNATAFFEADNSKTFHRNRTDPYYIQYEDLSYASGYWGTDDLQLGDLQVHNVSFAVAND 250

Query: 205 SNSTVGVMGIGLAGLQSTY--VGVNSASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPD 262
           +NST  V GIG  G +S++  VG    ++  ++Y NFP  LK+QGII R AYSL+LN P+
Sbjct: 251 TNSTTPVFGIGFPGGESSFASVGPEYRAAHPHEYANFPQTLKNQGIIQRVAYSLYLNSPN 310

Query: 263 ADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTN 322
           +  G+VLFG VDHS+Y GQLYT+P+L +       +P                  ++   
Sbjct: 311 STYGNVLFGGVDHSQYQGQLYTLPILQLGNLTSDGDPYNTLAITLQGVSVTRRGSKHKVK 370

Query: 323 TQ-FPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGF 381
           T+  P +LDSGTT  Y+PY L + IA             Y + CP   ++  + FDFGG 
Sbjct: 371 TKPIPVVLDSGTTAMYLPYKLAKSIASRYHGILGPEDQGYIIDCPKSGDNDYITFDFGGV 430

Query: 382 QIXXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAF 441
            I                 C LG+IP +   A+FGD FL  AYVVYDLE  EIS+AQA+F
Sbjct: 431 TI--KTDIRNYIFEQSENKCLLGIIPNSDILAVFGDVFLTDAYVVYDLEGKEISLAQASF 488

Query: 442 NNSDSQIEVISDS-IPSAVRAQGYSSTW 468
           N+S  QIE I+ S +P A RA GYS TW
Sbjct: 489 NSSSEQIEAITSSGVPGAKRAPGYSKTW 516

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 50/84 (59%), Gaps = 3/84 (3%)

Query: 34  LSFDKLRGNSYEEAGKGNKPSAELRKRD--DGYEEIEIYNEQN-FYSIELEIGTPSQNVT 90
           + F+K+ G S+ EA    K     R ++  D  +E+ + N  N +YS+ + +GTP QN+T
Sbjct: 34  IGFNKVYGKSFSEATADRKYVNLFRNKNISDDNDEVALQNNANTYYSVNISLGTPGQNMT 93

Query: 91  VLLDTGSSDLWVSSPENPYCIDSD 114
           + LDTGSSDLWV  P    C D+D
Sbjct: 94  IQLDTGSSDLWVIKPGGLQCTDND 117

>Suva_34.1 Chr34 complement(13..1176) [1164 bp, 387 aa] {ON} YIR039C
           (REAL)
          Length = 387

 Score =  233 bits (594), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 131/310 (42%), Positives = 182/310 (58%), Gaps = 6/310 (1%)

Query: 161 FRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQ 220
           F+ N T F+I+Y D ++ +GT+GTD   LGD+ ++N +F V+N +    G++GI L   +
Sbjct: 1   FKYNETIFNITYDDNSYYAGTFGTDIVSLGDITLSNFTFGVSNDTTINGGILGISLPSAE 60

Query: 221 STYVGVNSASSGA--YQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKY 278
            T  G  + SS    + Y+NFPMALK+QG I++ AYSLFLNEP+A  GS+LFGAVD SKY
Sbjct: 61  ITDSGQGALSSNTTPFAYDNFPMALKNQGKIEKIAYSLFLNEPNARFGSILFGAVDKSKY 120

Query: 279 SGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYM 338
           +GQLYT+PML  Y                          + ++  QFP L DSGT+ S +
Sbjct: 121 TGQLYTLPMLQAYNTLDALGGGMLVTAQSVAILDSISGNKTVSEVQFPVLFDSGTSTSVL 180

Query: 339 PYTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXX 398
           P  +   I  +   +YS     Y   C S+ N+T+L+ DFGGF I               
Sbjct: 181 PTEIADAIGRSFDGKYSSDDEGYIFDC-SKVNNTQLSIDFGGFNISANISNFVTPLTKDH 239

Query: 399 XTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSA 458
             C L ++P +   ++ GD FLV  YVVYDLE++E+S+AQA+FNN +  IE+ISDS+P A
Sbjct: 240 --CVLQILP-SDTVSVLGDAFLVDTYVVYDLESHEVSVAQASFNNEEEDIEIISDSVPGA 296

Query: 459 VRAQGYSSTW 468
             A GYSSTW
Sbjct: 297 TPAPGYSSTW 306

>YIL015W Chr9 (322342..324105) [1764 bp, 587 aa] {ON}  BAR1Aspartyl
           protease secreted into the periplasmic space of mating
           type a cells, helps cells find mating partners, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest
          Length = 587

 Score =  234 bits (597), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 147/427 (34%), Positives = 218/427 (51%), Gaps = 38/427 (8%)

Query: 61  DDGYEEIEI---YNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTK 117
           +DG   +E    + E+ +Y+  L+IGTPSQ++TVL DTGS+D WV    NP+C+ + +T 
Sbjct: 27  NDGTGHLEFLLQHEEEMYYATTLDIGTPSQSLTVLFDTGSADFWVMDSSNPFCLPNSNTS 86

Query: 118 PVXXXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRS-NNTAFSISYGDTT 176
                                      +DC    T++  +S++++   N  F I+Y D T
Sbjct: 87  ------------SYSNATYNGEEVKPSIDCRSMSTYNEHRSSTYQYLENGRFYITYADGT 134

Query: 177 FASGTWGTDNFDLGDLNVTNLSFAVANQSNSTV-GVMGIGLAGLQSTYVGVNSASSGAYQ 235
           FA G+WGT+   +  +++ N+ F VA  + + V GV+GIG    +S  V     +   Y 
Sbjct: 135 FADGSWGTETVSINGIDIPNIQFGVAKYATTPVSGVLGIGFPRRES--VKGYEGAPNEY- 191

Query: 236 YENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRG 295
           Y NFP  LKS+ IID  AYSLFLN PD+  GS++FGA+D SK+SG L+T PM+N Y    
Sbjct: 192 YPNFPQILKSEKIIDVVAYSLFLNSPDSGTGSIVFGAIDESKFSGDLFTFPMVNEY---- 247

Query: 296 IQNPIEFDXXXXXXXXXXXXXIRN--------LTNTQFPALLDSGTTLSYMPYTLTQLIA 347
              P   D              +N         T T++P LLDSGT+L   P  +   +A
Sbjct: 248 ---PTIVDAPATLAMTIQGLGAQNKSSCEHETFTTTKYPVLLDSGTSLLNAPKVIADKMA 304

Query: 348 GAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIP 407
             V A YS+  G Y + CP    D   NFDFG  QI                 C   + P
Sbjct: 305 SFVNASYSEEEGIYILDCPVSVGDVEYNFDFGDLQISVPLSSLILSPETEGSYCGFAVQP 364

Query: 408 LTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSST 467
            T+++ + GD FL  AYVV+DL+NY+IS+AQA +N S+   ++++     ++     ++ 
Sbjct: 365 -TNDSMVLGDVFLSSAYVVFDLDNYKISLAQANWNASEVSKKLVNIQTDGSISGAKIATA 423

Query: 468 --WSTNQ 472
             WSTN+
Sbjct: 424 EPWSTNE 430

>TPHA0C00840 Chr3 (173318..176320) [3003 bp, 1000 aa] {ON} Anc_8.318
           YLR120C
          Length = 1000

 Score =  241 bits (615), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 154/452 (34%), Positives = 226/452 (50%), Gaps = 45/452 (9%)

Query: 30  KYVHLSFDKLRGNSYEEAGKGNKPS-AELRKRDDGYEEIEIYNEQNFYSIELEIGTPSQN 88
           K   + F K   +S EE       S  +L KRD   E+I + N   FYS E+E+GTP+Q 
Sbjct: 28  KAAVIPFRKYYADSLEELDYNTSTSETKLVKRDG--EDIVLTNRNTFYSAEIEVGTPAQT 85

Query: 89  VTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXXXXXXXXXXXXXXXXVDCS 148
           + V++DTGSSDLWV   +N  C  + D                              +C 
Sbjct: 86  MNVIVDTGSSDLWVIGHDNLTCPLASD---------------------------GSFNCE 118

Query: 149 EYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNST 208
            +G+F  SKS++F  N+T F+I+Y       G WG DN  +G +N T LSF V + + S+
Sbjct: 119 RFGSFSISKSSTFTKNSTEFAITYVSGNNCIGVWGQDNLIIGGVNATGLSFGVVHTTTSS 178

Query: 209 VGVMGIGLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSV 268
            G++GIGL   ++T VG      G Y+Y+NFPM LK++GII    YS++L+   +  G  
Sbjct: 179 AGILGIGLPDTETTAVG----QYGHYKYDNFPMVLKNKGIISHQGYSIYLDSSSSTYGEF 234

Query: 269 LFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXX-XXXXXXXXXIRNLTNTQFPA 327
           L G VD SKY+G LY +P++N Y N    +P +F                  LT T+   
Sbjct: 235 LLGGVDTSKYTGTLYKLPLVNWY-NTYFSSPGDFHVTLQGLGLITNSGSAVTLTETKMAV 293

Query: 328 LLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXXXX 387
           +LD+G+T++ +P TL   +  ++G  YS   G Y   CP+E   ++L F+FGG  I    
Sbjct: 294 ILDTGSTVTGIPATLYNALLSSLGGYYSSTHGAYVFTCPTET--SKLVFNFGG--INYKL 349

Query: 388 XXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAF-----N 442
                        C L +   + +  I GD+FL + Y  +DLEN EI +A A F     N
Sbjct: 350 PMSSFINTLGDNVCSLKVSSRSDSNFILGDDFLRNVYAAFDLENKEIGLAMADFDSSSNN 409

Query: 443 NSDSQIEVISDSIPSAVRAQGYSSTWSTNQAI 474
             +  +  +   IP AV+A  YS+TW T +A+
Sbjct: 410 KREDTVIAMESGIPDAVQAPEYSATWVTYEAV 441

>ZYRO0E02266g Chr5 complement(169081..170601) [1521 bp, 506 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 506

 Score =  229 bits (585), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 136/330 (41%), Positives = 191/330 (57%), Gaps = 15/330 (4%)

Query: 148 SEYGTFDPSKSTSFRSNNT--AFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQS 205
           S  G FDP+ S+SF  N+T   F I YGD ++ASG W TD+  +GD++V +++ AVA+ +
Sbjct: 178 SSSGNFDPNSSSSFNKNDTVDGFFIEYGDNSYASGYWATDDLTVGDISVKDMTIAVADDT 237

Query: 206 NSTVGVMGIGLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDADK 265
           NS+V V GI   GL+S+  G N      ++YENFP  LK QGI+ RNAYSL+LN   A  
Sbjct: 238 NSSVAVFGISYRGLESSVFGDNLQD--PHEYENFPYLLKDQGIVKRNAYSLYLNSAGASD 295

Query: 266 GSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIE-FDXXXXXXXXXXXXXIRNLTNTQ 324
           G++LFG VDH+KYSG LYT+P+L   + +   +P E F                 LT T 
Sbjct: 296 GNILFGGVDHNKYSGDLYTLPVL---KGQEDSDPWERFVVTVQGIGIKGSETQNTLTTTP 352

Query: 325 FPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQ--YTGYYSMRCPSENNDTRLNFDFGGFQ 382
           F  LLDSGTT  Y+P  +  ++A A G  +        Y + CPS+  D ++ F+FGGF 
Sbjct: 353 FIGLLDSGTTAVYLPEPVADMVANAYGGSFDDDPEVQSYVISCPSD--DEKIVFNFGGFN 410

Query: 383 IXXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAFN 442
           I                 C L + P +    I GD+FL  +YVVYD++N EIS+AQA F+
Sbjct: 411 IETSLSNYITDNGNGQ--CILNISPTSDYMGILGDSFLRDSYVVYDMDNNEISLAQANFD 468

Query: 443 NSDSQIEVISDSIPSAVRAQGYSSTWSTNQ 472
           +++  +E I+  +P A +A GYSST+S  Q
Sbjct: 469 STE-DVEAITGPVPGATKAPGYSSTYSGPQ 497

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/82 (43%), Positives = 48/82 (58%), Gaps = 12/82 (14%)

Query: 35  SFDKLRGNSYEEAGKGNKPSAELRKRDDGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLD 94
           SFD+ R  S+ E G G          DD  +EI+I N+  +YS  + +GTP Q +T+LLD
Sbjct: 41  SFDESRQISFSEKGTGG---------DD--QEIDISNQNVYYSASIYLGTPGQELTLLLD 89

Query: 95  TGSSDLWVSSPENPYC-IDSDD 115
           TGSSDLW+      +C  DSDD
Sbjct: 90  TGSSDLWIPQKGGYHCQSDSDD 111

>KLLA0D15917g Chr4 complement(1336727..1338262) [1536 bp, 511 aa]
           {ON} some similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease
          Length = 511

 Score =  229 bits (583), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 147/426 (34%), Positives = 218/426 (51%), Gaps = 34/426 (7%)

Query: 52  KPS-AELRKRDDGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYC 110
           KP+   L+KR   +E  ++  +  FY++EL +GTPSQ +  + DTGSSDLWV +  NP+C
Sbjct: 36  KPADRSLQKRSKSFES-KLNPQDYFYTVELGVGTPSQKINCIFDTGSSDLWVPAKSNPFC 94

Query: 111 IDSD-DTKPVXXXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFS 169
           + +  DT                            +DC + G FDP  S S  +    FS
Sbjct: 95  LGNKLDTN--------------GTNEFHGTEITPILDCDKIGVFDPGSSYSLSATGYNFS 140

Query: 170 ISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQST--YVGVN 227
             Y D +++ G W  D+  + D  V +L FAVAN S++  GV+G+GL  L++   Y G  
Sbjct: 141 TQYFDGSYSDGFWVVDDISIADQQVPDLQFAVANISSAPSGVLGVGLPRLEAVRGYDGAP 200

Query: 228 SASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPM 287
           +A+     Y+NFP  LKS  +I+R  YSL+ +  D + G+VLFG +D  KY G LYT+P+
Sbjct: 201 NAN-----YDNFPQTLKSNRLINRVLYSLYFDSGDLESGTVLFGGIDEKKYDGVLYTLPL 255

Query: 288 LNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRN--LTNTQFPALLDSGTTLSYMPYTLTQL 345
           +N+Y    I  P  FD              ++  + + + PALLDSG+T+   P    + 
Sbjct: 256 VNIYEQ--IDEPAAFDITLQGLGIRSESNCKDTVIAHKKAPALLDSGSTIMGAPQEALES 313

Query: 346 IAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGM 405
           IA  +GA +S+  G Y + CP+ N+D    FDFG  ++                 C L +
Sbjct: 314 IAQELGAAFSESDGLYVLDCPASNDDRTFYFDFGELKLKVPIHDLLYLPESGQNYCGLAI 373

Query: 406 IPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVIS--DSIPSAVRAQG 463
           I  +    I GD  L  AYVVYDL+N EIS+AQ     S S+I+ +S   S+P   ++  
Sbjct: 374 IA-SGEEWILGDLVLKSAYVVYDLDNLEISIAQVK-TTSGSRIQTVSATGSLPQTRKSN- 430

Query: 464 YSSTWS 469
            S+ WS
Sbjct: 431 -STPWS 435

>CAGL0E01727g Chr5 (171119..172738) [1620 bp, 539 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
          Length = 539

 Score =  225 bits (573), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 143/412 (34%), Positives = 215/412 (52%), Gaps = 29/412 (7%)

Query: 75  FYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXXXXXX 134
            Y+++L +GTP QNVTV LDTGSSDLW     NPYC  +    P                
Sbjct: 52  MYTVQLHVGTPPQNVTVQLDTGSSDLWFPVASNPYCKRNAKLAP--KKVKALPATGFATE 109

Query: 135 XXXXXXXXXXVDCSEYG-TFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLN 193
                      DC  +G       S+   ++++ F + Y D T+ASG WGTD F L   N
Sbjct: 110 NDQVAKKLRTFDCDAFGLFNSSMSSSFKSNDSSEFFVKYEDGTYASGMWGTDTFKLNHHN 169

Query: 194 VTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNSASSGA------YQYENFPMALKSQG 247
           V+N++FA+AN +N+++GV+G+G    ++T    +  S G+      YQY+NFP+ALK   
Sbjct: 170 VSNITFALANIANASMGVLGVGFPAEETT----DDPSPGSLIDKEHYQYDNFPIALKRTR 225

Query: 248 IIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLN--MYRNRGIQNPIEFDXX 305
            I + +YS+FLN+ ++ KG +LFG VDHSKY G L+TVPM+N  +  N+   +  E    
Sbjct: 226 TIKKVSYSIFLNDTNSKKGVILFGGVDHSKYQGTLWTVPMVNNLLTLNQTTTSRPEITLN 285

Query: 306 XXXXXXXXXXXIRNLT--NTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSM 363
                       +N+T    + P LLD+GTTL+Y P  +  +IA  V       TG   +
Sbjct: 286 GLGFRDDK----KNVTLWGEKIPVLLDTGTTLAYAPKQVVDVIAKRVNGTIDSKTGGIKL 341

Query: 364 -RCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMI---PLTSNAAIFGDNF 419
            +CP+  +++ L F+F G +I                 CYL +     L+    + GD F
Sbjct: 342 KKCPNAKDNSELIFNFAGAEIPVSLLNMVEKRKGK---CYLEIRYHEELSKTGMLLGDIF 398

Query: 420 LVHAYVVYDLENYEISMAQAAFNNSDS-QIEVISDSIPSAVRAQGYSSTWST 470
           + H Y V+++E+ E+S A A  N+S   QIE I   +PSAV+A  Y +T+++
Sbjct: 399 MRHVYSVFNMEDMEVSFAVANGNDSAPLQIEAIISDVPSAVKAPQYYNTFAS 450

>Skud_9.154 Chr9 (291885..293435) [1551 bp, 516 aa] {ON} YIL015W
           (REAL)
          Length = 516

 Score =  224 bits (571), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 152/433 (35%), Positives = 215/433 (49%), Gaps = 40/433 (9%)

Query: 55  AELRKRDDGYEEIEI-YNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDS 113
           A L     G+ E+ +   EQ +Y+  L+IGTPSQ +TVL DTGS+D WV    NP+C  S
Sbjct: 23  AALTNDGSGHLELSLQREEQMYYATTLDIGTPSQQLTVLFDTGSADFWVMDSSNPFC--S 80

Query: 114 DDTKPVXXXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRS-NNTAFSISY 172
             + P                          VDCS   T++ + S++++  +N  F I Y
Sbjct: 81  PKSNP----------SLYQNATYNGSKITPSVDCSSMSTYNENSSSTYQDLDNGRFYIIY 130

Query: 173 GDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTV-GVMGIGLAGLQSTYVGVNSASS 231
            D TF+ G+WG +   +  +++ ++ F +A  + + V GV+GIG    +S  V     + 
Sbjct: 131 ADETFSDGSWGKETVSVNGIDIPDIQFGLAKYATTPVSGVLGIGFPRRES--VKGYEGAP 188

Query: 232 GAYQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMY 291
             Y Y NFP  LKS+ IID  AYSLFLN PD+  GS++FGA+D SK+ G L T PM+N Y
Sbjct: 189 DKY-YPNFPQLLKSEQIIDVVAYSLFLNSPDSGMGSIVFGAIDESKFYGDLLTFPMVNEY 247

Query: 292 RNRGIQNPIEFDXXXXXXXXXXXXXIRN--------LTNTQFPALLDSGTTLSYMPYTLT 343
                  P   D              +N           T++P LLDSGT+L   P T+ 
Sbjct: 248 -------PTIVDAPATLAMTIQGLGAQNKSGCERETFMTTKYPVLLDSGTSLLNAPKTIA 300

Query: 344 QLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYL 403
             +A  V A YS   G Y + CP   +D    FDFG  QI                 C  
Sbjct: 301 DKMASFVNASYSADEGIYILNCPDSADDIEYTFDFGDLQINVPLTSLILSPEVEGGYCGF 360

Query: 404 GMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVIS----DSIPSAV 459
            + P T+++ + GD FL  AYVV+DL+NY+IS+AQA +N S+   +VI+     SIP   
Sbjct: 361 AVQP-TNDSMVLGDVFLSSAYVVFDLDNYKISLAQANWNASEDSKQVINIPTDGSIPGGK 419

Query: 460 RAQGYSSTWSTNQ 472
            A   +  WSTN+
Sbjct: 420 SAT--AEPWSTNE 430

>KNAG0H02760 Chr8 (507659..509350) [1692 bp, 563 aa] {ON} Anc_7.182
           YIL015W
          Length = 563

 Score =  218 bits (554), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 138/429 (32%), Positives = 220/429 (51%), Gaps = 29/429 (6%)

Query: 52  KPSAELRKRDDGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCI 111
           K S +L KR+    +++ + +++FY+  L+IG P Q +TV+ D+GS+D WV S  NP+C+
Sbjct: 34  KFSTQLAKRNHLKFDLQ-FEDESFYATTLKIGDPPQEITVIFDSGSADTWVMSRYNPFCL 92

Query: 112 DSDDTKPVXXXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRS-NNTAFSI 170
            S +                             VDCS+  T++ ++STSF+  NN  F I
Sbjct: 93  SSSNI-----------TANGLKTLYDGKAIIPKVDCSQIKTYNANRSTSFQELNNGRFYI 141

Query: 171 SYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVG-VMGIGLAGLQSTYVGVNSA 229
            YGD TFA G WGT+ F+ G + + N+ F +A+ + + +G V+GIG    +S     N+ 
Sbjct: 142 IYGDKTFADGIWGTETFEFGGVKIPNVQFGLADYATTPIGGVLGIGFQRRESVKGYTNAP 201

Query: 230 SSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLN 289
                 Y NFP  LK++GIID  AYSL L +       ++FGA+D + Y G + T PM+N
Sbjct: 202 E---VFYPNFPQVLKNEGIIDTVAYSLSLGQ----SSHIMFGAIDRNSYIGDMVTFPMIN 254

Query: 290 MYRNRGIQNP--IEFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIA 347
           M+ N  +  P  +                 +  + T++PALLDSG+TL   P  +   +A
Sbjct: 255 MFPN-AVSKPATLSITIQGLGAQNKQECKFQTFSTTKYPALLDSGSTLISAPVEIADKMA 313

Query: 348 GAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIP 407
             +GAQ+S+  G Y++ CP++  +    FDFG  +                  C  G+  
Sbjct: 314 AFIGAQWSESDGIYTLECPNDTTNIDYIFDFGDMKFTLPLSNLILPSQGGSNVCGFGL-Q 372

Query: 408 LTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQI-EVISD-SIPSAVRAQGYS 465
            + N  + GD FL    VV+DL++Y+IS+A++   +S   I  + SD  IP A+ A+  +
Sbjct: 373 RSDNEIVLGDVFLCSTLVVFDLDHYQISLAKSNQKSSAEDIVNIPSDGKIPGAIIAK--A 430

Query: 466 STWSTNQAI 474
             W+T + I
Sbjct: 431 EAWTTYEPI 439

>Smik_9.175 Chr9 (296875..298656) [1782 bp, 593 aa] {ON} YIL015W
           (REAL)
          Length = 593

 Score =  213 bits (542), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 140/410 (34%), Positives = 206/410 (50%), Gaps = 30/410 (7%)

Query: 61  DDGYEEIEI---YNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTK 117
           +DG   +E      E  +Y+  L+IGTPSQ +TVL DTGS+D W+    NP+C+ +  T 
Sbjct: 27  NDGTGRLEFSLQRKEDMYYATTLDIGTPSQQLTVLFDTGSADFWIMDSSNPFCLSTSSTS 86

Query: 118 PVXXXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRS-NNTAFSISYGDTT 176
                                      VDC    T+    S+++++ +N  F I Y D T
Sbjct: 87  ------------SYLNATYDGSIITPSVDCQSMVTYSEGNSSTYQNLDNGRFYIIYADGT 134

Query: 177 FASGTWGTDNFDLGDLNVTNLSFAVANQSNSTV-GVMGIGLAGLQSTYVGVNSASSGAYQ 235
           FA GTWGT+   +  + + N+ F +A  + + V GV+GIG    +S  V     +   Y 
Sbjct: 135 FADGTWGTETVSIDGIVIPNIQFGLAKYATTPVSGVLGIGFPRRES--VKGYEGAPNKY- 191

Query: 236 YENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRG 295
           Y NFP  LKS+ IID  AYSLFLN P++  GS++FGA+D SK+SG L+T PM+N Y N  
Sbjct: 192 YPNFPQILKSEQIIDVVAYSLFLNSPESGTGSIIFGAIDESKFSGDLFTFPMVNEYPNI- 250

Query: 296 IQNP--IEFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQ 353
           +  P  +                      T++P LLDSGT+L   P  +   +A  V A 
Sbjct: 251 VDTPATLAMTIQGLGAQNKNSCEYETFMTTKYPVLLDSGTSLLNAPKVIADKMASFVNAT 310

Query: 354 YSQYTGYYSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTSNAA 413
           YS   G Y + CP+  ++    FDFG  +I                 C   + P T+++ 
Sbjct: 311 YSAEEGIYILDCPAFADEIEYTFDFGDLKISVPLTSLILSPEAEGGYCGFAVQP-TNDSM 369

Query: 414 IFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQG 463
           + GD FL  AYVV+DL+NY+IS+AQA ++ S+   ++++      VRA G
Sbjct: 370 VLGDVFLSSAYVVFDLDNYKISLAQANWDVSEITTKLVN------VRADG 413

>AGR240W Chr7 (1200736..1202094) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL015W (BAR1)
          Length = 452

 Score =  206 bits (524), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 132/408 (32%), Positives = 199/408 (48%), Gaps = 31/408 (7%)

Query: 62  DGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXX 121
           DG+  + +++  + Y IE+E+GTP Q +  +LDTGS+DLW+ +  NP+C+ + D K    
Sbjct: 32  DGFLAMPLHHNDDHYDIEIEVGTPPQKLHAVLDTGSADLWLQAENNPFCVGAKDEK---- 87

Query: 122 XXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGT 181
                                  +DC    TF    ST+ R     F I Y D TF  G+
Sbjct: 88  ------------QEVRGVTVTPSIDCRGIKTFCNESSTTLRILPNPFYIDYAD-TFVDGS 134

Query: 182 WGTDNFDLGDLNVTNLSFAVANQSNSTV-GVMGIGLAGLQST--YVGVNSASSGAYQYEN 238
           W TD   +G  +V+ + F V   SN+ + GV+G+G A L+S   Y G  +A+     Y N
Sbjct: 135 WATDRLVIGGHDVSGMKFGVGRTSNTELSGVLGVGHANLESVRGYAGAPNAT-----YPN 189

Query: 239 FPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQN 298
            P  LK  G + + AYS+ L +     G +LFGA+D SKY G+L+T P+LN+  +  + +
Sbjct: 190 LPRQLKLDGSVQKLAYSVSLQKTSERDGEILFGAIDTSKYVGKLHTFPILNI--DPHLNS 247

Query: 299 PIEF--DXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQ 356
           P  F                 R L N+ F ALLD+GT    +  +L + I  A+ A Y  
Sbjct: 248 PSNFYIALQGIDIQGGRSSTGRPLINSSFHALLDTGTG-GMVVSSLAEDIGAALNATYDT 306

Query: 357 YTGYYSMRCPSENNDTRLNFDFGGFQIXXXXXX-XXXXXXXXXXTCYLGMIPLTSNAAIF 415
               + ++CP+E++  + NF+FG  QI                  C L ++P TS     
Sbjct: 307 EQCVFVIQCPTEDDTRQFNFNFGELQIAVPISNFVVPASGLETGQCALAIMPGTSETFAL 366

Query: 416 GDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQG 463
           G  FL   Y V++LE+ EISMA+A  N  +  I  I   +P+A+R  G
Sbjct: 367 GIPFLKEVYTVFNLEDNEISMARANTNPQEPDIRPIPAGVPAAIRDSG 414

>SAKL0E15356g Chr5 (1283552..1285225) [1674 bp, 557 aa] {ON} weakly
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 557

 Score =  207 bits (528), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 146/467 (31%), Positives = 220/467 (47%), Gaps = 43/467 (9%)

Query: 32  VHLSFDKLRGNSYEEAGKGNKPSAELR---------KRDDGYEEIEIYNE--QNFYSIEL 80
           ++L F   + N++    K      EL+         KRD    E+++YN       ++ +
Sbjct: 48  LNLLFSLNKCNAFPRQSKSGLLELELKRMPVEEKFIKRDGSARELDLYNRAYSGLLNVII 107

Query: 81  EIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXXXXXXXXXXXX 140
            IG   QN+  + DTG SD WV    + YC   + T P                      
Sbjct: 108 SIGKEGQNMFFVADTGLSDTWVVGQNSVYCDIENGTTPANHTANFSENTFAFKNHA---- 163

Query: 141 XXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFA 200
                 C     F+ + STS  SNNT F   + D TFASGTW  D  ++G + +   +F 
Sbjct: 164 ----FPCYLADVFEVNYSTSIVSNNTDFFTQFYDYTFASGTWYQDTIEVGSIIIEKFNFG 219

Query: 201 VANQSNSTVGVMGIGLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNAYSLFLNE 260
           VA ++N+T+G +G+GL G + T  G        Y YENFP  LK+ G+I R  YS++  +
Sbjct: 220 VAQETNATIGSLGLGLEGNEITNEG-----DYTYTYENFPTKLKNSGMIKRVIYSIYAGK 274

Query: 261 PDADKGSVLFGAVDHSKYSGQ-LYTVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRN 319
            D + GS+LFGAV+HS+Y G  LYT+P++N+  N    +P+EF                 
Sbjct: 275 IDTEDGSLLFGAVEHSRYVGDTLYTLPLVNV--NNASSDPVEFHVTLQNLVVSVNKTNTT 332

Query: 320 LTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQ-YTGYYSMRCPSENNDTRLNFDF 378
           + + ++ ALL++G  ++Y+P  L        G   SQ Y G Y   C SE      ++DF
Sbjct: 333 IMSDRYAALLNTGAIVTYLPTHLFSDFIKKTGLSESQKYYGMYVTDCSSE---ISFSYDF 389

Query: 379 GGFQIXXXXXXXXXXXXXXX---XTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEIS 435
           GGF+I                    C + +        + G  F   AYVV+DLE  E+S
Sbjct: 390 GGFKIESSLNDYLFEIDESEIPGAKCAVTINSHDEKYLVLGSGFFSSAYVVFDLERLEVS 449

Query: 436 MAQAA-----FNNSDSQ----IEVISDSIPSAVRAQGYSSTWSTNQA 473
           +AQAA     F  S+ +    +E++ DSIPSA +A  YS+TW+ ++A
Sbjct: 450 IAQAAHVYDNFTYSNIEDNPDVEIVIDSIPSATKAASYSNTWTFDRA 496

>NDAI0B01720 Chr2 complement(409125..410768) [1644 bp, 547 aa] {ON}
           Anc_7.182
          Length = 547

 Score =  206 bits (525), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 142/442 (32%), Positives = 220/442 (49%), Gaps = 41/442 (9%)

Query: 54  SAELRKRDD--GYEEIEI-YNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYC 110
           S  + KR+D  G+  +++ + +Q +Y+  L++GTP QN+TVLLD+GSSD W+   +NP+C
Sbjct: 31  SNRINKRNDISGHLHMKLEHIQQTYYATTLQVGTPPQNITVLLDSGSSDFWLMDSKNPFC 90

Query: 111 IDSDDTKPVXXXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFR---SNNTA 167
           +++                               +DCS +  ++P  S++++   ++N+ 
Sbjct: 91  MEN-----------YCNSTEIPKYNNDLITQNLTIDCSYFNKYNPEISSTYQKLPNDNSR 139

Query: 168 FSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVG-VMGIGLAGLQSTYVGV 226
           F + Y D +F  G W  +   + + N+T+L  AVAN + + VG ++GI     +S     
Sbjct: 140 FYLQYTDGSFEDGIWSKETVQIDNYNITSLQLAVANYATTPVGGLLGISFPRRESV---- 195

Query: 227 NSASSGAYQ--YENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYT 284
                GA    Y NFP  LK++ IID   YS++LN+ + D GS+LFGA+D SK+ G + T
Sbjct: 196 -KGYDGALNEYYPNFPQVLKNENIIDIVLYSMYLNDLNQD-GSLLFGAIDTSKFEGDMIT 253

Query: 285 VPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXI---RNLTNTQFPALLDSGTTLSYMPYT 341
            PM+N+Y N  +  P                          ++FP LLDSGTTL   P  
Sbjct: 254 YPMVNVYPNV-VDKPATLALTIQGVAAQNTNDCTQNETFMTSKFPVLLDSGTTLMSAPKE 312

Query: 342 LTQLIAGAVGAQYSQYTGYYSMRCPSEN--NDTRLNFDFGGFQIXXXXXXXXXXXXXXXX 399
           L   +A  V A YS+    Y + CPS+   ND    FDFGG Q+                
Sbjct: 313 LADKMADFVNATYSEDDRIYILNCPSQEVLNDIEYIFDFGGLQVKIPLEKFILPSDDGSG 372

Query: 400 TCYLGMIP-LTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAFN-----NSDSQIEVISD 453
            C  G++P  T++  + GD FL   Y V+DL++Y+IS+A    N     N DS I + S+
Sbjct: 373 PCAFGVLPETTTDRMVLGDIFLSFVYAVFDLDHYQISLANINKNANSESNEDSIINIPSN 432

Query: 454 -SIPSAVRAQGYSSTWSTNQAI 474
            +IP A  A      WST++ I
Sbjct: 433 GAIPGAKVAT--VKPWSTHEPI 452

>Ecym_4394 Chr4 (827655..829211) [1557 bp, 518 aa] {ON} similar to
           Ashbya gossypii AGR240W
          Length = 518

 Score =  200 bits (509), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 137/412 (33%), Positives = 202/412 (49%), Gaps = 31/412 (7%)

Query: 67  IEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXX 126
           +++ N  + Y  E+E+GTP Q + VL DTGS+DLW  S +N YC  S             
Sbjct: 43  MDLINNNDHYLAEIEVGTPPQKLKVLFDTGSADLWFQSSDNEYCAAS------------- 89

Query: 127 XXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDN 186
                               CS   T++  +S++F      F I Y +T F+ G W  D 
Sbjct: 90  YPQGDNSTNTNDNEQNMASFCSSSRTYNFQRSSTFTPTGYKFFIDYVNT-FSRGIWAKDR 148

Query: 187 FDLGDLNVTNLSFAVANQSNSTV-GVMGIGLAGLQSTYVGVNSASSGA--YQYENFPMAL 243
             +G+ +V+ L F V+N SN+T+ G++G+G   L+S         SGA    Y N PM L
Sbjct: 149 LVIGNADVSGLQFGVSNISNTTINGILGVGYERLESV-----KGYSGAPNRTYPNLPMLL 203

Query: 244 KSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFD 303
           K  G ID+ AYS+FLN  +++  +V FG VD  KY+G LY  P++N+Y++  I  P +F 
Sbjct: 204 KESGKIDKVAYSVFLNHLNSNVSTVTFGGVDSEKYTGDLYKFPLVNIYKS--IPRPSKFH 261

Query: 304 XXXXXXXXXXXXXIRNLT--NTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYY 361
                          N T  NT  PAL D+GT    +P  + + IA  + A + +    Y
Sbjct: 262 ITLQALEVHGNYSSLNKTVSNTPLPALFDTGTNGMVVPPNVAENIASTIHATFDEKFSLY 321

Query: 362 SMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXX-XXTCYLGMIPLTSNAAIFGDNFL 420
              CP+E +DT+L FDFG  QI                  C + +IP        G  FL
Sbjct: 322 LFACPAEEDDTKLVFDFGDIQIEAPLANFIVPAAELGTEQCGVAIIP-EDGTFTLGIPFL 380

Query: 421 VHAYVVYDLENYEISMAQAAFN-NSDSQIEVISDSIPSAVRAQGYSSTWSTN 471
              YVVY+LE+YE+++AQA +  +  S+I  I  +IP A +A   ++ W+TN
Sbjct: 381 RSTYVVYNLEDYEVALAQANWKWDGKSKITPIISNIPGATQAT--ATPWNTN 430

>TDEL0H02650 Chr8 (445052..446710) [1659 bp, 552 aa] {ON} Anc_7.182
           YIL015W
          Length = 552

 Score =  198 bits (503), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 152/434 (35%), Positives = 222/434 (51%), Gaps = 35/434 (8%)

Query: 51  NKPSAELRKRDDGYEEIEIYNEQN-FYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPY 109
           N    +L++R     EI++ +E   +YS  LEIGT  Q + VL D+GSSD+WVSS  NPY
Sbjct: 44  NLSKRKLQRRKS--TEIDLQHESGIYYSAILEIGTSHQELPVLFDSGSSDMWVSSSSNPY 101

Query: 110 CIDSDDTKPVXXXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSF-RSNNTAF 168
           C++S+                              +DC   GTFD + S+SF R +   F
Sbjct: 102 CLESE---------------GYVNQTYNGETVTPFIDCKALGTFDYNGSSSFERLDIGRF 146

Query: 169 SISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVG-VMGIGLAGLQSTYVGVN 227
            I Y D +FA G W  +   L  ++++ L F VA+ +   VG V+GIG    +S   G +
Sbjct: 147 YIKYSDESFADGFWAKEKLRLNGIDISTLQFGVADYATVPVGGVLGIGFPRRESVK-GYD 205

Query: 228 SASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPM 287
            A +  Y   NFP  LK++G+I   AYS+FLNE  +D GS+LFGAVD +KY+G LYT PM
Sbjct: 206 DAPNEFY--PNFPQVLKNEGVIGVAAYSMFLNEVSSDAGSILFGAVDPTKYTGSLYTFPM 263

Query: 288 LNMYRNRGIQNP--IEFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQL 345
           +N Y N  +  P  +                 +  T T+   LLDSGTTL   P  + + 
Sbjct: 264 VNEYPNV-VDKPATLAMTLQALGAKSDSSCKYKTFTTTKQAVLLDSGTTLMTAPPEIAEE 322

Query: 346 IA-GAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLG 404
           +A    G  Y++  G +   CPS+++DT   FDFG  +I                 C  G
Sbjct: 323 MAFFCWGPTYNESEGIFYFDCPSDDDDTEFIFDFGDLKITLPLASLVISSSGDGH-CGFG 381

Query: 405 MIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQ---IEVISD-SIPSAVR 460
           + P  S +   G  FL  AYVVYDL+NY+IS+AQA ++ + SQ   + +  D +I  A +
Sbjct: 382 LTP-ASYSMTLGAIFLSSAYVVYDLDNYQISIAQAKWDGNPSQKSRVRIPKDGTIYGATK 440

Query: 461 AQGYSSTWSTNQAI 474
           A   ++ W+T++ +
Sbjct: 441 AT--ATPWTTDEPV 452

>ZYRO0D15554g Chr4 complement(1298587..1300152) [1566 bp, 521 aa]
           {ON} weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 521

 Score =  196 bits (497), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 139/411 (33%), Positives = 202/411 (49%), Gaps = 35/411 (8%)

Query: 75  FYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXXXXXX 134
           FYS  LEIG+P+Q + +++D+GS+D WV +  NP+C  S + K                 
Sbjct: 46  FYSTTLEIGSPAQKLDLVVDSGSADTWVMASTNPFC--SSNAK----------SGASKNY 93

Query: 135 XXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTA-FSISYGDTTFASGTWGTDNFDLGDLN 193
                     +DC      D + S+ FR  N   F I+Y D +F  G W TD       +
Sbjct: 94  TYNGKAITETIDCQGLTALDVNSSSQFRDLNVGRFYINYTDGSFDDGYWATDEVSAAGAH 153

Query: 194 VTNLSFAVANQSNSTV-GVMGIGLAGLQST--YVGVNSASSGAYQYENFPMALKSQGIID 250
           ++ L F VA  ++  + G++G+G    +S   Y G  +       Y+NFP  LK  GIID
Sbjct: 154 ISGLQFGVAQYASEEIPGILGLGFPRRESVRGYPGAPNKF-----YDNFPQMLKKDGIID 208

Query: 251 RNAYSLFLNEPDADKG-SVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXX 309
             AYS++LN+P+   G SVLFG VD SKYSG LYT PM N Y N  +  P          
Sbjct: 209 VVAYSMYLNDPNGSGGGSVLFGGVDPSKYSGDLYTFPMANQYPNI-VSKPATLAVTLQGF 267

Query: 310 XXXXXXXIRNLT--NTQFPALLDSGTTLSYMPYTLTQLIAGAV--GAQYSQYTGYYSMRC 365
                   R  T     +  LLDSGT+L   P  +   +A  +   A++S+  G Y M C
Sbjct: 268 GAQKKSEGRQETFDTNNYAVLLDSGTSLMGAPEEVVSKMAHFINKNARFSEDDGIYVMDC 327

Query: 366 PSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAYV 425
           P +++DT   FDFG  QI                 C LG++P        GD FL +AY+
Sbjct: 328 PPKDDDTEFVFDFGDLQIAVPVSTLILPPSGESY-CGLGVLP-KDGTWTLGDVFLSYAYL 385

Query: 426 VYDLENYEISMAQAAFN---NSDSQIEVISD-SIPSAVRAQGYSSTWSTNQ 472
           V+DL+NY++SMA+A F+   +   QI++ +D +IP A  A   +  WS+++
Sbjct: 386 VFDLDNYKVSMAKAKFSGDGDQSPQIKIQTDGTIPGAKSAS--AKPWSSSE 434

>CAGL0J02288g Chr10 complement(223820..225445) [1626 bp, 541 aa]
           {ON} similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015w BAR1
          Length = 541

 Score =  188 bits (478), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 135/392 (34%), Positives = 196/392 (50%), Gaps = 36/392 (9%)

Query: 55  AELRKRDDGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSD 114
           A L KR     +   +N   + S+ LE GTP Q++ ++LDTGSSDLWV+   NP C +  
Sbjct: 33  ASLSKRSAVDLQFRRFNNLYYESV-LEFGTPPQSIPLVLDTGSSDLWVTLIGNPLCYNKG 91

Query: 115 DTKPVXXXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFR-SNNTAFSISYG 173
             KP                          +DCS    +D  KS +F    N  F I Y 
Sbjct: 92  SGKP----------------------PKCLIDCSGLVFYDMDKSQTFDYLKNVTFKIGYA 129

Query: 174 DTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTV-GVMGIGLAGLQSTYVGVNSASSG 232
           DTT+ SG W  D   L + ++ +L F +A  +N+T  GV+GIG   ++S  V     + G
Sbjct: 130 DTTYTSGIWIVDIITLPEGHLKDLQFGMAFATNATFSGVLGIGFPAMES--VNGYEFAPG 187

Query: 233 AYQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYR 292
            + Y NFP+ALK+ G  +  AYS+  N+ ++ KGS+LFG++D S++ G LYT PM+N + 
Sbjct: 188 KF-YPNFPLALKNAGFTNIAAYSIEYND-ESKKGSILFGSIDTSRFIGPLYTFPMINEF- 244

Query: 293 NRGIQN-PIEFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVG 351
             GI + P                    ++NT+ PALLD+G+TL  +P+ +TQ IA  + 
Sbjct: 245 -PGIADEPSTLSLTLDGIGIDGSCEQWVISNTKLPALLDTGSTLIELPHPITQSIASYLN 303

Query: 352 AQYSQYTGYYSMRCPSEN--NDTRLNFDFGGFQIXXXXXXXXXXXXXXXX-TCYLGMIPL 408
           A +S   G + + CPS++    T L F FG   +                  C LG I  
Sbjct: 304 ATWSDDHGLFVLACPSDDFLTTTDLAFTFGELHMKIPLRSFILLPDEESNGLCGLG-ITS 362

Query: 409 TSNAAIFGDNFLVHAYVVYDLENYEISMAQAA 440
           +    I GD+FL H Y V+DL+NY IS+A  A
Sbjct: 363 SKGRVILGDSFLTHVYTVFDLDNYMISLAPMA 394

>Smik_5.7 Chr5 (4489..5403) [915 bp, 304 aa] {ON} YIR039C (REAL)
          Length = 304

 Score =  182 bits (461), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 102/228 (44%), Positives = 131/228 (57%), Gaps = 5/228 (2%)

Query: 241 MALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPI 300
           MALKS G I++ AYSLFLNEP A  GS+LFGAVD SKYSGQLYT+PML  Y      +P 
Sbjct: 1   MALKSHGKIEKIAYSLFLNEPKAHFGSILFGAVDKSKYSGQLYTLPMLQAYDTLDSVSPG 60

Query: 301 EFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGY 360
            F               + ++  +FP L DSGTT S +P  +   I  +   +YS     
Sbjct: 61  MFVTAQSVAVLNGDSGNKTVSKVRFPVLFDSGTTYSSLPTEVAHAIGKSFDGKYSSGDQG 120

Query: 361 YSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFL 420
           Y+  C S+  DT L+ DFGGF I                 C L  I    +  + GD FL
Sbjct: 121 YTFDC-SKVKDTLLSIDFGGFNISANISNFVTRTKDH---CLLN-IEAADSGFVLGDAFL 175

Query: 421 VHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSSTW 468
           V AYVV+DLE++E+S+AQA+F++   +IEVISD +P A+RA GYSSTW
Sbjct: 176 VDAYVVFDLESHEVSIAQASFDDKKEEIEVISDRVPGAIRAPGYSSTW 223

>Kpol_1063.22 s1063 (50979..51989) [1011 bp, 336 aa] {ON}
           (50979..51989) [1011 nt, 337 aa]
          Length = 336

 Score =  160 bits (406), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 106/307 (34%), Positives = 155/307 (50%), Gaps = 33/307 (10%)

Query: 64  YEEIEI-YNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXX 122
           Y E++I Y+   FYS  L  G P QNVTVL+DTGSSDLWVSSP N YC +      +   
Sbjct: 52  YLELDIQYHYGQFYSTLLSFGNPVQNVTVLVDTGSSDLWVSSPNNIYCYEDGKNTNINHS 111

Query: 123 XXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTW 182
                                 ++C+++GT+   KS++    +    I YGD +FA G W
Sbjct: 112 ----------------------INCTKFGTYTRDKSSTSNKLDHRLFIQYGDGSFADGEW 149

Query: 183 GTDNFDLGDLNVTNLSFAVANQSNSTV-GVMGIGLAGLQST--YVGVNSASSGAYQYENF 239
            TD   +G  ++ ++ F ++N +++ + GV+G+G    +S   Y G     S    Y N 
Sbjct: 150 ITDTLTIGPYDLQSVQFGISNNASTIISGVLGLGFLRTESIDGYDG-----SPNKLYYNL 204

Query: 240 PMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNP 299
           P  LK Q I + NA+SLFLN  +   G+VLFG +D+SK+SG L T P++N+Y  + I  P
Sbjct: 205 PAYLKDQEITNTNAFSLFLNNSNDASGTVLFGGIDYSKFSGDLVTFPLVNIYP-KLINEP 263

Query: 300 IEFDXXXXXXXXXXXXXIR-NLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYT 358
             F                  L   + PALLDSG++L  MP  +T  IA  V +     T
Sbjct: 264 CTFTITLQQLYGKINGGKSIGLIKEKVPALLDSGSSLISMPIEITDEIALMVNSTLDTMT 323

Query: 359 GYYSMRC 365
             +++ C
Sbjct: 324 SLHNINC 330

>Suva_79.1 Chr79 complement(1..681) [681 bp, 227 aa] {ON} YIR039C
           (REAL)
          Length = 227

 Score =  148 bits (373), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 89/219 (40%), Positives = 120/219 (54%), Gaps = 8/219 (3%)

Query: 226 VNSASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTV 285
           V S  +  Y Y+NFPMALK QG I++ AYSLFLNEP+A  GS+LFGAVD SKYSGQLYT+
Sbjct: 13  VMSPDTTPYVYDNFPMALKRQGKIEKIAYSLFLNEPNARFGSILFGAVDKSKYSGQLYTL 72

Query: 286 PMLNMYR----NRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYT 341
           PML  Y     + G++   +                + ++  QFP L DSGT+ S +P  
Sbjct: 73  PMLKAYNTLDSSAGMEITAQSVAILSVAIIDSKSGNKTVSEVQFPVLFDSGTSTSALPTE 132

Query: 342 LTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTC 401
           +   I  +   +YS     Y   C S+ N+T L+ DFGGF I                 C
Sbjct: 133 IADAIGRSFDGKYSSDNQGYIFDC-SKVNNTLLSIDFGGFNISANISNSVTPITKDH--C 189

Query: 402 YLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAA 440
            L  I    +  + GD FL+  YVV+DLE++E+S+AQA+
Sbjct: 190 LLN-IEADDSGYVLGDAFLIDTYVVFDLESHEVSVAQAS 227

>SAKL0H00330g Chr8 complement(40564..42300) [1737 bp, 578 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 578

 Score =  148 bits (374), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 116/407 (28%), Positives = 188/407 (46%), Gaps = 34/407 (8%)

Query: 80  LEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXXXXXXXXXXX 139
           + +GTPSQ +  LLDT SSD+W+ +  + +C   + T  +                    
Sbjct: 82  MYVGTPSQAIRFLLDTDSSDIWLLNSNSTFCESENGTVNIDSNSNSTLANETASRSDA-- 139

Query: 140 XXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSF 199
                  C     F P  S+SF  N+  F + Y D ++A+GTW  D F  G  +  N++ 
Sbjct: 140 -----YQCKLVNVFYPEDSSSFVLNDLDFHVQYDDYSYANGTWSQDTFSFGYPSFYNVNI 194

Query: 200 AVANQSNSTVGVMGIGLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNAYSLFLN 259
           A+ +++N TVG +G+GL   Q+T  G        + Y +    LK+QG I++ AYS++ +
Sbjct: 195 ALVSETNLTVGSLGLGLRANQATNQG-----DDPFVYNSLLYRLKTQGWIEKIAYSVYTS 249

Query: 260 EPDADKGSVLFGAVDHSKYSGQ-LYTVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIR 318
           E +   G + FG + H  Y G  LYT+P++N+  +  +  P  F                
Sbjct: 250 ELNGTGGGIFFGGLYHDLYKGNVLYTLPLVNV--DPELDEPARFHITLQNLTTSINGTNF 307

Query: 319 NLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQY-SQYTGYYSMRCPSENNDTRLNFD 377
           ++ + ++PALL +G+  +Y+P  L       +  +  +++   Y + C  + N T + +D
Sbjct: 308 SVLSEKYPALLSTGSMFTYLPEELFDSFVDEMDLEKGAKHKDLYVIPC--DTNATFI-YD 364

Query: 378 FGGFQIXXXX---XXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEI 434
           FGGF+I                    C + + P   +    G+ F    YV+++LE+ EI
Sbjct: 365 FGGFEIETPLSGYTFKVESNRTADDMCAVMVKPHNKSYLTLGNGFFAATYVLFNLEDLEI 424

Query: 435 SMAQA-------AFNNSDSQIEVISDSIPSAVRAQGYSSTWSTNQAI 474
           SMA A       AF+      E I  SIPSA RA  YS+TW  NQ  
Sbjct: 425 SMAPASGIEYLDAFD-----YEYIESSIPSASRAASYSNTWILNQTF 466

>TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa]
           {ON} Anc_7.182 YIL015W
          Length = 395

 Score =  132 bits (331), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 111/406 (27%), Positives = 173/406 (42%), Gaps = 68/406 (16%)

Query: 72  EQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXXX 131
           + ++Y   + IG P QN+ VL+DTGSSDLWV+SP NP C + +                 
Sbjct: 27  DDSYYETNILIGNPPQNIGVLVDTGSSDLWVNSPNNPNCYNGN----------------- 69

Query: 132 XXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRS--NNTAFSISYGDTTFASGTWGTDNFDL 189
                        +DC+ +  F+ S S +F +   N+ F I Y D ++  G WG D+  +
Sbjct: 70  -------------IDCTGFTFFNKSNSKTFSNIYKNSIFQIGYQDASYTFGKWGVDSISI 116

Query: 190 GD------------LNVTNLSFAVANQSNSTV-GVMGIGLAGLQSTYVGVNSASSGAYQ- 235
                          N+ N  FA+A  SN  V  V+G+G    ++    VN       + 
Sbjct: 117 NSSYSDSNEDTGLYANIPNAQFAIATNSNVPVQAVLGLGFPRREA----VNGYKLATNKF 172

Query: 236 YENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRN-- 293
           Y N P  +K  G  D    +++L   +    S++FGA D ++Y G L+  PM+N Y N  
Sbjct: 173 YPNLPQLIKQHGYSDNVTIAMYLGS-NETYNSIMFGAYDKTRYIGDLHNFPMVNQYPNVT 231

Query: 294 -RGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGA 352
            +     I  D             I    + ++  +LDSGT+L   P      IAG + A
Sbjct: 232 DKPATFAITLDSMYISMDNNQSDNIYISNDEKYSVVLDSGTSLLSAPDHYVSKIAGLLNA 291

Query: 353 QYSQYTGYYSMRCPSENN-----DTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIP 407
            +   T  Y +  PSE +     D  +NF F  F +                  Y+  I 
Sbjct: 292 TFDNTTHMYLL--PSETDLTLYKDMIINFKFMDFNVPINMLEFILPYDD----SYVFAIL 345

Query: 408 LTSNAA---IFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEV 450
            T N     + GD FL H Y +++L+NY IS+  +  N + ++ E+
Sbjct: 346 PTKNVNTGFVLGDIFLPHVYTIFNLDNYTISLGLSNQNITSNEREI 391

>SAKL0H06512g Chr8 complement(573927..575141) [1215 bp, 404 aa] {ON}
           highly similar to uniprot|P07267 Saccharomyces
           cerevisiae YPL154C PEP4 Vacuolar aspartyl protease
           (proteinase A) required for the posttranslational
           precursor maturation of vacuolar proteinases synthesized
           as a zymogen self-activates
          Length = 404

 Score =  108 bits (270), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 116/464 (25%), Positives = 181/464 (39%), Gaps = 86/464 (18%)

Query: 1   MQLLPAALISGFLLGSQAVALSDVDEKPGKYVHLSFDKLRGNSYEE--AGKGNK------ 52
           MQL     ++  L+ S  +A + V +       L  D+L G ++E+     G K      
Sbjct: 1   MQLQSLLSLATLLVASVDIAEAKVHKAKIHKQKLE-DQLEGATFEQHITSLGQKYLSAYQ 59

Query: 53  ---PSAELRKRDDGYEE----IEIYNEQNF-YSIELEIGTPSQNVTVLLDTGSSDLWVSS 104
              P AE  K    Y E    + + N  N  Y  E+ +GTP QN  V+LDTGSS+LWV S
Sbjct: 60  KAYPEAEFAKEHQFYAEAGHDVPLTNYLNAQYYTEISLGTPPQNFKVILDTGSSNLWVPS 119

Query: 105 PENPYCIDSDDTKPVXXXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSN 164
            E   C                                  + C  +  +D   S+S+++N
Sbjct: 120 AE---C--------------------------------GSLACFLHAKYDHDSSSSYKAN 144

Query: 165 NTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGI--GLAGLQST 222
            ++F+I YG  +   G    D   +GDL +    FA A          G   G+ GL   
Sbjct: 145 GSSFAIQYGSGSL-EGYISQDTLSIGDLTIPKQDFAEATSEPGLAFAFGKFDGILGLAYD 203

Query: 223 YVGVNSASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPD--ADKGSVLFGAVDHSKYSG 280
            + V+      Y   +        G++D   +S +L   D   D G   FG +D SKY G
Sbjct: 204 SISVDKVVPPVYNAIH-------NGLLDEPKFSFYLGNADKSTDGGEATFGGIDSSKYEG 256

Query: 281 QLYTVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPY 340
            +  +P+      R     ++FD                       A +D+GT+L  +P 
Sbjct: 257 NITWLPV-----RRKAYWEVKFDGIGLGDEYAILDG--------HGAAIDTGTSLIALPS 303

Query: 341 TLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXT 400
            L +++   +GA+   ++G YS+ C + ++   L  +FGG+                  +
Sbjct: 304 GLAEILNAEIGAK-KGWSGQYSVECDTRDSLPDLTLNFGGYNF---TITPYDYTLEVSGS 359

Query: 401 CYLGMIPL-----TSNAAIFGDNFLVHAYVVYDLENYEISMAQA 439
           C     P+         AI GD FL   Y VYDL N  + +A+A
Sbjct: 360 CISAFTPMDFPEPVGPLAIIGDAFLRKHYSVYDLGNDAVGLAKA 403

>ZYRO0F07392g Chr6 (598584..599840) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 418

 Score =  107 bits (267), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 101/373 (27%), Positives = 151/373 (40%), Gaps = 69/373 (18%)

Query: 76  YSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXXXXXXX 135
           Y  E+ +GTP QN  V+LDTGSS+LWV S E   C                         
Sbjct: 105 YYTEVSLGTPPQNFKVILDTGSSNLWVPSTE---C------------------------- 136

Query: 136 XXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVT 195
                    + C  +  +D   S+S++ N T F+I YG  +   G    D  +LGDL++T
Sbjct: 137 -------SSLACFLHSKYDHDSSSSYKPNGTEFAIRYGSGSL-EGYISQDTLNLGDLSIT 188

Query: 196 NLSFAVANQSNSTVGVMGI--GLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNA 253
              FA A          G   G+ GL    + V+      Y       A K QG++D   
Sbjct: 189 KQDFAEATSEPGLQFAFGKFDGILGLGYDTISVDGVVPPFYN------AWK-QGLLDEPK 241

Query: 254 YSLFLNE--PDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXXX 311
           ++ +L       D G   FG VD SKY G++  +P+      R     ++FD        
Sbjct: 242 FAFYLGRDGESQDGGVATFGGVDDSKYEGEITWLPI-----RRKAYWEVKFDGIGLGEEY 296

Query: 312 XXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENND 371
                   L N    A +D+GT+L  +P  L ++I   +GA+ S +TG Y++ C + ++ 
Sbjct: 297 A------ELENHG--AAIDTGTSLIALPSGLAEIINAEIGAKKS-WTGQYTVECEARSSL 347

Query: 372 TRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPL-----TSNAAIFGDNFLVHAYVV 426
             + F  GG                    C   + P+         AI GD+FL   Y +
Sbjct: 348 PNMTFTLGGHNFELTAYDYILEVSG---QCISAIFPMDFPEPVGPLAIIGDSFLRKYYSI 404

Query: 427 YDLENYEISMAQA 439
           YDL N  + +A A
Sbjct: 405 YDLGNNAVGLADA 417

>NCAS0C01360 Chr3 complement(249141..250361) [1221 bp, 406 aa] {ON}
           Anc_8.677
          Length = 406

 Score =  103 bits (258), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 95/376 (25%), Positives = 157/376 (41%), Gaps = 74/376 (19%)

Query: 76  YSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXXXXXXX 135
           Y  ++ +GTP QN  V+LDTGSS+LWV S E   C                         
Sbjct: 92  YFADISVGTPPQNFKVILDTGSSNLWVPSSE---C------------------------- 123

Query: 136 XXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVT 195
                    + C  +  +D   S+S+++N T F+I YG  +   G    D  ++GDL + 
Sbjct: 124 -------NSLACFLHSKYDHDASSSYKANGTKFAIQYGSGSL-EGYISQDTLNIGDLTIP 175

Query: 196 NLSFAVANQSNSTVGVMGI--GLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNA 253
              FA A          G   G+ GL    + V+      Y       A++ QG++D   
Sbjct: 176 KQDFAEATSEPGLTFAFGKFDGILGLAYDTISVDKVVPPFYN------AIE-QGLLDEKK 228

Query: 254 YSLFLNEPDADK---GSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXX 310
           ++ +L +   D+   G +  G +D SK+ G +  +P+      R     ++F+       
Sbjct: 229 FAFYLGDTKKDEKNGGEITIGGIDESKFKGDIEWLPV-----RRKAYWEVKFEGIALGDQ 283

Query: 311 XXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENN 370
                    L N    A +D+GT+L  +P  L ++I   +GA+   +TG Y++ C + + 
Sbjct: 284 YAA------LENHG--AAIDTGTSLITLPSGLAEIINTEIGAK-KGWTGQYTLDCDTRDG 334

Query: 371 DTRLNFDFGG--FQIXXXXXXXXXXXXXXXXTCYLGMIPL-----TSNAAIFGDNFLVHA 423
              L F+F G  F I                +C   ++P+         AI GD FL   
Sbjct: 335 LPDLTFNFNGKNFTI-----SPFDYTLEVSGSCISAIMPMDFPEPMGPMAIVGDAFLRKY 389

Query: 424 YVVYDLENYEISMAQA 439
           Y +YDL+N+ + +A+A
Sbjct: 390 YSIYDLDNHAVGLAEA 405

>NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}
          Length = 408

 Score =  103 bits (258), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 97/374 (25%), Positives = 154/374 (41%), Gaps = 70/374 (18%)

Query: 76  YSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXXXXXXX 135
           Y  ++ +GTP Q+  V+LDTGSS+LWV S E   C                         
Sbjct: 94  YFADITLGTPPQSFKVILDTGSSNLWVPSVE---C------------------------- 125

Query: 136 XXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVT 195
                    + C  +  +D  KS+S++ N T F+I YG T    G    D  ++GDLN+ 
Sbjct: 126 -------GSLACYLHSKYDHDKSSSYKPNGTDFAIRYG-TGSLEGYISQDTLNIGDLNIP 177

Query: 196 NLSFAVANQSNSTVGVMGI--GLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNA 253
              FA A          G   G+ GL    + VN      Y       A++ Q ++D   
Sbjct: 178 KQDFAEATSEPGLTFAFGKFDGILGLAYDSISVNKVVPPFYN------AIE-QELLDEKK 230

Query: 254 YSLFL---NEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXX 310
           ++ +L   N+   D G +  G +D +K+ G +  +P+      R     ++F+       
Sbjct: 231 FAFYLGDANKKSEDGGEITIGGIDKTKFKGDIDWLPV-----RRKAYWEVKFE------G 279

Query: 311 XXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENN 370
                    L N    A +D+GT+L  +P  L ++I   +GA+   +TG Y++ C +  N
Sbjct: 280 IGLGDQFAELENHG--AAIDTGTSLIALPSGLAEIINTEIGAK-KGWTGQYTVECDARPN 336

Query: 371 DTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPL-----TSNAAIFGDNFLVHAYV 425
              L F+F G                   +C   ++P+         AI GD FL   Y 
Sbjct: 337 LPDLTFNFNG---KNFTIGPYDYTLEVSGSCISAIMPMDFPEPVGPMAIIGDAFLRKYYS 393

Query: 426 VYDLENYEISMAQA 439
           +YDLEN  + +A+A
Sbjct: 394 IYDLENNAVGLAEA 407

>TBLA0B03830 Chr2 complement(880233..881474) [1242 bp, 413 aa] {ON}
           Anc_8.677 YPL154C
          Length = 413

 Score =  102 bits (255), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 99/399 (24%), Positives = 165/399 (41%), Gaps = 72/399 (18%)

Query: 52  KPSAELRKRDDGYEEIEIYNEQNF-YSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYC 110
           K S+E+  ++ G+E + + N  N  Y  +++IGTP Q+  V+LDTGSS+LWV S E   C
Sbjct: 75  KISSEIVSKNGGHE-VPLSNYMNAQYFADIKIGTPPQSFKVVLDTGSSNLWVPSKE---C 130

Query: 111 IDSDDTKPVXXXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSI 170
                                             + C  +  ++  +S+++++N +AF+I
Sbjct: 131 --------------------------------GSLACYLHSKYNHDESSTYKANGSAFAI 158

Query: 171 SYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGI--GLAGLQSTYVGVNS 228
            YG  +   G    D  ++GDL +T   FA A          G   G+ GL    + VN 
Sbjct: 159 QYGSGSL-EGYISQDVMEIGDLKITKQDFAEATSEPGISFAFGKFDGILGLAYDTIAVNR 217

Query: 229 ASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDADK---GSVLFGAVDHSKYSGQLYTV 285
                Y   N       QG++D   ++ +L +    K   G  +FG +D +K+ G +  +
Sbjct: 218 VVPPVYNAIN-------QGLLDEPKFAFYLGDASKSKDNGGEAVFGGIDETKFEGDITWL 270

Query: 286 PMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQL 345
           P+      R     ++ +                L N    A +D+GT+L  +P  L ++
Sbjct: 271 PV-----RRKAYWEVKLEGLGLGEEYT------ELENHG--AAIDTGTSLITLPSGLAEI 317

Query: 346 IAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGM 405
           I   +GA+   +TG Y++ C    +   + F F G+                  +C   +
Sbjct: 318 INSEIGAK-KGWTGQYTIECDKRASLPDMTFTFDGYNF---TISPYDYTLEVSGSCISAI 373

Query: 406 IPL-----TSNAAIFGDNFLVHAYVVYDLENYEISMAQA 439
            P+         AI GD FL   Y VYDL N  + +A A
Sbjct: 374 TPMDFPEPVGPMAIIGDAFLRKYYSVYDLGNDAVGLAPA 412

>Kwal_26.8802 s26 (949063..950301) [1239 bp, 412 aa] {ON} YPL154C
           (PEP4) - vacuolar proteinase A [contig 68] FULL
          Length = 412

 Score =  101 bits (252), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 99/376 (26%), Positives = 150/376 (39%), Gaps = 74/376 (19%)

Query: 76  YSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXXXXXXX 135
           Y  E+ +GTP Q+  V+LDTGSS+LWV S E   C                         
Sbjct: 98  YFTEISLGTPPQSFKVILDTGSSNLWVPSDE---C------------------------- 129

Query: 136 XXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVT 195
                    + C  +  +    S+S+++N T+F+I YG  +   G    D   +GDL + 
Sbjct: 130 -------GSLACFLHSKYSHDASSSYKANGTSFAIQYGSGSL-EGYISQDTLSIGDLTIP 181

Query: 196 NLSFAVANQSNSTVGVMGI--GLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNA 253
              FA A          G   G+ GL    + V+      Y+  N        G++D   
Sbjct: 182 KQDFAEATSEPGLAFAFGKFDGILGLGYDTISVDKVVPPVYKAIN-------DGLLDEPR 234

Query: 254 YSLFLNEPDADK---GSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXX 310
           ++ +LN  D  +   G V FG +D SKY G +  +P+      R     ++FD       
Sbjct: 235 FAFYLNNADDSEESTGEVTFGGIDSSKYKGDITWLPV-----RRKAYWEVKFDGIGLGDE 289

Query: 311 XXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENN 370
                    L  T   A +D+GT+L  +P  L +++   +GA+   +TG Y++ C S + 
Sbjct: 290 YA------ELQGTG--AAIDTGTSLIALPSGLAEVLNSEIGAK-KGWTGQYTVDCESRDQ 340

Query: 371 DTRLNFDFGG--FQIXXXXXXXXXXXXXXXXTCYLGMIPL-----TSNAAIFGDNFLVHA 423
              L F F G  F I                +C     P+         AI GD FL   
Sbjct: 341 LPDLTFTFNGKNFTITAYDYTLEVSG-----SCISAFTPMDFPEPVGPLAIIGDAFLRKF 395

Query: 424 YVVYDLENYEISMAQA 439
           Y +YDL N  + +AQA
Sbjct: 396 YSIYDLGNNAVGLAQA 411

>KNAG0J01710 Chr10 (312872..314119) [1248 bp, 415 aa] {ON} Anc_8.677
           YPL154C
          Length = 415

 Score =  100 bits (250), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 95/374 (25%), Positives = 151/374 (40%), Gaps = 70/374 (18%)

Query: 76  YSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXXXXXXX 135
           Y  ++ +GTP Q   V+LDTGSS+LWV S E   C                         
Sbjct: 101 YYTDITLGTPPQQFKVILDTGSSNLWVPSSE---C------------------------- 132

Query: 136 XXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVT 195
                    + C  +  +D S S+S+++N T FSI YG  +   G    D   +GDL + 
Sbjct: 133 -------GSLACFLHEKYDHSASSSYKANGTDFSIQYGSGSL-EGYISQDTLSIGDLTIP 184

Query: 196 NLSFAVANQSNSTVGVMGI--GLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNA 253
              FA A          G   G+ GL    + V+      Y       AL+ Q ++D   
Sbjct: 185 KQDFAEATSEPGLAFAFGKFDGILGLAYDTISVDKVVPPFYN------ALE-QDLLDEAK 237

Query: 254 YSLFL---NEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXX 310
           ++ +L   N+   D G  +FG VD SKY+G +  +P+      R     ++ +       
Sbjct: 238 FAFYLGDTNKDAEDGGEAIFGGVDKSKYTGDVTWLPV-----RRKAYWEVKLEGLGLGDE 292

Query: 311 XXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENN 370
                           A +D+GT+L  +P  L ++I   +GA+   +TG Y++ C + + 
Sbjct: 293 YAEL--------ESHGAAIDTGTSLITLPSGLAEIINSEIGAK-KGWTGQYTLECNTRDQ 343

Query: 371 DTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPL-----TSNAAIFGDNFLVHAYV 425
              L F+F G+                  +C   + P+         AI GD FL   Y 
Sbjct: 344 LPDLTFNFNGYNF---TIGPYDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYS 400

Query: 426 VYDLENYEISMAQA 439
           +YDLE+  + +A+A
Sbjct: 401 IYDLEHNAVGLAKA 414

>TPHA0D01260 Chr4 (262523..263782) [1260 bp, 419 aa] {ON} Anc_8.677
           YPL154C
          Length = 419

 Score =  100 bits (249), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 94/375 (25%), Positives = 153/375 (40%), Gaps = 71/375 (18%)

Query: 76  YSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXXXXXXX 135
           Y  ++ +GTP QN  V+LDTGSS+LWV S +   C                         
Sbjct: 104 YYTDISLGTPKQNFKVILDTGSSNLWVPSKD---C------------------------- 135

Query: 136 XXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGD-LNV 194
                    + C  +  +D  +ST++  N T F+I YG  +   G    D   +GD L +
Sbjct: 136 -------TSLACYLHSKYDHDESTTYEKNGTKFTIQYGSGSM-DGYISRDTLIIGDDLVI 187

Query: 195 TNLSFAVANQSNSTVGVMGI--GLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRN 252
               FA A          G   G+ GL    + VN      Y       A+K QGI+D N
Sbjct: 188 PEQDFAEATSEPGLAFAFGKFDGILGLAYDTIAVNKVVPPFYN------AIK-QGILDEN 240

Query: 253 AYSLFLNEPDADK---GSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXX 309
            ++ +L + + D    G   FG  D SK++G +  +P+      R     ++FD      
Sbjct: 241 KFAFYLGDTNKDNKSGGEATFGGYDKSKFTGDITWLPV-----RRKAYWEVKFDSIALGD 295

Query: 310 XXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSEN 369
                          + A +D+GT+L  +P  L ++I   +GA+ S ++G Y++ C + +
Sbjct: 296 EVASLDG--------YGAAIDTGTSLITLPSGLAEVINTQIGAKKS-WSGQYTIDCDTRD 346

Query: 370 NDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPL-----TSNAAIFGDNFLVHAY 424
               + F+F G+                  +C   + P+         AI GD FL   Y
Sbjct: 347 ALPDMTFNFNGYNFTVSPYDYTLEMSG---SCISAITPMDFPEPVGPLAIIGDAFLRKYY 403

Query: 425 VVYDLENYEISMAQA 439
            +YDL+N  + +A++
Sbjct: 404 SIYDLDNNAVGLAKS 418

>KLTH0D11264g Chr4 (920981..922234) [1254 bp, 417 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 417

 Score = 99.8 bits (247), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 99/376 (26%), Positives = 149/376 (39%), Gaps = 74/376 (19%)

Query: 76  YSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXXXXXXX 135
           Y  E+ +GTP Q+  V+LDTGSS+LWV S E   C                         
Sbjct: 103 YFTEITLGTPPQSFKVILDTGSSNLWVPSDE---C------------------------- 134

Query: 136 XXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVT 195
                    + C  +  +    S+S+++N T F+I YG  +   G    D   +GDL + 
Sbjct: 135 -------GSLACFLHSKYSHDASSSYKANGTNFAIQYGSGSL-EGYISQDTLSIGDLTIP 186

Query: 196 NLSFAVANQSNSTVGVMGI--GLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNA 253
              FA A          G   G+ GL    + V+      Y+  N        G++D   
Sbjct: 187 KQDFAEATSEPGLAFAFGKFDGILGLGYDTIAVDKVVPPVYKAIN-------DGLLDEPR 239

Query: 254 YSLFLNEPDADK---GSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXX 310
           ++ +LN  D  +   G V FG +D SKY G +  +P+      R     ++FD       
Sbjct: 240 FAFYLNNADDSEESTGEVTFGGIDSSKYKGNITWLPV-----RRKAYWEVKFDGIGLGDE 294

Query: 311 XXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENN 370
                    L  T   A +D+GT+L  +P  L +++   +GA+   ++G Y++ C S + 
Sbjct: 295 YA------ELEGTG--AAIDTGTSLIALPSGLAEVLNAEIGAK-KGWSGQYTVDCESRDQ 345

Query: 371 DTRLNFDFGG--FQIXXXXXXXXXXXXXXXXTCYLGMIPL-----TSNAAIFGDNFLVHA 423
              L F F G  F I                +C     P+         AI GD FL   
Sbjct: 346 LPDLTFTFNGKNFTISAYDYTLEVSG-----SCISAFTPMDFPEPVGPLAIIGDAFLRKF 400

Query: 424 YVVYDLENYEISMAQA 439
           Y VYDL N  + +AQA
Sbjct: 401 YSVYDLGNNAVGLAQA 416

>YPL154C Chr16 complement(259714..260931) [1218 bp, 405 aa] {ON}
           PEP4Vacuolar aspartyl protease (proteinase A), required
           for the posttranslational precursor maturation of
           vacuolar proteinases; important for protein turnover
           after oxidative damage; synthesized as a zymogen,
           self-activates
          Length = 405

 Score = 97.4 bits (241), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 93/374 (24%), Positives = 149/374 (39%), Gaps = 70/374 (18%)

Query: 76  YSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXXXXXXX 135
           Y  ++ +GTP QN  V+LDTGSS+LWV S E   C                         
Sbjct: 91  YYTDITLGTPPQNFKVILDTGSSNLWVPSNE---C------------------------- 122

Query: 136 XXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVT 195
                    + C  +  +D   S+S+++N T F+I YG T    G    D   +GDL + 
Sbjct: 123 -------GSLACFLHSKYDHEASSSYKANGTEFAIQYG-TGSLEGYISQDTLSIGDLTIP 174

Query: 196 NLSFAVANQSNSTVGVMGI--GLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNA 253
              FA A          G   G+ GL    + V+      Y       A++ Q ++D   
Sbjct: 175 KQDFAEATSEPGLTFAFGKFDGILGLGYDTISVDKVVPPFYN------AIQ-QDLLDEKR 227

Query: 254 YSLFLNEPDADK---GSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXX 310
           ++ +L +   D    G   FG +D SK+ G +  +P+      R     ++F+       
Sbjct: 228 FAFYLGDTSKDTENGGEATFGGIDESKFKGDITWLPV-----RRKAYWEVKFEGIGLGDE 282

Query: 311 XXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENN 370
                           A +D+GT+L  +P  L ++I   +GA+   +TG Y++ C + +N
Sbjct: 283 YAELE--------SHGAAIDTGTSLITLPSGLAEMINAEIGAK-KGWTGQYTLDCNTRDN 333

Query: 371 DTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPL-----TSNAAIFGDNFLVHAYV 425
              L F+F G+                  +C   + P+         AI GD FL   Y 
Sbjct: 334 LPDLIFNFNGYNF---TIGPYDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYS 390

Query: 426 VYDLENYEISMAQA 439
           +YDL N  + +A+A
Sbjct: 391 IYDLGNNAVGLAKA 404

>Smik_6.351 Chr6 (563275..564492) [1218 bp, 405 aa] {ON} YPL154C
           (REAL)
          Length = 405

 Score = 94.7 bits (234), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 92/374 (24%), Positives = 149/374 (39%), Gaps = 70/374 (18%)

Query: 76  YSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXXXXXXX 135
           Y  ++ +GTP QN  V+LDTGSS+LWV S E   C                         
Sbjct: 91  YYTDITLGTPPQNFKVILDTGSSNLWVPSNE---C------------------------- 122

Query: 136 XXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVT 195
                    + C  +  +D   S+S+++N T F+I YG T    G    D   +GDL + 
Sbjct: 123 -------GSLACFLHSKYDHEASSSYKANGTEFAIQYG-TGSLEGYISQDTLSIGDLTIP 174

Query: 196 NLSFAVANQSNSTVGVMGI--GLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNA 253
              FA A          G   G+ GL    + V+      Y       A++ Q ++D   
Sbjct: 175 KQDFAEATSEPGLTFAFGKFDGILGLGYDTISVDKVVPPFYN------AIQ-QDLLDEKK 227

Query: 254 YSLFLNEPDADK---GSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXX 310
           ++ +L +   D    G   FG +D SK+ G +  +P+      R     ++F+       
Sbjct: 228 FAFYLGDTSKDSENGGEATFGGIDESKFKGDITWLPV-----RRKAYWEVKFEGIGLGDE 282

Query: 311 XXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENN 370
                           A +D+GT+L  +P  L ++I   +GA+   +TG Y++ C + ++
Sbjct: 283 YAELE--------SHGAAIDTGTSLITLPSGLAEMINAELGAK-KGWTGQYTLDCNTRDS 333

Query: 371 DTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPL-----TSNAAIFGDNFLVHAYV 425
              L F+F G+                  +C   + P+         AI GD FL   Y 
Sbjct: 334 LPDLIFNFNGYNY---TIGPYDYTLEVSGSCISAITPMDFPEPVGPLAIIGDAFLRKYYS 390

Query: 426 VYDLENYEISMAQA 439
           +YDL N  + +A+A
Sbjct: 391 IYDLGNNAVGLAKA 404

>Skud_16.128 Chr16 complement(231348..232565) [1218 bp, 405 aa] {ON}
           YPL154C (REAL)
          Length = 405

 Score = 94.4 bits (233), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 92/374 (24%), Positives = 149/374 (39%), Gaps = 70/374 (18%)

Query: 76  YSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXXXXXXX 135
           Y  ++ +GTP QN  V+LDTGSS+LWV S E   C                         
Sbjct: 91  YYTDITLGTPPQNFKVILDTGSSNLWVPSNE---C------------------------- 122

Query: 136 XXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVT 195
                    + C  +  +D   S+S+++N T F+I YG T    G    D   +GDL + 
Sbjct: 123 -------GSLACFLHSKYDHEASSSYKANGTEFAIQYG-TGSLEGYISQDTLSIGDLTIP 174

Query: 196 NLSFAVANQSNSTVGVMGI--GLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNA 253
              FA A          G   G+ GL    + V+      Y       A++ Q ++D   
Sbjct: 175 KQDFAEATSEPGLTFAFGKFDGILGLGYDTISVDKVVPPFYN------AIQ-QDLLDEKK 227

Query: 254 YSLFLNEPDADK---GSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXX 310
           ++ +L +   D    G   FG +D SK+ G +  +P+      R     ++F+       
Sbjct: 228 FAFYLGDTSKDSENGGEATFGGIDESKFKGDITWLPV-----RRKAYWEVKFEGIGLGDE 282

Query: 311 XXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENN 370
                           A +D+GT+L  +P  L ++I   +GA+   +TG Y++ C + ++
Sbjct: 283 YAELEG--------HGAAIDTGTSLITLPSGLAEMINAELGAK-KGWTGQYTLDCNTRDS 333

Query: 371 DTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPL-----TSNAAIFGDNFLVHAYV 425
              L F+F G+                  +C   + P+         AI GD FL   Y 
Sbjct: 334 LPDLIFNFNGYNF---TIGPYDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYS 390

Query: 426 VYDLENYEISMAQA 439
           +YDL N  + +A+A
Sbjct: 391 IYDLGNDAVGLAKA 404

>KLLA0D05929g Chr4 (507555..508784) [1230 bp, 409 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 409

 Score = 93.6 bits (231), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 89/374 (23%), Positives = 153/374 (40%), Gaps = 69/374 (18%)

Query: 76  YSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXXXXXXX 135
           Y  E+ +G+P Q+  V+LDTGSS+LWV S E   C                         
Sbjct: 96  YFTEITLGSPPQSFKVILDTGSSNLWVPSAE---C------------------------- 127

Query: 136 XXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVT 195
                    + C  +  +D   S+++++N + F+I YG  +   G    D   +GDL + 
Sbjct: 128 -------GSLACFLHTKYDHEASSTYKANGSEFAIQYGSGSL-EGYVSRDLLTIGDLVIP 179

Query: 196 NLSFAVANQSNSTVGVMGI--GLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNA 253
           +  FA A          G   G+ GL    + VN      Y       A+K++ ++D   
Sbjct: 180 DQDFAEATSEPGLAFAFGKFDGILGLAYDSISVNRIVPPVYN------AIKNK-LLDDPV 232

Query: 254 YSLFLNEPDA--DKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXXX 311
           ++ +L + D   D G   FG +D  KY+G++  +P+      R     ++F+        
Sbjct: 233 FAFYLGDSDKSEDGGEASFGGIDEEKYTGEITWLPV-----RRKAYWEVKFEGIGLGEEY 287

Query: 312 XXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENND 371
                    T     A +D+GT+L  +P  L +++   +GA+   ++G YS+ C S ++ 
Sbjct: 288 A--------TLEGHGAAIDTGTSLIALPSGLAEILNAEIGAK-KGWSGQYSVDCESRDSL 338

Query: 372 TRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPL-----TSNAAIFGDNFLVHAYVV 426
             L  +F G+                  +C     P+         AI GD FL   Y +
Sbjct: 339 PDLTLNFNGYNF---TITAYDYTLEVSGSCISAFTPMDFPEPVGPLAIIGDAFLRKYYSI 395

Query: 427 YDLENYEISMAQAA 440
           YD+ +  + +A+AA
Sbjct: 396 YDIGHDAVGLAKAA 409

>Suva_9.187 Chr9 (310921..311922) [1002 bp, 333 aa] {ON} YIL015W
           (REAL)
          Length = 333

 Score = 92.4 bits (228), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 79/153 (51%), Gaps = 7/153 (4%)

Query: 323 TQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQ 382
           T++P LLDSGT+L   P ++   +A  V A YS   G Y + CP    D    FDFG  Q
Sbjct: 22  TKYPVLLDSGTSLLNAPKSIADKMASFVNASYSADEGIYILDCPESTYDVEYTFDFGDLQ 81

Query: 383 IXXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAFN 442
           I                 C   + P T+++ + GD FL  AYVV+DL+NY+IS+AQA +N
Sbjct: 82  INVPLTSLILSPETEGGYCGFAVQP-TNDSMVLGDVFLSSAYVVFDLDNYKISLAQANWN 140

Query: 443 NSDSQIEVIS----DSIPSAVRAQGYSSTWSTN 471
            S+   ++++     SIPS   A      WSTN
Sbjct: 141 ASNDSKQLVNIPTDGSIPSGKSATAQP--WSTN 171

>Suva_16.156 Chr16 complement(268862..270082) [1221 bp, 406 aa] {ON}
           YPL154C (REAL)
          Length = 406

 Score = 93.2 bits (230), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 92/378 (24%), Positives = 146/378 (38%), Gaps = 78/378 (20%)

Query: 76  YSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXXXXXXX 135
           Y  ++ +G P QN  V+LDTGSS+LWV S E   C                         
Sbjct: 92  YYTDISLGNPPQNFKVILDTGSSNLWVPSTE---C------------------------- 123

Query: 136 XXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVT 195
                    + C  +  +D   S+S++ N T F+I YG T    G    D   +GDL + 
Sbjct: 124 -------GSLACFLHSKYDHEASSSYKPNGTEFAIQYG-TGSLEGYISQDTLSIGDLTIP 175

Query: 196 NLSFAVANQSNSTVGVMGI--GLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNA 253
              FA A          G   G+ GL    + V+      Y       A++ Q ++D   
Sbjct: 176 KQDFAEATSEPGLTFAFGKFDGILGLGYDTISVDKVVPPFYN------AIQ-QDLLDEKK 228

Query: 254 YSLFLNEPDADK---GSVLFGAVDHSKYSGQLYTVPMLNM----YRNRGIQNPIEFDXXX 306
           ++ +L +   D    G   FG +D SK+ G +  +P+        +  GI    EF    
Sbjct: 229 FAFYLGDTSKDSENGGEATFGGIDKSKFKGDVTWLPVRRKAYWEVKFEGIGLGHEFAELE 288

Query: 307 XXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCP 366
                               A +D+GT+L  +P  L ++I   +GA+   ++G Y++ C 
Sbjct: 289 GHG-----------------AAIDTGTSLITLPSGLAEMINAEIGAK-KGWSGQYALDCN 330

Query: 367 SENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPL-----TSNAAIFGDNFLV 421
           + +    L F+F G+                  +C   + P+         AI GD FL 
Sbjct: 331 TRDGLPDLTFNFNGYNF---TIGPYDYTLEVSGSCISAITPMDFPEPVGPLAIIGDAFLR 387

Query: 422 HAYVVYDLENYEISMAQA 439
             Y +YDL N  + +A+A
Sbjct: 388 KYYSIYDLGNDAVGLAEA 405

>Suva_62.1 Chr62 complement(3..758) [756 bp, 252 aa] {ON} YIR039C
           (REAL)
          Length = 252

 Score = 90.1 bits (222), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 110/249 (44%), Gaps = 31/249 (12%)

Query: 1   MQLLPAALISGFLLGSQAVALSDVDEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELR-- 58
           MQL P   ++  L   QA            YV     KL           N P+  L+  
Sbjct: 25  MQLFPFLSLTLLLTYFQAA----FGSSSNSYVKFPVQKL----------ANIPNTNLQDA 70

Query: 59  ----KRDDGYEE--IEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCID 112
               KR + +    I ++     Y +E++IGTP Q   + LDTGSSD+ V+  ++ +C  
Sbjct: 71  SGISKRSEAFNSTIINMFASAGIYVVEMQIGTPPQTAYLELDTGSSDMCVNEADSAHCKS 130

Query: 113 SDDTKPVXXXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISY 172
             D   +                           CS +GTF+P+ S++F+ N T F ++Y
Sbjct: 131 LADDNNIWTSNYELTATATETLSTPLPSVHHITSCSYWGTFNPNISSTFKYNETIFDLTY 190

Query: 173 GDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNSASSG 232
           G       T+GTD   LG++ ++N +F V+N +  + G++GI L   + T  G ++ SS 
Sbjct: 191 G-------TYGTDVVSLGNITLSNYTFGVSNDTTMSYGILGISLPSEEITDRGQDALSSN 243

Query: 233 A--YQYENF 239
              + Y+NF
Sbjct: 244 KTPFAYDNF 252

>Kpol_1013.6 s1013 (10059..11267) [1209 bp, 402 aa] {ON}
           (10059..11267) [1209 nt, 403 aa]
          Length = 402

 Score = 92.4 bits (228), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 92/373 (24%), Positives = 151/373 (40%), Gaps = 69/373 (18%)

Query: 76  YSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXXXXXXX 135
           Y  ++ +GTP+Q+  V+LDTGSS+LWV S      +D +                     
Sbjct: 89  YYTDITLGTPAQSFKVILDTGSSNLWVPS------VDCN--------------------- 121

Query: 136 XXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVT 195
                    + C  +  +D S S++++ N T FSI YG  +   G    D   +GDL + 
Sbjct: 122 --------SLACYLHAKYDHSDSSTYKKNGTTFSIQYGSGSM-EGYISQDVLQIGDLVIP 172

Query: 196 NLSFAVANQSNSTVGVMGI--GLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNA 253
              FA A          G   G+ GL    + VN      Y   N       + ++D   
Sbjct: 173 GQDFAEATSEPGLAFAFGKFDGILGLAYDTIAVNRVVPPFYNAIN-------KKLVDEPI 225

Query: 254 YSLFLNE--PDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXXX 311
           +S +L +     D G V FG  D S ++G +  +P+      R     ++FD        
Sbjct: 226 FSFYLGDDTKSEDGGQVTFGGYDSSLFTGDITWLPV-----RRKAYWEVKFD------AI 274

Query: 312 XXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENND 371
                + +L N    A +D+GT+L  +P  L ++I   +GA+ S ++G + + C + +  
Sbjct: 275 ALGNEVADLVNHG--AAIDTGTSLITLPSGLAEVINSQIGAKKS-WSGQWIVDCKTRDTL 331

Query: 372 TRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPLTSNA-----AIFGDNFLVHAYVV 426
             + F F G+                  +C   + P+   A     AI GD FL   Y +
Sbjct: 332 PDMTFTFDGYNF---TITPYDYTLEVSGSCISAITPMDFPAPVGPLAIVGDAFLRRYYSI 388

Query: 427 YDLENYEISMAQA 439
           YD+ N  + +A A
Sbjct: 389 YDVGNNAVGLAAA 401

>Suva_9.186 Chr9
           (310161..310220,310267..310332,310362..310451,
           310470..310622,310626..310658,310662..310688,
           310692..310742,310746..310787,310807..310833,
           310840..311922) [1632 bp, 543 aa] {OFF} YIL015W (PSEUDO)
          Length = 543

 Score = 91.3 bits (225), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 79/154 (51%), Gaps = 7/154 (4%)

Query: 322 NTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGF 381
            T++P LLDSGT+L   P ++   +A  V A YS   G Y + CP    D    FDFG  
Sbjct: 231 TTKYPVLLDSGTSLLNAPKSIADKMASFVNASYSADEGIYILDCPESTYDVEYTFDFGDL 290

Query: 382 QIXXXXXXXXXXXXXXXXTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAF 441
           QI                 C   + P T+++ + GD FL  AYVV+DL+NY+IS+AQA +
Sbjct: 291 QINVPLTSLILSPETEGGYCGFAVQP-TNDSMVLGDVFLSSAYVVFDLDNYKISLAQANW 349

Query: 442 NNSDSQIEVIS----DSIPSAVRAQGYSSTWSTN 471
           N S+   ++++     SIPS   A      WSTN
Sbjct: 350 NASNDSKQLVNIPTDGSIPSGKSATA--QPWSTN 381

>Kpol_1072.15 s1072 complement(35798..36997) [1200 bp, 399 aa] {ON}
           complement(35798..36997) [1200 nt, 400 aa]
          Length = 399

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 96/414 (23%), Positives = 160/414 (38%), Gaps = 81/414 (19%)

Query: 42  NSYEEAGKGNKPSAELRKRDDGYEEIEIYNEQNF----YSIELEIGTPSQNVTVLLDTGS 97
           N +E+A     P   + K+D    E       N+    Y  ++ IGTP Q   V+LDTGS
Sbjct: 52  NQFEKAF----PEVHISKKDQFTIESHDVPLDNYLNAQYYTDVSIGTPPQKFKVILDTGS 107

Query: 98  SDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSK 157
           S+LWV S                                        + C  +  +D S 
Sbjct: 108 SNLWVPS-----------------------------------VGCSSLACYLHSKYDHSL 132

Query: 158 STSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGI--G 215
           S+++RSN + F I YG  +   G    D   +GDL +    FA A          G   G
Sbjct: 133 SSTYRSNGSDFVIQYGSGSL-KGYISQDTLTIGDLIIPQQDFAEATAEPGLAFAFGKFDG 191

Query: 216 LAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDADK--GSVLFGAV 273
           + GL    + VN A    Y   +       +G++D+  ++ +L +  + K  G   FG  
Sbjct: 192 ILGLAYDSISVNKAVPPLYNAIH-------RGLLDKPMFAFYLGDEKSSKNGGEATFGGY 244

Query: 274 DHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGT 333
           D S++ G++  +P+      R     ++FD              + +      A +D+GT
Sbjct: 245 DPSRFEGEIKWLPV-----RRKAYWEVQFDGIKLGD--------KFMKLEGHGAAIDTGT 291

Query: 334 TLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDF--GGFQIXXXXXXXX 391
           +L  +P  +   +   +GA+ S + G Y++ C    +  +L  +F    F I        
Sbjct: 292 SLITLPSQIADFLNNEIGAKKS-WNGQYTIDCKKRESLPKLTLNFYNHNFTIDPFDYTLE 350

Query: 392 XXXXXXXXTCYLGMIPL-----TSNAAIFGDNFLVHAYVVYDLENYEISMAQAA 440
                   +C   + P+         +I GD FL   Y +YDLEN  + +A++ 
Sbjct: 351 ISG-----SCISAITPMDFPQPVGPLSIIGDAFLRRFYSIYDLENNAVGLAKSV 399

>Ecym_2396 Chr2 complement(769479..770726) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii ACR144W ACR143W
          Length = 415

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 93/377 (24%), Positives = 148/377 (39%), Gaps = 72/377 (19%)

Query: 74  NFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXXXXX 133
           N Y  E+ +GTP Q+  V++DTGSS+LWV    N  C+                      
Sbjct: 99  NQYYSEIGLGTPPQSFKVVMDTGSSNLWVP---NKNCVSEA------------------- 136

Query: 134 XXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLN 193
                        C  +  FD  +S+S+  N++ FS+SYG  +   G    D   +GDL 
Sbjct: 137 -------------CLNHARFDHDRSSSYAKNDSRFSVSYGKGSM-EGFVSYDTLKIGDLT 182

Query: 194 VTNLSFAVANQSNSTVGVMGI--GLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDR 251
           + N  FA A     +  V G   G+ GL    + VN      Y+  +       QG++D 
Sbjct: 183 IKNQGFAEATVEPGSAFVYGQFDGILGLAYDGLAVNHIVPPFYEAVH-------QGLLDE 235

Query: 252 NAYSLFLNEP---DADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXX 308
             ++ +L++    D+  G V+FG  D +K++G++  +P++     R     +E +     
Sbjct: 236 PVFAFYLSDEKKGDSLAGEVVFGGYDETKFTGEISWLPVI-----RKAYWEVELNSITLG 290

Query: 309 XXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSE 368
                    +      +   LD+GT+    P  L Q      GA      G+    C S 
Sbjct: 291 S--------QKFQLQNYGGALDTGTSFITFPSELYQEFVSKTGATVDPDDGHIIAPC-SG 341

Query: 369 NNDTRLNFDFGG--FQIXXXXXXXXXXXXXXXXTCYLGMIPLTSNAA----IFGDNFLVH 422
           +    L F+  G  F I                TC + + PL    A    I GD FL  
Sbjct: 342 SGFPDLTFELAGRSFTI----SSSDYVVQWDDTTCAVAITPLDLGGAGKMVIIGDVFLRR 397

Query: 423 AYVVYDLENYEISMAQA 439
            Y +YDL    + +A++
Sbjct: 398 WYSIYDLSKNAVGLAKS 414

>TDEL0A06230 Chr1 (1091257..1092483) [1227 bp, 408 aa] {ON}
           Anc_8.677 YPL154C
          Length = 408

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 109/471 (23%), Positives = 178/471 (37%), Gaps = 103/471 (21%)

Query: 3   LLPAALISGFLLGSQAVALSDVDEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKRDD 62
           LLP AL+   L+G   +A + V         LS + L  +++ E    +     L + + 
Sbjct: 6   LLPLALM---LVGQSGLADAKVHSAKIHKQKLSEEYL--STFYEQHLSHLGQKYLTQYEK 60

Query: 63  GYEEIEIYNEQNF-----------------YSIELEIGTPSQNVTVLLDTGSSDLWVSSP 105
            Y EI    +  F                 Y  ++ +GTP+QN  V+LDTGSS+LWV S 
Sbjct: 61  AYPEISFSRKHPFFAEDNHDVPLTNYLNAQYYTDISLGTPAQNFKVILDTGSSNLWVPSV 120

Query: 106 ENPYCIDSDDTKPVXXXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNN 165
           +   C                                  + C  +  +D S S+S++ N 
Sbjct: 121 D---C--------------------------------GSLACFLHSKYDHSASSSYKPNG 145

Query: 166 TAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGI--GLAGLQSTY 223
           T F+I YG  +   G    D   +GDL +    FA A          G   G+ GL    
Sbjct: 146 TDFAIQYGSGSL-EGYISQDTLSVGDLVIPKQDFAEATSEPGLAFAFGKFDGILGLAYNT 204

Query: 224 VGVNSASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDADK------GSVLFGAVDHSK 277
           + V+      Y   +       Q ++D   ++ +L +    +      G   FG +D SK
Sbjct: 205 ISVDKVVPPFYNAID-------QDLLDEPRFAFYLGDSSDSEDSSVSGGVATFGGIDKSK 257

Query: 278 YSGQLYTVPMLNM----YRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGT 333
           + G++  +P+        +  GI    EF                        A +D+GT
Sbjct: 258 FKGEISWLPVRRKAYWEVKFEGIGLGDEFAILDGHG-----------------AAIDTGT 300

Query: 334 TLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXX 393
           +L  +P  L ++I   +GA+   ++G Y++ C + ++   L F+F G             
Sbjct: 301 SLITLPSGLAEIINSEIGAK-KGWSGQYTVDCETRSSLPDLTFNFSG---KNYTIGPYDY 356

Query: 394 XXXXXXTCYLGMIPL-----TSNAAIFGDNFLVHAYVVYDLENYEISMAQA 439
                 +C   + P+         AI GD FL   Y VYDL N  + +A+A
Sbjct: 357 TLEVSGSCISAITPMDFPEPVGPLAIVGDTFLRRFYSVYDLGNNAVGLAKA 407

>CAGL0M02211g Chr13 complement(264202..265449) [1248 bp, 415 aa]
           {ON} similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154c PEP4 aspartyl protease Saccharopepsin precursor
          Length = 415

 Score = 85.9 bits (211), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 95/385 (24%), Positives = 147/385 (38%), Gaps = 85/385 (22%)

Query: 76  YSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXXXXXXX 135
           Y  ++ +GTP Q   V+LDTGSS+LWV S                               
Sbjct: 91  YFADISLGTPPQKFKVILDTGSSNLWVPS------------------------------- 119

Query: 136 XXXXXXXXXVDCSEYGTF-----DPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLG 190
                    VDC     F     D S+S+++  +    SISYG  +   G    DN  +G
Sbjct: 120 ---------VDCGSLACFLHNKYDHSQSSTYIKDGRPLSISYGSGSI-EGYISEDNLQIG 169

Query: 191 DLNVTNLSFAVANQSNSTVGVMGI--GLAGLQSTYVGVNSASSGAYQYENFPMALKSQGI 248
           DL + N  F             G   G+ GL    +  +  +   Y       +   Q +
Sbjct: 170 DLTIQNQKFGETTSEPGLAFAFGKFDGILGLAYDTIAQDDITPPFY-------SAIQQHL 222

Query: 249 IDRNAYSLFL---NEPDADKGSV------LFGAVDHSKYSGQLYTVPMLNMYRNRGIQNP 299
           +D + +S +L   N+P A+ GS         G VD SK+ G L  +P L++ R    + P
Sbjct: 223 LDESKFSFYLKSVNDPAAEGGSASDGGVFTLGGVDSSKFKGDL--IP-LHVRRQAYWEVP 279

Query: 300 IEFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTG 359
           +                   L NT   A +D+GT+L  +P  + ++I   +GA+   +TG
Sbjct: 280 LN-------AIKLGDQSTGKLENTG--AAIDTGTSLITLPSDMAEIINAQIGAK-KGWTG 329

Query: 360 YYSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPL-----TSNAAI 414
            Y++ C +      L F   G                   +C   + P+         AI
Sbjct: 330 QYTLECSTRAKLPDLTFTLDGHDFVLSPFEYTLEVSG---SCISVITPMDFPEPIGRMAI 386

Query: 415 FGDNFLVHAYVVYDLENYEISMAQA 439
            GD FL   Y V+DL+   +S+A+A
Sbjct: 387 LGDAFLRRYYSVFDLDANVVSLAEA 411

>KAFR0H02420 Chr8 complement(462759..464009) [1251 bp, 416 aa] {ON}
           Anc_8.677 YPL154C
          Length = 416

 Score = 85.1 bits (209), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 91/367 (24%), Positives = 142/367 (38%), Gaps = 73/367 (19%)

Query: 76  YSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXXXXXXX 135
           Y  ++ IG+P Q   V++DTGSS+LWV S      +D +                     
Sbjct: 99  YFADISIGSPGQTFRVIMDTGSSNLWVPS------VDCN--------------------- 131

Query: 136 XXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVT 195
                    + C  +  +D   S+++  N T F+I YG      G    D   +GDL + 
Sbjct: 132 --------SLACFLHNKYDHRVSSTYVRNGTRFAIRYGSGAL-EGYMSNDTVTVGDLQIP 182

Query: 196 NLSFAVANQSNSTVGVMGI--GLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNA 253
              FA A          G   G+ GL    + VN A    Y   N       +G++D   
Sbjct: 183 KQDFAEATSEPGLAFAFGKFDGIFGLAFDTISVNRAVPPFYNAVN-------RGLLDAPQ 235

Query: 254 YSLFLNEPDADK--GSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXXX 311
           ++ +L +    K  G V FG  D ++++G +  +P+          N I F         
Sbjct: 236 FAFYLGDKRLRKEGGEVTFGGYDETRFTGNITWLPVRREAYWEVDFNGISFGSQYAP--- 292

Query: 312 XXXXXIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENND 371
                   LT T   A +D+GT+L  +P  L +++   +GA+   ++G Y + C   +  
Sbjct: 293 --------LTATG--AAIDTGTSLITLPSGLAEILNAQIGAR-KNWSGQYVLDCSRRSTL 341

Query: 372 TRLNFDFGG--FQIXXXXXXXXXXXXXXXXTCYLGMIPL-----TSNAAIFGDNFLVHAY 424
             + F+ GG  F I                TC   ++P+         AI GD FL   Y
Sbjct: 342 PDITFNLGGSNFSIGPYDYTLEASG-----TCISAIVPMDFPEPVGPLAIIGDAFLRRWY 396

Query: 425 VVYDLEN 431
            VYDL N
Sbjct: 397 SVYDLGN 403

>Smik_5.6 Chr5 (4120..4488) [369 bp, 123 aa] {ON} YIR039C (REAL)
          Length = 123

 Score = 72.0 bits (175), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 60/94 (63%)

Query: 147 CSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSN 206
           C+ +GTF    S++F+ N+T F  +YGD T+  GT+GTD   LG++ + + SF VAN + 
Sbjct: 30  CAYWGTFSARNSSTFKCNDTQFDETYGDGTYYRGTYGTDVVSLGNITLESFSFGVANNTE 89

Query: 207 STVGVMGIGLAGLQSTYVGVNSASSGAYQYENFP 240
           +  G++GI L   ++T+    + ++  ++YENFP
Sbjct: 90  NQGGILGISLPAGENTHSLGGAYNTTPFEYENFP 123

>ACR144W Chr3 (603306..604532) [1227 bp, 408 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL154C (PEP4);
           Tandem gene duplication in this genome
          Length = 408

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 87/391 (22%), Positives = 148/391 (37%), Gaps = 69/391 (17%)

Query: 59  KRDDGYEEIEIYN-EQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTK 117
           K +DG+   E+ N   N Y+ ++ IGTP Q+  V++DTGSS LWV   E   C       
Sbjct: 76  KNNDGHVS-ELANLANNIYAADVTIGTPPQDFRVVVDTGSSTLWVPGKE---C------- 124

Query: 118 PVXXXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTF 177
                                      + C  +  +D  +S++++ N T   ++YG  + 
Sbjct: 125 -------------------------RAMACRLHKRYDHDRSSTYKENGTLTGVTYGSGSI 159

Query: 178 ASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGI--GLAGLQSTYVGVNSASSGAYQ 235
             G    D F + DL +    F        +V V     G+ GL   Y  +    +  +Q
Sbjct: 160 M-GYVSEDTFRISDLEIPGQQFTETTDEPGSVFVFAAFDGILGL--AYPSLGYGVTPPFQ 216

Query: 236 YENFPMALKSQGIIDRNAYSLFLNEPDADKGS--VLFGAVDHSKYSGQLYTVPMLNMYRN 293
                  L  + ++    + ++L++    +G+  ++ G  D +K+ G++  +P+      
Sbjct: 217 ------QLMEKKLVKEPVFGMYLDDMKTGEGNGQLVLGGYDETKFKGEIAWLPV-----R 265

Query: 294 RGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQFPALLDSGTTLSYMPYTL-TQLIAGAVGA 352
           R     + FD               N+    + A +DSGT+L   P  L  Q I+   G 
Sbjct: 266 RQAYWEVVFDSVTVGDD--------NIPLENYGAAIDSGTSLITFPSELFNQFISKLSGV 317

Query: 353 QYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYLGMIPL---- 408
              +    Y + C ++     L F FGG +                  C   ++ L    
Sbjct: 318 TKDRQGNVY-VDCANKQTAPPLTFGFGGHKFSISGEDYIISVPGQSARCMPAIVQLDIDS 376

Query: 409 TSNAAIFGDNFLVHAYVVYDLENYEISMAQA 439
               AI GD FL   Y +YD  N  + +A A
Sbjct: 377 AGKVAIIGDVFLRRYYSIYDFGNNAVGLATA 407

>Ecym_1324 Chr1 complement(662306..664036) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii ACR150W
          Length = 576

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 89/346 (25%), Positives = 134/346 (38%), Gaps = 58/346 (16%)

Query: 147 CSEYGTFDPSKSTSFR----SNNTAFSISYGDTTFASGTWGTD--NFDL-------GD-- 191
           C+    +   +STSF+    S N A+++S+ D T   G+ G D  NF         GD  
Sbjct: 86  CTHGNLYYSGESTSFKNQSGSLNAAYNMSFIDYTEFYGSAGIDIANFTSVESSGTEGDPT 145

Query: 192 -----------LNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNSASSGAYQYENFP 240
                      L++   SF  A  SN   G +G+G   L  T    +   S  +  +   
Sbjct: 146 NTQVQWFGKHTLSIPEFSFFRAEHSNIVDGSLGLGARILSGTAEDSSGFDSSFFFLD--- 202

Query: 241 MALKSQGIIDRNAYSLFLNEPDA----------DKGSVLFGAVDHSKYSGQLYTVPMLNM 290
             LK+   I   +YS++L   ++          D G++L GAVD + + G  Y   ML  
Sbjct: 203 -MLKNANFIKSTSYSIWLGNDNSTLNASRLASSDVGTLLLGAVDPNYFIGNFYRFKMLP- 260

Query: 291 YRNRGIQ---NPIEFDXXXXXXXXXXXXXIRNLTNTQF--PALLDSGTTLSYMPYTLTQL 345
           +R+   +   N +                  N+T   F  P LLD   T+SY+P  L   
Sbjct: 261 FRDSKTETTFNSLPIVPLTKVDIVNAKGTAVNVTQPGFMEPVLLDPRYTISYLPIELILQ 320

Query: 346 IAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXXXXXX-----------XXXXX 394
           IA    A Y +    + + C   N D ++ F FG  +I                      
Sbjct: 321 IAMQTNAVYVKSLDLWLVDCDVANFDAKIRFQFGDLKIDVPLSHFVSSGYVGSPIASTQL 380

Query: 395 XXXXXTCYLGMIP-LTSNAAIFGDNFLVHAYVVYDLENYEISMAQA 439
                TC L + P  +S  +I G  FL   Y+  DLE   ++MAQA
Sbjct: 381 GASNMTCQLNVYPNYSSGFSILGGTFLRSVYLSVDLEGNSVAMAQA 426

>KLLA0F22088g Chr6 (2064310..2065986) [1677 bp, 558 aa] {ON} weakly
           similar to uniprot|Q66RD4 Saccharomyces cerevisiae
           YDR349C YPS7 Putative GPI-anchored aspartic protease
           located in the cytoplasm and endoplasmic reticulum
          Length = 558

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 130/298 (43%), Gaps = 38/298 (12%)

Query: 190 GDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNSASSGAYQYENFPMALKSQGII 249
           G L + + SF +AN++ S V    +GL+G  S     + +S        F   LK+ G+I
Sbjct: 146 GWLTINSTSFILANETGSLVH-GALGLSGPISVPASDSVSSLNFDDSYYFLTHLKNAGVI 204

Query: 250 DRNAYSLFLNEPD----------ADKGSVLFGAVDHSKYSGQLYT---VPMLNM---YRN 293
           + ++YSL++N             A+ G++L G+VD   Y G L +   +P  +    Y +
Sbjct: 205 ETSSYSLWVNNASNHSVDGQINRANAGTLLLGSVDPKYYDGDLISFGSIPFKDESSGYLS 264

Query: 294 RGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQF--PALLDSGTTLSYMPYTLTQLIAGAVG 351
            G   PI                  NLT++ F  P  + S    SY+P +L   ++    
Sbjct: 265 TGY--PIV--PMSRVSIANSEQEAVNLTDSSFLQPVFIHSRYLYSYLPLSLIIQVSIQTN 320

Query: 352 AQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXX-----------XXXXXXXXXXXXXXT 400
           A Y +    + + C   +  + L F+FG   I                            
Sbjct: 321 AVYVESLDRWLVACDIGDMGSNLIFEFGNLNISVPTVDFLGATYNMYSNSSLRFTNGKEA 380

Query: 401 CYLGMIP-LTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPS 457
           CYL M P   ++ ++ G +F+ +AY+V+D++N  I++AQAA   SD  +E  +++ P+
Sbjct: 381 CYLKMYPNYATSFSVLGQSFIKNAYIVHDVDNSNIALAQAA---SDEAVEKAANNSPA 435

>Smik_67.1 Chr67 (653..982) [330 bp, 110 aa] {ON} YGL259W (REAL)
          Length = 110

 Score = 59.3 bits (142), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 57/111 (51%), Gaps = 9/111 (8%)

Query: 1   MQLLPAALISGFLLGSQAVALSDVDEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKR 60
           MQL P   ++  L  SQAV  S  D     YV     KL        G G++  + + KR
Sbjct: 1   MQLFPLLSLALSLAYSQAVLGSSSDS----YVRFPVQKLA----NVPGMGSQDVSNVFKR 52

Query: 61  DDGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCI 111
           DD      I N    Y +++EIGTP Q   + LDTGSSD++V+  ++PYC+
Sbjct: 53  DDVLNSTLI-NAVGMYVVKVEIGTPPQTAYLQLDTGSSDMYVNDADSPYCV 102

>YGL258W-A Chr7 (9162..9395) [234 bp, 77 aa] {ON} Putative protein
           of unknown function
          Length = 77

 Score = 55.8 bits (133), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/52 (53%), Positives = 36/52 (69%), Gaps = 1/52 (1%)

Query: 241 MALKSQGIIDRN-AYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMY 291
           MA + QG I++  +YSLFLN P+   GS+LFGAVD SKY+ +L T PM   Y
Sbjct: 1   MAFERQGKIEKKISYSLFLNGPNVHFGSILFGAVDKSKYAEELCTHPMRQAY 52

>Skud_4.618 Chr4 complement(1101382..1103142) [1761 bp, 586 aa] {ON}
           YDR349C (REAL)
          Length = 586

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 85/328 (25%), Positives = 139/328 (42%), Gaps = 45/328 (13%)

Query: 169 SISYGDTTFASGTWGTDN-----FDLGDLNVTNLSFAVANQSN-STVGVMGIGLAGLQST 222
           S+S  +++FA  T   +N     F+ G L+++N+SF     SN  + G++G  L+G + T
Sbjct: 133 SVSLENSSFALITNLVENQDNIQFESGSLSISNVSFFNIESSNFKSSGLLG--LSG-KVT 189

Query: 223 YVGVNSASSGAYQYENFPMALKSQGIIDRNAYSLFL----------NEPDADKGSVLFGA 272
             G +  SS   +Y  F   LK    I+  +YSL+L           +P  + G +L G 
Sbjct: 190 NPGTDIDSSQYTEYSYFLSLLKDANFIESPSYSLWLAGDTSTYKTYRDPILNCGKLLLGG 249

Query: 273 VDHSKYSGQL-------YTVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQF 325
           VD S ++G L       Y  P+ N      I  PI                  N+T+  F
Sbjct: 250 VDPSLFTGTLGQFDLIPYADPVTNAIT---IGYPIV--PLGPIYIVSNSGESLNMTSKDF 304

Query: 326 --PALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQI 383
             PALLDS +++SY+P +    IA  + A Y +    + ++C   +    L F      I
Sbjct: 305 LSPALLDSTSSVSYLPTSTIIQIAVQIAATYVESLDRWLVQCSMADMGVTLAFRLRDLFI 364

Query: 384 XX-----------XXXXXXXXXXXXXXTCYLGMIPLTSNAA-IFGDNFLVHAYVVYDLEN 431
                                       C+L +   T+    I G+ F+ + Y+  DLE+
Sbjct: 365 EIPLRDLLSSTYDTSTNSSMLFSSGQEACFLTLYANTNTGLNILGEAFMKNIYMAMDLED 424

Query: 432 YEISMAQAAFNNSDSQIEVISDSIPSAV 459
             I++AQA     D+ I+  +++  SAV
Sbjct: 425 NTIAIAQAKKVEDDAVIDDANETTTSAV 452

>YDR349C Chr4 complement(1172386..1174176) [1791 bp, 596 aa] {ON}
           YPS7Putative GPI-anchored aspartic protease, member of
           the yapsin family of proteases involved in cell wall
           growth and maintenance; located in the cytoplasm and
           endoplasmic reticulum
          Length = 596

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 76/303 (25%), Positives = 133/303 (43%), Gaps = 36/303 (11%)

Query: 187 FDLGDLNVTNLSFAVANQSN-STVGVMGIGLAGLQSTYVGVNSASSGAYQYENFPMAL-K 244
           F+ G L+++N+SF     SN  T G++G  L+G + T  G N+  S  Y  +++ ++L K
Sbjct: 166 FNSGSLSISNVSFFDIQSSNFKTSGLLG--LSG-KVTNPG-NAIDSSQYTEQSYFLSLLK 221

Query: 245 SQGIIDRNAYSLFL----------NEPDADKGSVLFGAVDHSKYSGQLYT---VPMLNMY 291
              II+ ++YSL+L           +P ++ G +L G VD S ++G L     +P ++  
Sbjct: 222 DADIIESSSYSLWLAGDTSTYKTYRDPISNCGKLLLGGVDPSLFTGTLGKFDLIPYVDPV 281

Query: 292 RNR-GIQNPIEFDXXXXXXXXXXXXXIRNLTNTQF--PALLDSGTTLSYMPYTLTQLIAG 348
            N   +  PI                  N+T+  F  PALLDS +++SY+P +    IA 
Sbjct: 282 SNAVSVGYPIV--PLGPIYIVSNSGQSLNMTSKDFLSPALLDSTSSVSYLPTSTIIQIAV 339

Query: 349 AVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXX-----------XXXXXXXXXXXX 397
            + A Y +    + ++C   +    L F      I                         
Sbjct: 340 QIAATYVESLDRWLVQCSIADMGVSLGFRLRELTIEIPLRDLLSSTYDTSTNSSMFFSSG 399

Query: 398 XXTCYLGMIPLTSNAA-IFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIP 456
              C+L +   T+    I G+ F+ + Y+  DLE+  I++AQA     D+  E  +++  
Sbjct: 400 QEACFLTLYANTNTGVNILGEAFIKNIYMAMDLEDNTIAIAQAKKVEDDAVTEETNETTA 459

Query: 457 SAV 459
           S +
Sbjct: 460 STI 462

>Smik_4.613 Chr4 complement(1098592..1100382) [1791 bp, 596 aa] {ON}
           YDR349C (REAL)
          Length = 596

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 71/292 (24%), Positives = 112/292 (38%), Gaps = 42/292 (14%)

Query: 181 TWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNSASSGAYQYEN-- 238
           T G   F+ G L+++N+SF     SN        GL GL        SA+  ++  E   
Sbjct: 160 TRGNVQFNSGSLSISNVSFFSVESSNFKTS----GLLGLSGKITNPGSAADSSHYTEQSY 215

Query: 239 FPMALKSQGIIDRNAYSLFL----------NEPDADKGSVLFGAVDHSKYSGQL------ 282
           F   LK   +I+  +YSL+L           +P  + G +L G VD S ++G L      
Sbjct: 216 FLSLLKDVNLIESPSYSLWLAGDTSTYQTHRDPIYNCGKLLLGGVDPSLFTGTLGKFDLI 275

Query: 283 -YTVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQF--PALLDSGTTLSYMP 339
            Y  P+     +  +                      N+T+  F  PALLDS +++SY+P
Sbjct: 276 PYVDPV-----SSAVSTGYPIVPLGPIYIVSNSGQSLNMTSKDFLSPALLDSTSSVSYLP 330

Query: 340 YTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXX-----------XXX 388
                 IA  + A Y +    + ++C   N    L F      I                
Sbjct: 331 TNTIIQIAVQIAATYVESLDRWLVQCSMANMGVSLGFTLRELVIEIPLRDLLSSTYDTST 390

Query: 389 XXXXXXXXXXXTCYLGMIPLTSNAA-IFGDNFLVHAYVVYDLENYEISMAQA 439
                       C+L +   T+    I G+ F+ + Y+  DLE+  I++AQA
Sbjct: 391 NSSMFFSSGQEACFLTLYANTNTGLNILGEAFMKNIYMAMDLEDNTIAIAQA 442

>TDEL0E02230 Chr5 (427831..429552) [1722 bp, 573 aa] {ON} Anc_5.401
           YDR349C
          Length = 573

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 70/288 (24%), Positives = 110/288 (38%), Gaps = 45/288 (15%)

Query: 192 LNVTNLSFAVAN-QSNSTVGVMGIGLAGLQSTYVGVNSASSGAYQYENFPMA------LK 244
           ++++N+SF   N  S  T G +G+G         G  S  S A   E F  +      L 
Sbjct: 150 MSISNISFFETNYASFYTAGSLGLG---------GRISDGSAAIDSEKFDSSFFFLDRLM 200

Query: 245 SQGIIDRNAYSLFLNEPD-------------ADKGSVLFGAVDHSKYSGQLYTVPMLNMY 291
           + GII   +YSL+                  AD G ++ GAVD S Y+G L +  M+   
Sbjct: 201 NLGIIKTPSYSLWFGADTVPYDRRKLASGTMADCGKLILGAVDPSLYTGILRSFKMIPFI 260

Query: 292 R--NRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQF--PALLDSGTTLSYMPYTLTQLIA 347
              ++   N                    N+T+ +F  P LLDS  + +Y+P      IA
Sbjct: 261 DPVSQAQSNNYPILPLGTIYINSANGKSLNMTSEEFVEPVLLDSRYSTTYLPIDAIVQIA 320

Query: 348 GAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXX-----------XXXXXXXXXXX 396
             +GA + +    + + C     D  L+F FG  +I                        
Sbjct: 321 VQIGATFVESLDKWLVACSVAKLDVSLDFTFGNIEIRVPLEDFLVTTYDPKSNTSLHFST 380

Query: 397 XXXTCYLGMIPLTSNA-AIFGDNFLVHAYVVYDLENYEISMAQAAFNN 443
               C+L M+        + G  FL + Y+  D+E+  I++AQA   N
Sbjct: 381 GEEACFLAMVSKDKTGYNVLGGPFLKNLYMAVDIEDSSIAIAQAKMVN 428

>NDAI0C04610 Chr3 complement(1052297..1054126) [1830 bp, 609 aa]
           {ON} Anc_5.401 YDR349C
          Length = 609

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 75/301 (24%), Positives = 118/301 (39%), Gaps = 38/301 (12%)

Query: 174 DTTFASGTWGTDN----FDLGD--LNVTNLSFAVANQSNSTVGVMG-IGLAGLQSTYVGV 226
           +T +A  T+ T N     +LG   L V+N+SF   N  ++    MG +GL+G + T  G 
Sbjct: 137 NTAYAHSTYNTKNNKGLINLGTNYLGVSNVSFI--NADDTVPYAMGSLGLSG-KITGTGT 193

Query: 227 NSASSGAYQYENFPMALKSQGIIDRNAYSLFL------------NEPDADKGSVLFGAVD 274
           +  SS      +F   L    +ID ++YSL+L            N   +  G ++ GAVD
Sbjct: 194 DIDSSNFDNSYDFLDRLYQTNLIDSHSYSLWLAMNQTYNGTRVQNSVTSSFGKLILGAVD 253

Query: 275 HSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXX--XXXXXXXXXIRNLTNTQF--PALLD 330
            + ++G      ML    +      I +                + N+T+  F  P  LD
Sbjct: 254 PTLFTGSFLQFEMLPALESDSATETIGYPIIPMGPIYVVSKSGEMANVTSKDFLEPVFLD 313

Query: 331 SGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXX----- 385
           S  T +Y+P  +   +A  +GA Y +    + + C   N    L+F F    I       
Sbjct: 314 STYTSTYLPLNMIIQVAIQIGAMYVESLERWLVPCNIANQHATLDFTFQDVSIRVPLTDL 373

Query: 386 ------XXXXXXXXXXXXXXTCYLGMIP-LTSNAAIFGDNFLVHAYVVYDLENYEISMAQ 438
                                CYL +     +   I G  FL H Y+  DL+   I++AQ
Sbjct: 374 LGTTYDSSTNTSMHFSTGDEACYLKIFSNQMTGYNILGRPFLKHVYMAVDLDGNNIAIAQ 433

Query: 439 A 439
           A
Sbjct: 434 A 434

>ACR150W Chr3 (614407..616068) [1662 bp, 553 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR349C (YPS7)
          Length = 553

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 84/406 (20%), Positives = 146/406 (35%), Gaps = 75/406 (18%)

Query: 78  IELEIGTPSQNVTVLLDTGSSDLW-VSSPENPYCIDSDDTKPVXXXXXXXXXXXXXXXXX 136
           +EL +GTP Q   + LD     +W VS    P C   D  K                   
Sbjct: 46  VELRVGTPGQRERLRLDITQPYMWLVSGRLYPEC---DRKKG------------------ 84

Query: 137 XXXXXXXXVDCSEYGTFDPSKSTSFRSNN-TAFSISYGDTTFASGTWGTD--NFDLGDLN 193
                    +C     + P  S ++ + +   ++++  D    SG  G +  NF+  D+ 
Sbjct: 85  ---------NCLTGNLYFPKASETYHAGDGETYNLTMADGIQISGLLGYEEVNFNRSDVR 135

Query: 194 VTNLSFAVANQSNSTVGVMG-------------IGLAGLQSTYVGVNSASSGAYQYENFP 240
           V + +  +A +    V  MG             +GL+G  +    +  A+ G+  +  F 
Sbjct: 136 VRDGNVHLAPREGVKVERMGFLEATTMTDIHAGLGLSGRVNNPDPLGDAARGSEFF--FL 193

Query: 241 MALKSQGIIDRNAYSLFLNEPDA----------DKGSVLFGAVDHSKYSGQLYT---VPM 287
             ++  G+I   +YSL+    +           D G+++ GAVD   Y G  Y    VP 
Sbjct: 194 DKMRDAGLISSRSYSLWFGNDNTSAVDLPTVLEDIGTLMLGAVDPRLYYGNFYQYDGVPS 253

Query: 288 LNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQF--PALLDSGTTLSYMPYTLTQL 345
           +++   +  +                     NLT+  F  P LL+S    S++P ++ Q 
Sbjct: 254 VDIASGQHTRGGYPIVPLTRVQLLGTEGRQLNLTDDTFAEPVLLNSRFMTSFLPKSIVQQ 313

Query: 346 IAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXX----------XXXXXXXXXX 395
           IA    A +++ +    + C     +    F FG   +                      
Sbjct: 314 IARQTNAVFTKSSNRLIVECSLLKEEASFRFHFGELVVEVPLSDFIGPTNLRAGTSILAP 373

Query: 396 XXXXTCYLGMIPLTSNA-AIFGDNFLVHAYVVYDLENYEISMAQAA 440
               TCYL ++P T    ++ G   L   Y+  D E+  + MA A 
Sbjct: 374 DTNETCYLKLMPSTGMGFSMLGMPILRKLYIAADTESGAVGMALAV 419

>Suva_2.520 Chr2 complement(929574..931370) [1797 bp, 598 aa] {ON}
           YDR349C (REAL)
          Length = 598

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 112/284 (39%), Gaps = 38/284 (13%)

Query: 187 FDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNSASSGAYQYENFPMALKSQ 246
           F+ G L+++N+SF   N  +S  G  G+   G + T  G +  SS   +   F   L   
Sbjct: 167 FNSGSLSISNVSFF--NIESSNFGTSGLLGLGGKITDSGTDYDSSQFTENSFFLSLLTDA 224

Query: 247 GIIDRNAYSLFL----------NEPDADKGSVLFGAVDHSKYSGQL-------YTVPMLN 289
             I+  +YSL+L           E   D G +L G VD S ++G L       Y  P+ N
Sbjct: 225 SFIECPSYSLWLAGDTSTYQSYKESIPDCGKLLLGGVDPSLFTGTLGKFDLIPYVDPVSN 284

Query: 290 MYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQF--PALLDSGTTLSYMPYTLTQLIA 347
           +        P+                  N+T+  F  PALLDS +++SY+P +    IA
Sbjct: 285 VVSTGYPIVPL-----GPIYIISNSGQSMNMTSKDFLSPALLDSTSSVSYLPTSTIIQIA 339

Query: 348 GAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXX-----------XXXXXXXXXXX 396
             + A Y +    + + C   +    L F F    I                        
Sbjct: 340 VQIAATYVESLDRWLVECSMADMGVTLGFMFRSLTIKIPLSDLLSSTYDTTTNSSMFFSS 399

Query: 397 XXXTCYLGMIPLTSNAA-IFGDNFLVHAYVVYDLENYEISMAQA 439
               C+L +   T+    I G+ F+ + Y+  DLE+  I++AQA
Sbjct: 400 GQEACFLTLYANTNTGVNILGEAFMKNIYMAVDLEDNSIAIAQA 443

>NCAS0F03150 Chr6 complement(630327..632264) [1938 bp, 645 aa] {ON}
           Anc_5.401 YDR349C
          Length = 645

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 108/487 (22%), Positives = 171/487 (35%), Gaps = 106/487 (21%)

Query: 36  FDKLRGNSYEEAGKGNKPSAELRKRDDGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDT 95
           F KL+  S E      KP   L        +I   N+  +Y + + IG+P Q   + +DT
Sbjct: 20  FSKLKSASAESTSSIWKPFPTL--------DIGTINDGVYY-VNVTIGSPPQQEMLRIDT 70

Query: 96  GSSDLWV-SSPENPYCIDSDDTKPVXXXXXXXXXXXXXXXXXXXXXXXXXVDCSEYGTFD 154
               +WV S  ++  C   D                                C     F 
Sbjct: 71  SQPFVWVLSGADDKQCNRLDS------------------------------GCLSGNRFY 100

Query: 155 PSKSTSFRS--NNTAFSISYGDTTFASGTWGTDNFDLGDLNVT-NLSFAVANQS--NSTV 209
           P +ST+  S  N+T +S+++ DT   +G+   DN +  + ++T  L +   N S  NS +
Sbjct: 101 PEESTTGESATNSTIYSLNFLDTFRVNGSIVVDNLNFTNTDITAALDYTTFNSSKNNSII 160

Query: 210 GV--------------------MGIGLAGLQSTY-VGVNSASSGAYQYENFPM--ALKSQ 246
            +                      +G  GL ST+   +N + SG +   +F M   L   
Sbjct: 161 DIGDDFLVIKNFGFINAEDSYPTDMGSLGLSSTFNETLNYSPSGNFN-TSFSMLAMLAES 219

Query: 247 GIIDRNAYSLFLN---------------EPDADKGSVLFGAVDHSKYSGQLYTVPMLNMY 291
           G+ID  +YSL+L                +P  + G +L G+VD S +    Y   +L   
Sbjct: 220 GLIDSQSYSLWLGNGAERDTQLSSQRTPDPQYNNGKLLLGSVDPSLFKEPFYQFDVLPYV 279

Query: 292 RNRGIQNPIEFDX--XXXXXXXXXXXXIRNLTNTQF--PALLDSGTTLSYMPYTLTQLIA 347
                     F                  N+T+  F  P LL+S    +Y+P      IA
Sbjct: 280 DPNTQIESFSFPVIPMNAIYIVSKTGTGTNVTSEDFLEPVLLNSNFRSNYLPLNSIIQIA 339

Query: 348 GAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXX-----------XXXXXXXXXXX 396
             VGA Y +    + + C   N +    F F    I                        
Sbjct: 340 IQVGATYVESLDRWLLPCSIANENVHFEFTFDKLNIKAPLIDFLESTFDSTTNTSMHFSD 399

Query: 397 XXXTCYLGMIPLTS---NAAIFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVISD 453
               C+L + P T    NA   G  FL   Y+  + E   + MAQA    + + +   +D
Sbjct: 400 NSEACFLKLYPNTYVGFNA--LGRPFLKSVYLAVEQEGRIVGMAQAVQEMNSTFLN--AD 455

Query: 454 SIPSAVR 460
            +P+  R
Sbjct: 456 VVPATTR 462

>ZYRO0A06578g Chr1 (533368..535530) [2163 bp, 720 aa] {ON} similar
           to uniprot|Q66RD4 Saccharomyces cerevisiae YDR349C YPS7
           Putative GPI-anchored aspartic protease located in the
           cytoplasm and endoplasmic reticulum
          Length = 720

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 67/278 (24%), Positives = 107/278 (38%), Gaps = 34/278 (12%)

Query: 192 LNVTNLSFAVANQSNSTVGVMGIG-LAGLQSTYVGVNSASSGAYQYENFPMALKSQGIID 250
           L ++N SF   N + S+ GV+G+G     + T +  +   S  +  E    +L+  GII+
Sbjct: 289 LTLSNSSFFEINDTTSSKGVLGLGGKINDKGTDIDSSQFDSSFFLLE----SLRDNGIIE 344

Query: 251 RNAYSLFL------------NEPDA-DKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRG-- 295
             +YSL+L            N PD  + G ++ G VD   YSG L     L    +R   
Sbjct: 345 SLSYSLWLGGDTRPYYDVGRNVPDEINCGKLILGGVDPYYYSGPLKKFNNLIFLDSRTDM 404

Query: 296 IQNPIEFDXXXXXXXXXXXXXIRNLTNTQF--PALLDSGTTLSYMPYTLTQLIAGAVGAQ 353
           +                      N+TN  F  P LLDS  + S++P      IA  V A 
Sbjct: 405 LSRGYPVLPMRTINVVSATGNSINVTNENFLTPVLLDSRYSFSHLPAETIVQIAVQVNAI 464

Query: 354 YSQYTGYYSMRCPSENNDTRLNFDFGGFQI-----------XXXXXXXXXXXXXXXXTCY 402
           Y +    + + C   +    + F+FG   I                            C+
Sbjct: 465 YMKEVDMFVVSCKIADMGVNIQFEFGDVSIDVPFKDFLMSTHNPETNSTMKFSGGDEACF 524

Query: 403 LGMIPLTSNA-AIFGDNFLVHAYVVYDLENYEISMAQA 439
           + M+        I G +FL + Y+  D ++  I++AQA
Sbjct: 525 MTMVSSEETGFNILGTSFLRNVYLAVDHDDQSIAIAQA 562

>AGR407C Chr7 complement(1475317..1476123) [807 bp, 268 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL154C
           (PEP4)
          Length = 268

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 67/296 (22%), Positives = 113/296 (38%), Gaps = 46/296 (15%)

Query: 161 FRSNNTAFSISYGDTTFASGT------WGTDNFDLGDLNVTNLSFAVANQS-----NSTV 209
             +N++ +  S  +   ASGT        TD   +GD  +    FA A  S      S  
Sbjct: 1   MHANSSTYKSSGEEVELASGTGSMQGYLSTDVLGMGDAVLGEQGFAEATSSVLPFIASYQ 60

Query: 210 GVMGIGLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNAYSLFL--NEPDADKGS 267
           GV G+G   L          + G      + M  + Q  +    + +FL  N    ++G 
Sbjct: 61  GVFGLGHREL----------AKGGQVPPIYNMMERGQ--LKDPMFGIFLPKNLAHINEGE 108

Query: 268 VLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQFPA 327
           ++FG  D +K++G L  +P+      +G    +EF+                +      A
Sbjct: 109 IIFGGYDSTKFAGSLEWLPI----TKKGFWE-VEFNSISTGES--------TVQGEGLGA 155

Query: 328 LLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXXXX 387
           +LD+G++L+ +P  +     GA+ A     TG   + C +      + F+ GG +     
Sbjct: 156 ILDTGSSLTLLPTEIFDKFNGALEAALGSKTG-GRVSCSARETAPEIVFELGGKKF---A 211

Query: 388 XXXXXXXXXXXXTCYLGMIP----LTSNAAIFGDNFLVHAYVVYDLENYEISMAQA 439
                        C + + P      SN  I G  FL   Y VYDL +  + +A+A
Sbjct: 212 ITGNEYIMPAGSECMVTIRPQASGAQSNVVILGTPFLRKFYSVYDLGSDRVGLAEA 267

>KLTH0E02596g Chr5 (235803..237593) [1791 bp, 596 aa] {ON} weakly
           similar to uniprot|Q66RD4 Saccharomyces cerevisiae
           YDR349C YPS7 Putative GPI-anchored aspartic protease
           located in the cytoplasm and endoplasmic reticulum
          Length = 596

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 61/273 (22%), Positives = 107/273 (39%), Gaps = 33/273 (12%)

Query: 196 NLSFAVANQSNSTVGVMGIGLAG--LQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNA 253
           + SF  AN+  + +    +GLAG   Q+ Y   +S    +Y   +    L  + +I  ++
Sbjct: 162 SFSFLSANEVAAYIQQGALGLAGRAAQTGYDNDSSDFDSSYVLLD---RLVDESLIYTSS 218

Query: 254 YSLFLN----------EPDADKGSVLFGAVDHSKYSGQLY---TVPMLNMYRNRGIQNPI 300
           +S+++           EP    G V+FGAVD S Y+G      T+P  N  R        
Sbjct: 219 FSMWMGADTRDPLESPEPSNGCGKVIFGAVDTSLYTGDFVKFDTIPFHNA-RTGETSRGY 277

Query: 301 EFDXXXXXXXXXXXXXIRNLTNTQF--PALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYT 358
                            +N+T+  F  P L+DS    +Y+P  +   IA    A Y +  
Sbjct: 278 PIIPLTKVNVQSKSGETKNMTSDSFLEPVLIDSRFRYNYLPLEIIVQIAMQANAYYVESL 337

Query: 359 GYYSMRCPSENNDTRLNFDFGGFQIXX-----------XXXXXXXXXXXXXXTCYLGMIP 407
             + + C        + F+FG   I                            C L ++P
Sbjct: 338 NRWLLACDVGRLGASIIFEFGNLSINVPLNNLMGPTFDSDTNGTLHFSNKQQACELKLLP 397

Query: 408 LTSNA-AIFGDNFLVHAYVVYDLENYEISMAQA 439
            T++   + G  F+ + Y+  +LE+ ++++AQA
Sbjct: 398 STASGFNVLGGAFIKNVYMAAELESNQVALAQA 430

>KNAG0C05140 Chr3 (999304..1001100) [1797 bp, 598 aa] {ON} Anc_5.401
           YDR349C
          Length = 598

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 73/293 (24%), Positives = 118/293 (40%), Gaps = 50/293 (17%)

Query: 192 LNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNSASSGAYQYENFP---MALKSQG- 247
           L + N+SF   + S + +G +G+G   + S+   ++S        ENF      LK+   
Sbjct: 160 LALRNISFVTTSSSTTDLGSLGLG-GSIHSSVFDIDS--------ENFQDTFFLLKTMAN 210

Query: 248 --IIDRNAYSLFLNE---------PDADKGSV----LFGAVDHSKYSGQLYTVPMLNMYR 292
             +I   +YSL+L           PDAD GSV    + GAVD S Y G+ +    ++   
Sbjct: 211 LNLIKSKSYSLWLGNCRRTIDTITPDADNGSVAGKLILGAVDPSLYEGEFFQFNTISYIE 270

Query: 293 NRGIQNPIEFDXXXXXXXXXXXXXIR--NLTNTQF--PALLDSGTTLSYMPYTLTQLIAG 348
                +   +               R  N+T+ Q+  PALLDS    S++P      IA 
Sbjct: 271 PSHNLSTFGYPILPMGPIYMTSQAGRRLNMTSEQYLQPALLDSSFVGSFLPANTIIQIAI 330

Query: 349 AVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXX-----------XXXXXXXXXXXX 397
            +GA Y +    + + C   +    ++F F G  I                         
Sbjct: 331 QIGAIYIESLNRWVVPCSVASMGAHIDFTFDGLDIKVPLSDLLTSSKDPATNSTMHFAEG 390

Query: 398 XXTCYLGMIPLTSNAA----IFGDNFLVHAYVVYDLENYEISMAQAAFNNSDS 446
              C+L    L SN A    + G +F+ +AY+  DL+  ++++AQA     DS
Sbjct: 391 ESACFL---MLYSNNAMGFNVLGTSFIKNAYIAVDLDGTKVAIAQAKNTTGDS 440

>SAKL0G07524g Chr7 (624810..626708) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q66RD4 Saccharomyces cerevisiae YDR349C YPS7
           Putative GPI-anchored aspartic protease located in the
           cytoplasm and endoplasmic reticulum
          Length = 632

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 71/278 (25%), Positives = 112/278 (40%), Gaps = 40/278 (14%)

Query: 186 NFDLGDLNVTNLSFAVANQSNS-TVGVMGIGLAGLQSTYVGVNSASSGAYQYENFPMALK 244
           + D   L++TN+SF   + S S T G +G+G    + T  G +  S G      F   L 
Sbjct: 156 DLDSDTLSMTNVSFINVDYSGSITQGALGLGG---RITAPGEDINSDGFDGSFFFLEQLV 212

Query: 245 SQGIIDRNAYSLFL-----NEPDADK-------GSVLFGAVDHSKYSGQLY---TVPMLN 289
           +  +ID ++YSL+L      E D D+       G ++ GAVD S Y+G      T+P  +
Sbjct: 213 ANNVIDSSSYSLWLGQDVGQEDDEDEYYTEENCGKLVLGAVDPSLYTGDFVRFDTIPFHD 272

Query: 290 MYRNRGIQN---PIEFDXXXXXXXXXXXXXIRNLTNTQF--PALLDSGTTLSYMPYTLTQ 344
           +  + G  +   PI                  N+T+  F  P LLD+    S++P  L  
Sbjct: 273 V--DTGATSFGYPIV--PLTKVSVKASSGQTLNVTSPDFAEPVLLDTRYLYSFLPLKLII 328

Query: 345 LIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXX-----------XXXXXXXX 393
            IA    A Y +    + + C   + +  + F+F G  I                     
Sbjct: 329 QIAIQTNAYYVESLDRWLVSCSVGDLNASMIFEFNGLSIDVPIKDFLSNSYDSVSNSTLH 388

Query: 394 XXXXXXTCYLGMIP-LTSNAAIFGDNFLVHAYVVYDLE 430
                  CYL M P   +  ++ G  F+ +AY+  DLE
Sbjct: 389 FSNGNSACYLKMYPNYATGFSVLGAAFVKNAYIAADLE 426

>ACR143W Chr3 (601369..602550) [1182 bp, 393 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL154C (PEP4);
           Tandem gene duplication in this genome
          Length = 393

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 37/59 (62%), Gaps = 10/59 (16%)

Query: 56  ELRKRDDGYEEIEI---------YNEQNF-YSIELEIGTPSQNVTVLLDTGSSDLWVSS 104
           EL +R    EE+++         YN +NF YS+++ +GTP+QN  V LDTGSS LW+ S
Sbjct: 53  ELSRRTVEDEELQVGGGKFSANVYNFENFQYSVDITLGTPAQNFRVALDTGSSLLWIPS 111

 Score = 37.4 bits (85), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 48/116 (41%), Gaps = 7/116 (6%)

Query: 327 ALLDSGTTLSYMPY-TLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXX 385
           A+ D+G++   MP  T T  ++   GA +   T Y  + C + N+   L  DFGG  +  
Sbjct: 281 AVFDTGSSFIIMPEDTYTDFVSQFPGASHDDGTDY--VDCSTVNSGPDLTLDFGG--VAL 336

Query: 386 XXXXXXXXXXXXXXTCYLGMI--PLTSNAAIFGDNFLVHAYVVYDLENYEISMAQA 439
                         TC L +      +   I GD FL   Y +Y+  +  I +A A
Sbjct: 337 KLSARDYVMQLGRNTCILAVSGNSRVTGEVILGDTFLRRYYTIYNFGDNTIGVASA 392

>Kwal_55.20034 s55 (223867..225648) [1782 bp, 593 aa] {ON} YDR349C
           (YPS7) - GPI-anchored aspartic protease [contig 157]
           FULL
          Length = 593

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 85/211 (40%), Gaps = 21/211 (9%)

Query: 248 IIDRNAYSLFLNEPDADK-GSVLFGAVDHSKYSGQLYTVPMLNMYRNR-GIQN---PIEF 302
           +I+  AYS  L+    +  G ++FG VD S Y+G L  +  L  Y  R G+ +   PI  
Sbjct: 222 VIESYAYSSALDSVAVENCGILIFGGVDRSLYTGDLVKIDTLPYYNVRTGVTSRGYPIV- 280

Query: 303 DXXXXXXXXXXXXXIRNLTNTQF--PALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGY 360
                         ++NLT+  F  P LLD+    +Y+P  L   IA    A Y +    
Sbjct: 281 -PLVKVDVKSKSGQVKNLTSEYFLEPVLLDTRYRYNYLPLDLIVKIATQANAYYVESLNR 339

Query: 361 YSMRCPSENNDTRLNFDFGGFQIXX-----------XXXXXXXXXXXXXXTCYLGMIPLT 409
           + + C        + FDFG   I                            C L  +P +
Sbjct: 340 WLLACDVGKLGASILFDFGEVVIDVPLSDLMGPTYDSTTNGTLYFSNADQACELRFLPNS 399

Query: 410 S-NAAIFGDNFLVHAYVVYDLENYEISMAQA 439
               +I G  F+ + Y+  +L++ ++++AQA
Sbjct: 400 DLGFSILGGPFIKNVYLAAELQSNQVALAQA 430

>TPHA0E01920 Chr5 (393982..395856) [1875 bp, 624 aa] {ON} Anc_5.401
           YDR349C
          Length = 624

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 67/271 (24%), Positives = 98/271 (36%), Gaps = 50/271 (18%)

Query: 212 MGIGLAGLQSTYVGVNSASSGAYQYENFPMA--LKSQGIIDRNAYSLFL----------- 258
           + IG  GL S+     S +S  +  ++F     L +  +ID  +YSL+L           
Sbjct: 179 LTIGSLGLASSTTSDLSGASLDFVDDSFSFLTYLSNSEVIDTPSYSLWLGGDTLPYTNMT 238

Query: 259 --NEPDAD-KGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQ-----------NPIEFDX 304
             N    D  G+++ GAVD   Y G+L    ML    N   +            PI  + 
Sbjct: 239 SINSTTIDYCGNLVLGAVDQRYYEGRLVQFDMLPALLNNVTEAVTYGLPIIPMGPIYIEN 298

Query: 305 XXXXXXXXXXXXIRNLTNTQF--PALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYS 362
                         NLT T F  P LLDS  T + +P      IA  + A Y +  G + 
Sbjct: 299 SSGTQL--------NLTTTNFLEPVLLDSRYTNARLPLNTVIQIATQLNAAYVEEFGSWI 350

Query: 363 MRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXX------------TCYLGMIPLTS 410
           + C     +  LNF+F G  I                             C L + P T 
Sbjct: 351 VECSLAEMNVNLNFNFQGLTIPVSLNDFLSRVINSTTGEPIKFSESSEDACALAVYPNTD 410

Query: 411 NA-AIFGDNFLVHAYVVYDLENYEISMAQAA 440
               I G  FL + Y+  D E   +++A+A 
Sbjct: 411 IGFNILGGPFLKNIYLAIDNEGRSVAIAKAV 441

>CAGL0A02431g Chr1 complement(261812..263575) [1764 bp, 587 aa] {ON}
           similar to uniprot|Q06325 Saccharomyces cerevisiae
           YDR349c YPS7
          Length = 587

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 57/237 (24%), Positives = 94/237 (39%), Gaps = 26/237 (10%)

Query: 242 ALKSQGIIDRNAYSLFL---------NEPDADK-GSVLFGAVDHSKYSGQLYTVPMLNMY 291
           ALK   +I+ ++YSL+L         +  DA++ G ++FGAVD +   G+     M+   
Sbjct: 203 ALKEARLINSSSYSLWLGSQKRNGFADTSDANEAGYLIFGAVDPNLVEGEFRKFDMIPYI 262

Query: 292 RNRGIQNPIEFDXXXXXXXXXXXXXIR--NLTNTQF--PALLDSGTTLSYMPYTLTQLIA 347
             +  +    +               R  N+T   F  P LLD    LSY+P      IA
Sbjct: 263 HPQTGKVAYGYPVVPMGPIYITSSSGRSLNVTTDGFSAPVLLDPSFALSYLPTKAIIQIA 322

Query: 348 GAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXX-----------XXXXXXXXXXX 396
             + A Y +    + + C   ++   ++F FG   I                        
Sbjct: 323 IQIAAVYVESLDLWLVSCDVASSGATVDFSFGDLTIKVPLSDLLASTHDQSTNTTLHFNT 382

Query: 397 XXXTCYLGMIPLT-SNAAIFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVIS 452
               C L + P T +   + G  F+ +AY+  DLE   ++M QAA   S  + E+I+
Sbjct: 383 GQEACVLQLYPNTFTGYNVLGQAFMKNAYLAVDLEGKGVAMGQAANFKSGERKEIIT 439

>Kpol_1059.33 s1059 (70588..72576) [1989 bp, 662 aa] {ON}
           (70588..72576) [1989 nt, 663 aa]
          Length = 662

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 74/289 (25%), Positives = 109/289 (37%), Gaps = 63/289 (21%)

Query: 147 CSEYGTFDPSKSTS---FRSNNTAFSISYGDTTFASGTWGTDNF---------------- 187
           C+E   +DPS S +   +RS +  F   + D  FA+G+  TD F                
Sbjct: 92  CNERTVYDPSSSNTSIPYRSGH-VFDFEFIDALFANGSAYTDRFSFPNILGSTESYSYGN 150

Query: 188 -------DLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNS-ASSGAYQYENF 239
                  D G LN++++SF     S    G + IG  GL       NS   SG Y    F
Sbjct: 151 HSGLVEVDHGHLNISSMSFFSTYNS----GGLSIGSLGLGGNVESRNSDLDSGQYDGSFF 206

Query: 240 PMA-LKSQGIIDRNAYSLFLN--------------EPDADKGSVLFGAVDHSKYSGQLYT 284
            +  LK  G+I+   YSL+L                 ++  G ++ GAV+ +   G+  +
Sbjct: 207 LLEELKEAGLIEGRGYSLWLGGDNTSLVEQEGTVYSSESIAGRLILGAVNPNLIDGKFVS 266

Query: 285 VPMLNMYRNRGIQNP--IEFDXXXXXXXXXXXXXIR------NLTNTQF--PALLDSGTT 334
             ML        QNP  +E               I       N+T+  +  P LLDS  T
Sbjct: 267 FNMLPY------QNPDTLEMSNGYPILPMGPINIISKSGASLNMTSNNYLQPVLLDSRYT 320

Query: 335 LSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQI 383
            S +P      IA  + A Y +    + + C        L F FG  +I
Sbjct: 321 NSRLPIEAIIQIAIQIDASYVEQLNSWVVSCSILKESVVLEFSFGPLRI 369

>YGL259W Chr7 (8470..8967) [498 bp, 165 aa] {ON}  YPS5Protein with
           similarity to GPI-anchored aspartic proteases such as
           Yap1p and Yap3p
          Length = 165

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 37/66 (56%), Gaps = 1/66 (1%)

Query: 50  GNKPSAELRKRDDGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPY 109
           G +  + + KR++      I N    Y +++EIGTP Q V + LDTGSSD+ V++ +  Y
Sbjct: 42  GTQDVSTVFKRNEVLNTTVI-NGIGVYVVKMEIGTPPQTVYLQLDTGSSDMIVNNADIAY 100

Query: 110 CIDSDD 115
           C    D
Sbjct: 101 CKSMSD 106

>KAFR0E04080 Chr5 (818320..820110) [1791 bp, 596 aa] {ON} Anc_5.401
           YDR349C
          Length = 596

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 97/425 (22%), Positives = 154/425 (36%), Gaps = 48/425 (11%)

Query: 71  NEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVXXXXXXXXXXX 130
           N Q  Y +   +G P Q  +++LDT    LWV S      ++  DT  V           
Sbjct: 69  NLQGRYYVNASVGEPQQEQSLVLDTTEPYLWVISGNVE--MNCTDTNNVCNANSLYYYNE 126

Query: 131 XXXXXXXXXXXXXXVDCSEYGTFDPSKSTSFRSNNTAFSI--SYGDTTFASGTWGTDNFD 188
                         +D   Y +F  S       N T  SI  +Y +T   S      N  
Sbjct: 127 SSSAVAIDENADYQMDFLNYVSFAGSSYMD-TINFTDISIKNNYTNTLLQSNLSAYVNLT 185

Query: 189 LGDLNVTNLSFAVANQSNSTV-GVMGIGLAGLQSTYVGVNSASSGAYQYENFPM-ALKSQ 246
              L V N+SF  +  + S   GV+G+G +   S        +SG Y    F     K  
Sbjct: 186 NDHLWVKNVSFLDSTTATSLYSGVLGLGGSITSSN----EYENSGNYDSSYFIFNKFKEA 241

Query: 247 GIIDRNAYSLFLNEPDADK-------------GSVLFGAVDHSKYSGQLYTVPML----- 288
            I   N+YSL+L E ++               G +L G +D + Y G LY   M+     
Sbjct: 242 NITQSNSYSLWLVEDESSLTTTSTKFEEEGTFGKLLLGVIDPALYRGSLYQFDMIPYVDP 301

Query: 289 -NMYRNRGIQNPIEFDXXXXXXXXXXXXXIRNLTNTQF--PALLDSGTTLSYMPYTLTQL 345
            ++  ++G   PI                  N+T+  F  P LLDS    +Y+P      
Sbjct: 302 ESLVSSQGY--PIL--PMGVIYVKSESGARLNVTSKDFLEPVLLDSSQQGNYLPENAIIQ 357

Query: 346 IAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXXXXXXXXXXXXXXXXTCYL-- 403
           IA  +GA Y +    + + C   +    + F F G +I                   +  
Sbjct: 358 IAIQIGATYIESMDRWLVSCDMASYGASVLFTFDGLEIDVPLENLLTNTFETGSNSSIYY 417

Query: 404 ------GMIPLTSNA----AIFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVISD 453
                   + +  NA     + G  F  + Y+  DLE   +++AQA  ++ D    + + 
Sbjct: 418 SDGETACALTIYDNANMGYNLLGSAFFRNTYIAVDLEGNTVAIAQAKPSDEDDSSNLSAT 477

Query: 454 SIPSA 458
           ++P+A
Sbjct: 478 TLPAA 482

>TBLA0H01680 Chr8 (385315..387144) [1830 bp, 609 aa] {ON} Anc_5.401
           YDR349C
          Length = 609

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 67/282 (23%), Positives = 104/282 (36%), Gaps = 34/282 (12%)

Query: 188 DLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNSASSGAYQYENFPMALKSQG 247
           D  +L+V+N+SF  A   +S          GL ST +GV +  S  +   N   AL + G
Sbjct: 178 DTHNLSVSNISFFDAYNYSSLRYGALGLGGGLVSTNLGV-TGPSDPFSLLN---ALLNSG 233

Query: 248 IIDRNAYSLFL--------------NEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRN 293
           +I   +YS++                E  +D G ++FG VD S   G   +  M+     
Sbjct: 234 VIQTASYSMWFANGSSYIDTKHFPYEEKKSDYGLIVFGGVDSSLIDGTFQSFTMIPYEDT 293

Query: 294 RGIQNPIEFDXXXXXXXXXXXXXIR--NLTNTQF--PALLDSGTTLSYMPYTLTQLIAGA 349
                   +               R  NLT   F  P LLDS  T S +P +    +A  
Sbjct: 294 SDGLTTSGYPILPMGPIYIIANSGRTLNLTTLDFLEPVLLDSRITNSRLPASFIIQVAIQ 353

Query: 350 VGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQIXXXXX-----------XXXXXXXXXX 398
           + A Y +    + + C   + +   +F FG  +I                          
Sbjct: 354 LEAMYLESLDRWVVPCSLADYNVNFDFSFGSVRIRVPLEDFLVPSGLTGDNKTIHFSQNE 413

Query: 399 XTCYLGMIPLTS-NAAIFGDNFLVHAYVVYDLENYEISMAQA 439
             CYL M P T     I G  FL +A +  D  + +I++ +A
Sbjct: 414 DACYLAMYPNTDIGFNILGTPFLKNAVIAVDHSSSQIAIGKA 455

>TDEL0F00230 Chr6 (36217..36729) [513 bp, 170 aa] {ON} Anc_3.383
           YBR122C
          Length = 170

 Score = 32.0 bits (71), Expect = 2.2,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 39/80 (48%), Gaps = 9/80 (11%)

Query: 43  SYEEAGKGNKPSAELRKRDDGYEEIEIYNEQNFYSIELEIGT--------PSQNVTVLLD 94
           SY+ +G+ N P   L+K   G     IY+E N   +EL  G+        P   + ++ D
Sbjct: 15  SYQGSGQINIPRRPLKKIRLGKARPAIYHEFNV-KVELSDGSVITRRSQFPKDEIRLIQD 73

Query: 95  TGSSDLWVSSPENPYCIDSD 114
             +S LW SS ++   +D++
Sbjct: 74  QRNSPLWNSSRDDLVVVDAN 93

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,295,624
Number of extensions: 1986783
Number of successful extensions: 5700
Number of sequences better than 10.0: 143
Number of HSP's gapped: 5347
Number of HSP's successfully gapped: 238
Length of query: 524
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 410
Effective length of database: 40,409,475
Effective search space: 16567884750
Effective search space used: 16567884750
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)