Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0F041308.286ON32830716440.0
Skud_4.3878.286ON3363138471e-112
ZYRO0D06600g8.286ON3303128111e-107
NCAS0B035908.286ON3293127831e-103
KAFR0B053708.286ON3293107821e-102
Kpol_1033.168.286ON3213077721e-101
TBLA0D040408.286ON3293087622e-99
Suva_2.2898.286ON3353187603e-99
Smik_4.3728.286ON3353127534e-98
YDR126W (SWF1)8.286ON3363197501e-97
NDAI0J010008.286ON3393227492e-97
TPHA0C010708.286ON3333167457e-97
CAGL0B01991g8.286ON3303087317e-95
KNAG0H031108.286ON3313076841e-87
KLTH0G13112g8.286ON3493326763e-86
SAKL0H16434g8.286ON5552916445e-79
Ecym_42828.286ON3403255876e-73
AGR065W8.286ON3263015804e-72
Kwal_56.236978.286ON3383115745e-71
KLLA0F19690g8.286ON3243135586e-69
NCAS0C029208.389ON374822017e-17
Smik_12.3068.389ON359541982e-16
TBLA0H009208.389ON3601131982e-16
NDAI0G022508.389ON389821931e-15
ZYRO0C04092g8.389ON3661861921e-15
SAKL0H13860g8.389ON3521761902e-15
CAGL0G08217g8.389ON326951892e-15
KLLA0D18370g8.389ON355541893e-15
YLR246W (ERF2)8.389ON359541893e-15
Skud_12.3218.389ON356541893e-15
Kwal_56.224596.28ON3832201893e-15
KAFR0H019808.389ON361541884e-15
Suva_10.3428.389ON356541884e-15
NDAI0C026506.28ON3891521884e-15
TPHA0C023608.389ON404551851e-14
CAGL0E02497g6.28ON3761721805e-14
KLTH0F19580g3.12ON3421491795e-14
KNAG0F029306.28ON386991788e-14
KLTH0F08668g8.389ON358491771e-13
TDEL0F051308.389ON3591031761e-13
Ecym_41788.389ON3681331761e-13
KLLA0C06204g6.28ON3772901771e-13
Kwal_23.33028.389ON353491733e-13
AGL125C8.389ON367541743e-13
KAFR0A051306.28ON3961291717e-13
TPHA0P015603.12ON331521691e-12
KLLA0E02069g3.12ON3251271681e-12
Smik_15.1676.28ON378641672e-12
KNAG0A027108.389ON354961672e-12
Ecym_30326.28ON3771771663e-12
NCAS0D021406.28ON3761241646e-12
Skud_15.1596.28ON3791261646e-12
TDEL0G044106.28ON3811421646e-12
ADL197C3.12ON3901331646e-12
Kpol_1037.236.28ON3781531636e-12
SAKL0E01518g6.28ON3791571637e-12
YOL003C (PFA4)6.28ON3781421621e-11
KLTH0C10978g6.28ON377571621e-11
TPHA0J003906.28ON380931602e-11
TDEL0A003103.12ON329491573e-11
ZYRO0C03410g3.12ON327491565e-11
TBLA0H001503.12ON345531565e-11
Suva_15.1726.28ON3982001575e-11
ZYRO0C07546g6.28ON3771171557e-11
Kwal_55.221263.12ON3601401541e-10
Kpol_1014.293.12ON326531522e-10
Ecym_20143.12ON339531522e-10
NDAI0G013403.12ON335661512e-10
NCAS0E013003.12ON327491476e-10
SAKL0C13596g3.12ON333491476e-10
Smik_14.63.12ON3341611451e-09
YNL326C (PFA3)3.12ON336641432e-09
ACL003C6.28ON3751171432e-09
Skud_14.153.12ON336601423e-09
KAFR0A085903.12ON331481396e-09
CAGL0D02508g3.12ON332491397e-09
Suva_14.153.12ON330641398e-09
KNAG0K025703.12ON328491352e-08
Skud_4.7345.579ON3801901317e-08
TBLA0E028305.579ON3861101301e-07
TBLA0B004806.28ON377461282e-07
KAFR0I011105.579ON3701001149e-06
Kpol_1004.575.579ON3621061132e-05
KLTH0G04972g5.579ON3671071122e-05
Ecym_41145.579ON372621122e-05
KNAG0C028305.579ON3541031113e-05
Smik_4.7375.579ON3781921103e-05
CAGL0K06347g5.579ON3521771061e-04
Kwal_47.183665.579ON3561081051e-04
Kpol_526.325.626ON777711043e-04
ZYRO0C11132g5.626ON7591981024e-04
YDR459C (PFA5)5.579ON3741751014e-04
ZYRO0D13860g5.579ON365851005e-04
KNAG0B031405.626ON6821261016e-04
TDEL0A044405.579ON36555997e-04
Suva_2.6345.579ON38854980.001
ABR203W5.579ON35954960.002
SAKL0G06160g5.579ON364161960.002
KLLA0D06149g5.579ON34966960.002
NCAS0F013905.579ON37448960.002
CAGL0M08712g5.626ON763165960.003
NDAI0H018905.579ON40689910.007
SAKL0G07326g5.626ON73749910.010
KAFR0H005705.626ON75760840.063
TDEL0A049205.626ON75087830.084
NDAI0H008505.626ON78671820.10
TBLA0J008305.626ON739106820.12
Suva_2.4325.626ON76350810.13
KLTH0E02420g5.626ON734106810.14
NCAS0C052805.626ON75755810.14
KLLA0E16721g5.626ON75256810.16
Smik_15.2135.626ON744153810.16
Smik_4.5155.626ON76449800.20
YDR264C (AKR1)5.626ON76450800.21
Skud_4.5275.626ON76450790.30
TPHA0C003705.626ON75949780.33
TBLA0A069905.549ON14650740.44
YOR034C (AKR2)5.626ON74958760.58
Suva_4.498.446ON68759760.62
Skud_15.1995.626ON741159760.65
Suva_8.875.626ON73071750.77
YDL199C8.446ON68743741.1
Kpol_1060.306.269ON151337721.9
AER388C5.626ON72447712.2
Skud_4.588.446ON68743694.6
KAFR0B051502.397ON23898675.2
KAFR0C059605.626ON72745677.7
Ecym_13305.626ON73962677.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0F04130
         (328 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.28...   637   0.0  
Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W ...   330   e-112
ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {O...   317   e-107
NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON}     306   e-103
KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {...   305   e-102
Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON} (35544.....   301   e-101
TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {...   298   2e-99
Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W ...   297   3e-99
Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W ...   294   4e-98
YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}  SWF1Palmit...   293   1e-97
NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8....   293   2e-97
TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {O...   291   7e-97
CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar...   286   7e-95
KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON...   268   1e-87
KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]...   265   3e-86
SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]...   252   5e-79
Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}...   230   6e-73
AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic hom...   228   4e-72
Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {...   225   5e-71
KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} simil...   219   6e-69
NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389     82   7e-17
Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246...    81   2e-16
TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.3...    81   2e-16
NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389     79   1e-15
ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {...    79   1e-15
SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} simi...    78   2e-15
CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {O...    77   2e-15
KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]...    77   3e-15
YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subun...    77   3e-15
Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246...    77   3e-15
Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003...    77   3e-15
KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.3...    77   4e-15
Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246...    77   4e-15
NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28      77   4e-15
TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.3...    76   1e-14
CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {...    74   5e-14
KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} simi...    74   5e-14
KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {O...    73   8e-14
KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} simila...    73   1e-13
TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {O...    72   1e-13
Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar t...    72   1e-13
KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {...    73   1e-13
Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W...    71   3e-13
AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON} S...    72   3e-13
KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa] ...    70   7e-13
TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.1...    70   1e-12
KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {O...    69   1e-12
Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {...    69   2e-12
KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.3...    69   2e-12
Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to ...    69   3e-12
NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {O...    68   6e-12
Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {...    68   6e-12
TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {O...    68   6e-12
ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON} S...    68   6e-12
Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {O...    67   6e-12
SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} simila...    67   7e-12
YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON} ...    67   1e-11
KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {...    67   1e-11
TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28...    66   2e-11
TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON} ...    65   3e-11
ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar...    65   5e-11
TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}...    65   5e-11
Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {...    65   5e-11
ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {...    64   7e-11
Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL3...    64   1e-10
Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON} (48992.....    63   2e-10
Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON} s...    63   2e-10
NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12      63   2e-10
NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON...    61   6e-10
SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} simi...    61   6e-10
Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON} ...    60   1e-09
YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}  P...    60   2e-09
ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON} S...    60   2e-09
Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}...    59   3e-09
KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3....    58   6e-09
CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar...    58   7e-09
Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON} ...    58   8e-09
KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.1...    57   2e-08
Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {...    55   7e-08
TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.5...    55   1e-07
TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28 ...    54   2e-07
KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.5...    49   9e-06
Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa] ...    48   2e-05
KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {...    48   2e-05
Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}...    48   2e-05
KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {O...    47   3e-05
Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {...    47   3e-05
CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa] ...    45   1e-04
Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459...    45   1e-04
Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}...    45   3e-04
ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {...    44   4e-04
YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}...    44   4e-04
ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]...    43   5e-04
KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.6...    44   6e-04
TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {O...    43   7e-04
Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {...    42   0.001
ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic ho...    42   0.002
SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {...    42   0.002
KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} simila...    42   0.002
NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {O...    42   0.002
CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} simil...    42   0.003
NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {O...    40   0.007
SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {...    40   0.010
KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.6...    37   0.063
TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {O...    37   0.084
NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.6...    36   0.10 
TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {...    36   0.12 
Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON...    36   0.13 
KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {...    36   0.14 
NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa] ...    36   0.14 
KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} simi...    36   0.16 
Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {...    36   0.16 
Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON...    35   0.20 
YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}  ...    35   0.21 
Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON...    35   0.30 
TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626...    35   0.33 
TBLA0A06990 Chr1 (1707542..1707982) [441 bp, 146 aa] {ON} Anc_5....    33   0.44 
YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON} ...    34   0.58 
Suva_4.49 Chr4 complement(89704..91767) [2064 bp, 687 aa] {ON} Y...    34   0.62 
Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {...    34   0.65 
Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}...    33   0.77 
YDL199C Chr4 complement(101290..103353) [2064 bp, 687 aa] {ON} P...    33   1.1  
Kpol_1060.30 s1060 complement(71627..76168) [4542 bp, 1513 aa] {...    32   1.9  
AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}...    32   2.2  
Skud_4.58 Chr4 complement(98588..100651) [2064 bp, 687 aa] {ON} ...    31   4.6  
KAFR0B05150 Chr2 complement(1059558..1060274) [717 bp, 238 aa] {...    30   5.2  
KAFR0C05960 Chr3 complement(1187537..1189720) [2184 bp, 727 aa] ...    30   7.7  
Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar t...    30   7.8  

>TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.286
           YDR126W
          Length = 328

 Score =  637 bits (1644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/307 (100%), Positives = 307/307 (100%)

Query: 22  SPFYKVKWPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFYLSLYCYIIFVLIRDVIPVIGN 81
           SPFYKVKWPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFYLSLYCYIIFVLIRDVIPVIGN
Sbjct: 22  SPFYKVKWPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFYLSLYCYIIFVLIRDVIPVIGN 81

Query: 82  RLLSVEKLCIIPVLVVATPVLGWLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTC 141
           RLLSVEKLCIIPVLVVATPVLGWLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTC
Sbjct: 82  RLLSVEKLCIIPVLVVATPVLGWLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTC 141

Query: 142 HIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRVLW 201
           HIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRVLW
Sbjct: 142 HIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRVLW 201

Query: 202 ISVMKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGEKDKWYTIQQIM 261
           ISVMKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGEKDKWYTIQQIM
Sbjct: 202 ISVMKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGEKDKWYTIQQIM 261

Query: 262 REGNLVRTLDGQFFIQDQQNPNQFYSTNAYDSKLYVPQNYSIVNDPKDITNIYDQGSFWY 321
           REGNLVRTLDGQFFIQDQQNPNQFYSTNAYDSKLYVPQNYSIVNDPKDITNIYDQGSFWY
Sbjct: 262 REGNLVRTLDGQFFIQDQQNPNQFYSTNAYDSKLYVPQNYSIVNDPKDITNIYDQGSFWY 321

Query: 322 KLERLCT 328
           KLERLCT
Sbjct: 322 KLERLCT 328

>Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W
           (REAL)
          Length = 336

 Score =  330 bits (847), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 158/313 (50%), Positives = 216/313 (69%), Gaps = 20/313 (6%)

Query: 22  SPFYKVKWPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFYLSLYCYIIFVLIRDVIPVIGN 81
           SP +K  WPFS  Y R+F+P + +DQ++RWKF++VP FY S+Y Y+++     V P+I N
Sbjct: 20  SPVFKSTWPFSTLYRRVFQPFVSDDQKYRWKFHLVPLFYTSIYLYLVYTYHAKVEPLIKN 79

Query: 82  RLLSVEKLCIIPVLVVATPVLGWLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTC 141
            L  +E++ I P++++    LG L+M  KA+ S   +PGS ++Y YDY++YYP+VQC TC
Sbjct: 80  DLFLLERILIGPIIILPPVALGILAMVTKAEDSNVHRPGSTEKYPYDYLIYYPDVQCSTC 139

Query: 142 HIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRVLW 201
            I KPARSRHC++C  C+LVADHHC+WVNNCIGKGNY  FY FL+ N++S+SY FLR+  
Sbjct: 140 RITKPARSRHCSICNRCILVADHHCIWVNNCIGKGNYIQFYLFLISNIVSMSYAFLRLCS 199

Query: 202 ISVMKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGEKDKWYTIQQIM 261
           IS+    ++   PR++L  +ILCG F IIC +FTYLQL +V +GMTT E+DKWYTIQ+ M
Sbjct: 200 ISLKSSTAL---PRAVLTLSILCGCFTIICAIFTYLQLAIVREGMTTNEQDKWYTIQEYM 256

Query: 262 REGNLVRTL---------------DGQFFIQDQQNPNQFYSTNAYDSKLYVPQNYSIVND 306
           REG LVR+L               D    +QDQQ    FYSTNAYD K Y+  +Y  + D
Sbjct: 257 REGKLVRSLNDDPQSWFLKLTEKGDAAEPLQDQQ--GTFYSTNAYDHKRYILMHYITIKD 314

Query: 307 PKDITNIYDQGSF 319
             +ITN+YD+G+F
Sbjct: 315 ASEITNVYDKGTF 327

>ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {ON}
           similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 330

 Score =  317 bits (811), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 149/312 (47%), Positives = 216/312 (69%), Gaps = 8/312 (2%)

Query: 22  SPFYKVKWPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFYLSLYCYIIFVLIRDVIPVIGN 81
           SP +K +WPFS YY  +F PL Q++ RFRWKFY+VP FY S+Y  ++ + I++VIP +  
Sbjct: 19  SPLFKYQWPFSLYYKYVFLPLFQDNDRFRWKFYLVPLFYSSIYLGVVHLAIKNVIPQLSP 78

Query: 82  RLLSVEKLCIIPVLVVATPVLGWLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTC 141
            L   +    IP  +V TP  G L+  +  +T++ C+  +  ++ YD +L+YPN+ CRTC
Sbjct: 79  GLNFFDYWFFIPFFIVLTPATGILAAIIGPETTKSCKRRNIDKFRYDNLLFYPNINCRTC 138

Query: 142 HIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRVLW 201
            + KPARS+HCN+C +CVL  DHHC+W+NNC+G GNY +FY FLV+N +S+SY F+R + 
Sbjct: 139 QLPKPARSKHCNVCNQCVLAVDHHCIWINNCVGLGNYLYFYLFLVLNSLSMSYAFIRSMS 198

Query: 202 ISVMKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGEKDKWYTIQQIM 261
           I  +K P+ + YPRSIL F +L G FA+IC VFTYLQL +V +GMTT EKDKW+TI + M
Sbjct: 199 IVGLK-PN-IKYPRSILAFNLLTGCFALICIVFTYLQLCMVREGMTTNEKDKWFTIHEYM 256

Query: 262 REGNLVRTLDGQFF--IQDQ----QNPNQFYSTNAYDSKLYVPQNYSIVNDPKDITNIYD 315
           RE  LV++  G+++  + D+     + ++F+STN YD +LY  Q+Y+++ D + I NIYD
Sbjct: 257 REKRLVKSSSGKWYYDLTDRLDLPTDQHEFFSTNPYDGRLYRLQSYTLIEDAERINNIYD 316

Query: 316 QGSFWYKLERLC 327
           +GSF   L  LC
Sbjct: 317 EGSFMANLRTLC 328

>NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  306 bits (783), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 146/312 (46%), Positives = 207/312 (66%), Gaps = 9/312 (2%)

Query: 22  SPFYKVKWPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFYLSLYCYIIFVLIRDVIPVIGN 81
           SP Y++ WPFS YY ++F PL+Q++++F+ KFY++P FY  LY Y+I+     V P I N
Sbjct: 20  SPRYRLIWPFSVYYKKVFHPLIQDNKKFKIKFYIIPIFYFVLYLYLIYCYYSKVAPFINN 79

Query: 82  RLLSVEKLCIIPVLVVATP-VLGWLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRT 140
           +L + EK   IP++++A+P + G  +M  K   ++        EY +D +++YP + CRT
Sbjct: 80  QLWAFEKYMWIPLIIIASPLIFGVFTMFTKPTYTKKYSDEIDNEYAFDNLIFYPQILCRT 139

Query: 141 CHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRVL 200
           C   KPARS+HC++C  CVLVADHHC+WVNNC+GKGNY +FY FL+ N  SL+Y F+R+L
Sbjct: 140 CQSYKPARSKHCSICDRCVLVADHHCIWVNNCVGKGNYTYFYMFLITNTFSLTYAFIRLL 199

Query: 201 WISVMKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGEKDKWYTIQQI 260
            I    +   V  P++ L  TILCG F++ICG+FT+LQL L  +GMTT EKDKW+T+ + 
Sbjct: 200 TIFYTTN---VYLPKNTLTLTILCGCFSVICGIFTFLQLNLAQEGMTTNEKDKWFTVHEF 256

Query: 261 MREGNLVRTLDGQFFIQDQQNPN-----QFYSTNAYDSKLYVPQNYSIVNDPKDITNIYD 315
           MR+G LVRT  G+++  D  + +      FYSTN YD   Y  +N+ I+ DP  ITNIYD
Sbjct: 257 MRDGKLVRTQSGRWYFADPHDSDISEDSVFYSTNGYDHTEYTLRNFEIIEDPSRITNIYD 316

Query: 316 QGSFWYKLERLC 327
           +G F   L  LC
Sbjct: 317 RGDFLANLRDLC 328

>KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score =  305 bits (782), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 144/310 (46%), Positives = 209/310 (67%), Gaps = 7/310 (2%)

Query: 22  SPFYKVKWPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFYLSLYCYIIFVLIRDVIPVIGN 81
           SP  K  W FS+YY RIF P L++D++++WK+++VP FY++LY Y++ +    + P+I +
Sbjct: 21  SPTLKEFWLFSFYYQRIFVPFLKDDRKYKWKYHLVPIFYVTLYTYMVLLYFTKLNPIIKS 80

Query: 82  RLLSVEKLCIIPVLVVATPVLGWLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTC 141
           +L  +E+  IIP  ++ + + G L+M ++ ++S G      Q++++D +++YPN  C TC
Sbjct: 81  QLTILERWVIIPFSLLISLLSGILTMRIRPESSLGFNSSPYQDFEFDSLIFYPNTFCSTC 140

Query: 142 HIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRVLW 201
            +EKPARS+HCN+C  CVL++DHHC+W NNCIG GNYQ+FY FLV N + L Y FLR++ 
Sbjct: 141 RLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAFLRIIL 200

Query: 202 ISVMKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGEKDKWYTIQQIM 261
           ++   D   + +P  +L F IL G F  I  VFTYLQ  LV DGMTT EKDKW+TIQ+ M
Sbjct: 201 LTAYSD---IGFPNIVLTFLILSGAFFAILLVFTYLQFALVYDGMTTNEKDKWFTIQEFM 257

Query: 262 REGNLVRTLDGQFFIQDQQNP----NQFYSTNAYDSKLYVPQNYSIVNDPKDITNIYDQG 317
           REG L+RT +GQ+ I   + P     +FYSTNAYD  +Y P N+  +    +I NIYD+G
Sbjct: 258 REGRLIRTDNGQWLIAHPEEPAGQATRFYSTNAYDHTIYCPVNFRPITHHDEIPNIYDKG 317

Query: 318 SFWYKLERLC 327
           SF   L+ LC
Sbjct: 318 SFLKNLKELC 327

>Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON}
           (35544..36509) [966 nt, 322 aa]
          Length = 321

 Score =  301 bits (772), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 145/307 (47%), Positives = 197/307 (64%), Gaps = 5/307 (1%)

Query: 22  SPFYKVKWPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFYLSLYCYIIFVLIRDVIPVIGN 81
           SP +K+ WP S YYT+ +RP   + +R+RWK+Y+VP  YL LY ++I      V  ++  
Sbjct: 19  SPIFKLTWPLSIYYTKFYRPFFLDKERYRWKYYLVPGLYLGLYLFVIIYYHLRVNFMVNP 78

Query: 82  RLLSVEKLCIIPVLVVATPVLGWLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTC 141
            L   EK  I+P++  + P  G ++M  K + S      S   Y +D ILY+PNV C+TC
Sbjct: 79  HLYWFEKGLILPIMFTSLPYFGVMTMITKPENSIEHGINSNNRYRFDEILYFPNVSCKTC 138

Query: 142 HIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRVLW 201
              KPARS+HC++C +C+L+ DHHC+WVNNCIG GNY++FY F+  N +++ Y F R+L+
Sbjct: 139 RKPKPARSKHCSICDKCILLQDHHCIWVNNCIGMGNYKWFYLFIGGNSLTMIYCFTRLLF 198

Query: 202 ISVMKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGEKDKWYTIQQIM 261
           IS+      V   R+IL   ILCG+FAIIC VFTYLQL LV+ G+TT E DKWYTI +  
Sbjct: 199 ISIKYK---VTSSRAILTMNILCGSFAIICSVFTYLQLDLVSQGITTNEMDKWYTIHEYC 255

Query: 262 REGNLVRTLDGQFFIQDQQNPNQFYSTNAYDSKLYVPQNYSIVNDPKDITNIYDQGSFWY 321
           R+G L R+  G +F+ D    N FYSTN YD   Y P  Y+I+NDP DI NIYD+GS W 
Sbjct: 256 RDGKLARSKSGNWFLIDSN--NTFYSTNIYDHTRYSPTQYTIINDPTDIQNIYDKGSCWL 313

Query: 322 KLERLCT 328
               +CT
Sbjct: 314 NFIDICT 320

>TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score =  298 bits (762), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 134/308 (43%), Positives = 203/308 (65%), Gaps = 2/308 (0%)

Query: 22  SPFYKVKWPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFYLSLYCYIIFVLIRDVIPVIGN 81
           SPF+K     S YY   + P++Q+++++RWKF++VP FY++L+ Y++      V P+I +
Sbjct: 21  SPFFKNTPFISIYYKYAYEPVVQDNKKYRWKFHIVPIFYITLFIYLVINFYAKVEPLIHD 80

Query: 82  RLLSVEKLCIIPVLVVATPVLGWLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTC 141
           +L   E+   IP+ +++TP  G ++M +   T+      S ++Y YD ILY+P+ +C+TC
Sbjct: 81  KLTYFERFFFIPISIISTPFFGIITMLINPDTALMYSNDSIKKYAYDRILYFPDTECKTC 140

Query: 142 HIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRVLW 201
            +EKPARS+HC +C +C+LV DHHCVWVNNCIG+GN+ +FY FL  N + +SY  +R+L 
Sbjct: 141 KVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNFLYFYLFLFDNTLFMSYASMRLLE 200

Query: 202 ISVMKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGEKDKWYTIQQIM 261
           I++    +    PR ++   ILCG F  ICG F+Y+QL +V DGMTT EKDKWYTIQ +M
Sbjct: 201 ITLNFRRAGENVPRDVMTLDILCGCFLFICGTFSYMQLLIVKDGMTTNEKDKWYTIQCLM 260

Query: 262 REGNLVRTLDGQFFIQ--DQQNPNQFYSTNAYDSKLYVPQNYSIVNDPKDITNIYDQGSF 319
            +  LV++ D  ++I   + Q   +FYSTNAYD K Y    Y ++++ +DI NIYD+GS 
Sbjct: 261 EDKKLVKSSDNNWYISFVNDQGETEFYSTNAYDHKKYQLTEYKVIDNVEDIPNIYDKGSL 320

Query: 320 WYKLERLC 327
           W   +  C
Sbjct: 321 WKNFKDFC 328

>Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score =  297 bits (760), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 161/318 (50%), Positives = 216/318 (67%), Gaps = 16/318 (5%)

Query: 22  SPFYKVKWPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFYLSLYCYIIFVLIRDVIPVIGN 81
           SP +K  WPFS +Y R+F+P + +D ++RWKF++VP FY S+Y Y++F     V P+I N
Sbjct: 20  SPVFKSTWPFSTFYRRVFQPFVTDDHKYRWKFHLVPLFYTSIYLYLVFTYHTRVEPLIKN 79

Query: 82  RLLSVEKLCIIPVLVVATPVLGWLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTC 141
            L  +E++ I+P++++   VLG L+M  KA+ S   + GS ++Y YDY+LYYP V+C TC
Sbjct: 80  ELFLLERILIVPIIILPPVVLGILAMVTKAEDSNNHKLGSTEKYPYDYLLYYPGVKCSTC 139

Query: 142 HIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRVLW 201
              K ARS+HC++C  CVLVADHHC+WVNNCIGKGNY  FY FL  N+ S+SY FLR+ +
Sbjct: 140 RTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFLRLYF 199

Query: 202 ISVMKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGEKDKWYTIQQIM 261
           IS     S  V PR++L  TILCG F IIC +FTYLQL +V +GMTT E+DKWYTIQ+ M
Sbjct: 200 ISF---NSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYM 256

Query: 262 REGNLVRTLDG---QFFIQ-----DQQNPNQ-----FYSTNAYDSKLYVPQNYSIVNDPK 308
           REG LVR+LD     +F++     D   P Q     FYSTNAYD   Y  ++Y+ + D  
Sbjct: 257 REGKLVRSLDDDSRSWFLKFTEKGDTGQPLQDQHVTFYSTNAYDHHRYRLKHYTTIKDAS 316

Query: 309 DITNIYDQGSFWYKLERL 326
           +ITNIYD+G+F   L  L
Sbjct: 317 EITNIYDKGTFLANLVDL 334

>Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score =  294 bits (753), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 152/312 (48%), Positives = 207/312 (66%), Gaps = 19/312 (6%)

Query: 22  SPFYKVKWPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFYLSLYCYIIFVLIRDVIPVIGN 81
           SP +K  WPFS +Y  +F+P + +DQ++RWKF++VP FY  +Y Y+++     V  ++ +
Sbjct: 20  SPVFKSTWPFSTFYRNVFQPFIADDQKYRWKFHLVPIFYTLIYLYLVYTYHTRVEWLVRS 79

Query: 82  RLLSVEKLCIIPVLVVATPVLGWLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTC 141
            L   E++ ++P++ +A    G L M  KA+ S   +PGS ++Y YDY+LYYP V+C TC
Sbjct: 80  ELFLCERILVVPIITLAPIACGILVMVTKAEDSYHHKPGSTEKYPYDYLLYYPVVKCSTC 139

Query: 142 HIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRVLW 201
           HI KPARS+HC++C  C+LVADHHC+WVNNCIGKGNY  FY FL+ N+ SL Y FLR+  
Sbjct: 140 HIIKPARSKHCSICNRCILVADHHCIWVNNCIGKGNYLQFYLFLISNIFSLLYAFLRLWC 199

Query: 202 ISVMKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGEKDKWYTIQQIM 261
           IS+    ++   PR++L  TILCG F IIC +FTYLQL +V +GMTT E+DKWYTIQ+ M
Sbjct: 200 ISLNSKTAL---PRAVLTLTILCGCFTIICIIFTYLQLTIVREGMTTNEQDKWYTIQEYM 256

Query: 262 REGNLVRTL--------------DGQFFIQDQQNPNQFYSTNAYDSKLYVPQNYSIVNDP 307
           REG LVR+L              D     QDQ     FYSTNAYD K Y   +Y  + D 
Sbjct: 257 REGKLVRSLNDNCQSWFLKLTEDDTTKLTQDQHAT--FYSTNAYDHKQYNLAHYITIKDA 314

Query: 308 KDITNIYDQGSF 319
            +I+NIYD+G+F
Sbjct: 315 SEISNIYDKGTF 326

>YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}
           SWF1Palmitoyltransferase that acts on transmembrane
           proteins, including the SNAREs Snc1p, Syn8p, Tlg1p and
           likely all SNAREs; contains an Asp-His-His-Cys-cysteine
           rich (DHHC-CRD) domain; may have a role in vacuole
           fusion
          Length = 336

 Score =  293 bits (750), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 156/319 (48%), Positives = 212/319 (66%), Gaps = 17/319 (5%)

Query: 22  SPFYKVKWPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFYLSLYCYIIFVLIRDVIPVIGN 81
           SP +K  WPFS +Y  +F+P L +DQ++RWK ++VP FY S+Y Y+++     V   I N
Sbjct: 20  SPVFKSTWPFSTFYRNVFQPFLVDDQKYRWKLHLVPLFYTSIYLYLVYTYHMRVESTIKN 79

Query: 82  RLLSVEKLCIIPVLVVATPVLGWLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTC 141
            L  +E++ I+P++++    LG L+M  +A+ S+  + GS +EY YDY+LYYP ++C TC
Sbjct: 80  ELFLLERILIVPIIILPPVALGILAMVSRAEDSKDHKSGSTEEYPYDYLLYYPAIKCSTC 139

Query: 142 HIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRVLW 201
            I KPARS+HC++C  CVLVADHHC+W+NNCIGKGNY  FY FL+ N+ S+ Y FLR+ +
Sbjct: 140 RIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFLRLWY 199

Query: 202 ISVMKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGEKDKWYTIQQIM 261
           IS+    ++   PR++L  TILCG F IIC +FTYLQL +V +GMTT E+DKWYTIQ+ M
Sbjct: 200 ISLNSTSTL---PRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYM 256

Query: 262 REGNLVRTLDGQ----FF-----IQDQQNPNQ-----FYSTNAYDSKLYVPQNYSIVNDP 307
           REG LVR+LD      FF       D   P Q     FYSTNAYD K Y   +Y  + D 
Sbjct: 257 REGKLVRSLDDDCPSWFFKCTEQKDDAAEPLQDQHVTFYSTNAYDHKHYNLTHYITIKDA 316

Query: 308 KDITNIYDQGSFWYKLERL 326
            +I NIYD+G+F   L  L
Sbjct: 317 SEIPNIYDKGTFLANLTDL 335

>NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8.286
           YDR126W
          Length = 339

 Score =  293 bits (749), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 148/322 (45%), Positives = 208/322 (64%), Gaps = 22/322 (6%)

Query: 22  SPFYKVKWPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFYLSLYCYIIFVLIRDVIPVIGN 81
           SP YK + PFS YY  +F+P++Q+  R+RWK+++VP FYL+L+ Y+ +     V P+I +
Sbjct: 21  SPRYKNRSPFSIYYRHVFQPIVQDSHRYRWKYHLVPFFYLTLFIYLTYCYYTKVEPLIAS 80

Query: 82  RLLSVEKLCIIPVLVVATPVLGWLSMTVKAKT--SRGCQPGSAQEYDYDYILYYPNVQCR 139
           +L  +E    IP ++ +  + G L+M     T  +R  Q      Y YD I+YYPN++CR
Sbjct: 81  QLYFIEVWIWIPFMIFSPVIFGILTMVTIPNTVNNRRNQEKVLYRYPYDEIMYYPNIECR 140

Query: 140 TCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRV 199
           TC I KPARS+HC +C  C+L+ DHHC+WVNNCIG+GNY +FY+FL+ N I+++Y F+R+
Sbjct: 141 TCGIVKPARSKHCEICNSCILLCDHHCLWVNNCIGEGNYLYFYSFLLCNCITMTYSFIRL 200

Query: 200 LWISVMKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGEKDKWYTIQQ 259
               +M         R+IL   ILCG+FA+IC  FT+LQLQLV DGMTT E+DKW+T+Q+
Sbjct: 201 F---LMYCQGHAPSSRNILTLLILCGSFAVICAGFTFLQLQLVKDGMTTNEQDKWFTLQE 257

Query: 260 IMREGNLVRTLD-GQFFIQDQQNPNQ-----------FYSTNAYDSKLY--VPQNYSIVN 305
            MR+G L+RT D  ++FI    NPN            FYSTNAYD + Y      Y+IV 
Sbjct: 258 YMRDGKLIRTKDENKWFI---ANPNDDATITINADTIFYSTNAYDHEGYHLSSDEYTIVE 314

Query: 306 DPKDITNIYDQGSFWYKLERLC 327
           DP+ ITN+YD G F+  L+  C
Sbjct: 315 DPRQITNLYDSGDFFTNLKDFC 336

>TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {ON}
           Anc_8.286 YDR126W
          Length = 333

 Score =  291 bits (745), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 142/316 (44%), Positives = 207/316 (65%), Gaps = 11/316 (3%)

Query: 22  SPFYKVKWPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFYLSLYCYIIFVLIRDVIPVIGN 81
           SPF K +WPFS YY R++ P L++   ++WK++VVP FY S+Y Y+++     V  +I N
Sbjct: 19  SPFLKNRWPFSVYYRRLYVPYLKDVNSYKWKYHVVPGFYFSIYLYLVYCYYAKVEYLIVN 78

Query: 82  RLLSVEKLCIIPVLVVATPVLGWLSMTVKAKTSRGC----QPGSAQEYDYDYILYYPNVQ 137
            L   E+  ++P+L+V TP  G L+M  K     G           ++ +D I+Y+    
Sbjct: 79  HLNLFERGILLPLLIVLTPSFGILTMVTKPINIHGNGISQHDKLKNKFPFDNIIYHSGNV 138

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFL 197
           C TC+IEKPARS+HCN+C  C+L+ DHHC+WVNNCIG GNY++F+ FL++N ISLSY FL
Sbjct: 139 CSTCNIEKPARSKHCNICGTCILLQDHHCIWVNNCIGLGNYKYFFMFLLLNTISLSYAFL 198

Query: 198 RVLWISVMKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGEKDKWYTI 257
           R+L I++ K    V   ++IL   IL G+F++ICGVF YLQ++ VN+GMTT E DKWY +
Sbjct: 199 RLLHITLSKPD--VPKSKNILALCILTGSFSVICGVFFYLQMKQVNNGMTTNETDKWYAV 256

Query: 258 QQIMREGNLVRTLDGQFFIQDQQN----PNQFYSTNAYDSKLY-VPQNYSIVNDPKDITN 312
           Q++MREG L+++ D  +F    ++    P+Q YSTN YD+K Y +  +Y IV D  +I N
Sbjct: 257 QELMREGKLIKSEDNNWFALSTEDAPDSPSQVYSTNFYDNKTYKISNDYHIVKDASEIPN 316

Query: 313 IYDQGSFWYKLERLCT 328
           +YD+G+F   L+  C 
Sbjct: 317 VYDRGTFLDNLKGFCN 332

>CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar to
           uniprot|Q04629 Saccharomyces cerevisiae YDR126w
          Length = 330

 Score =  286 bits (731), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 131/308 (42%), Positives = 197/308 (63%), Gaps = 4/308 (1%)

Query: 23  PFYKVKWPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFYLSLYCYIIFVLIRDVIPVIGNR 82
           P ++ K+ F WYY  +++P++ ++ R+R KFYVVP FYLS+Y Y++++       +I   
Sbjct: 21  PQFRDKFIFRWYYDEVYKPMILDNSRYRIKFYVVPVFYLSVYSYMVYIFYSRTFAIISPM 80

Query: 83  LLSVEKLCIIPVLVVATPVLGWLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTCH 142
           L S+E   +IP++++     G +SM +K  +S   Q GS + Y YD +LY+P  +CRTC 
Sbjct: 81  LTSIETYVVIPLMLILPLFFGSMSMIIKPDSSNAHQIGSEKRYPYDNLLYFPQHECRTCK 140

Query: 143 IEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRVLWI 202
             KPARS+HC +C  C+ +ADHHCVW+NNC+G GNY +FY+FL  N++ LSY F+R+++I
Sbjct: 141 QVKPARSKHCTVCNSCIYLADHHCVWINNCVGMGNYMYFYSFLCSNLLLLSYSFIRLIFI 200

Query: 203 SVMKDP--SMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGEKDKWYTIQQI 260
              K    +     +S+LI +ILCG+F +I  V+ Y   +LVN GMTT EKDKW  +   
Sbjct: 201 QFNKSAYNTTPTGEKSLLILSILCGSFTVILAVYCYFVFELVNSGMTTNEKDKWQMVHDY 260

Query: 261 MREGNLVRTLDGQFFIQDQQNPN--QFYSTNAYDSKLYVPQNYSIVNDPKDITNIYDQGS 318
           +  G+LVR  +G++FI+ Q   N  +FYST++YD   Y   +Y  V  P +ITNIYD+G+
Sbjct: 261 INTGDLVRDPEGKYFIKYQNGGNNYEFYSTDSYDGTQYTIVDYFTVKSPAEITNIYDKGN 320

Query: 319 FWYKLERL 326
           F   L   
Sbjct: 321 FINNLREF 328

>KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON}
           Anc_8.286 YDR126W
          Length = 331

 Score =  268 bits (684), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 133/307 (43%), Positives = 197/307 (64%), Gaps = 9/307 (2%)

Query: 28  KWPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFYLSLYCYIIFVLIRDVIPVIGNRLLSVE 87
           +WP SWYY +++RP L +  R+R K+Y+VP FY SLYCY++ +   +++PVI  RL  +E
Sbjct: 26  QWPLSWYYEKVYRPFLADPTRYRVKYYIVPVFYFSLYCYMLNLYRSELLPVIWGRLYFIE 85

Query: 88  KLCIIPVLVVATPVLGWLSMTVKAKTSRGCQPG---SAQEYDYDYILYYPNVQCRTCHIE 144
                P+L+ A PV G L+M  + +   G   G   S  ++ YD ILYYPN  CR+CH  
Sbjct: 86  LYFFQPLLLAAIPVSGLLTMFTRPEGCGGRDQGVAPSEGQWPYDGILYYPNTTCRSCHTV 145

Query: 145 KPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRVLWISV 204
           K ARS+HC++CR C+ +ADHHC+W N CIG+GN+ +FY FL  + + L+Y F R+ +  V
Sbjct: 146 KWARSKHCSICRRCIQLADHHCIWFNTCIGRGNFFYFYVFLACHCLILTYAFARLFFFVV 205

Query: 205 MKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGEKDKWYTIQQIMREG 264
           + D  +    RS L   +L GTFA++  +FTY Q+ LV +GMTT E+DKW+ I + MR+G
Sbjct: 206 VADNKLTS-TRSTLTLLMLTGTFALLVDLFTYWQMMLVKEGMTTNEQDKWFLIHEYMRDG 264

Query: 265 NLVR-TLDG---QFFIQDQQNPNQFYSTNAYDSKLYVPQNYSIVNDPKDITNIYDQGSFW 320
             V  + +G   ++F++  ++  +FYSTNAYD   Y   NY IV +  +I N+YD+GSFW
Sbjct: 265 KCVNVSCNGSTKKWFLESDED-GKFYSTNAYDHTAYTLTNYHIVKNASEIINMYDKGSFW 323

Query: 321 YKLERLC 327
              + +C
Sbjct: 324 ENFKDMC 330

>KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 349

 Score =  265 bits (676), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 136/332 (40%), Positives = 192/332 (57%), Gaps = 40/332 (12%)

Query: 22  SPFYKVKWPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFYLSLYCYIIFVLIRDVIPVIGN 81
           SP ++ K  F WYYTR+F P+ ++  RFRWKF  +PAFYLS+Y Y  F+  +D+  +I +
Sbjct: 21  SPLFRTKPVFRWYYTRVFHPIFEDVNRFRWKFRAIPAFYLSIYAYCTFLFFKDIEGLIRS 80

Query: 82  RLLSVEKLCIIPVLVVATPVLGWLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTC 141
           RL  VE+L IIPV + A  + G L++ +K K++       A    YD ++++  V CRTC
Sbjct: 81  RLFGVERLLIIPVALSAPIITGLLTIWIKPKSTYASPMLDA----YDELIFHSGVSCRTC 136

Query: 142 HIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRVLW 201
            + K AR++HC +C +CV +ADHHCVW NNCIG+GNYQ+FY FLV NV   +YGFLR+L+
Sbjct: 137 KLPKFARTKHCPICDQCVQLADHHCVWANNCIGRGNYQYFYLFLVSNVFLTNYGFLRLLF 196

Query: 202 ISVMKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGEKDKWYTIQQIM 261
           +         V+ R +LI +IL G F +I  VF+Y Q  LV DGMTT E++KW  I  ++
Sbjct: 197 L------QRFVHSRQLLILSILLGCFGVILAVFSYFQFVLVRDGMTTNEENKWLVIHDMI 250

Query: 262 REGNLVRTLDGQFFIQ------------------DQQNPNQF------------YSTNAY 291
           R   +V    G+++ +                    Q PN+F            YSTN Y
Sbjct: 251 RARQMVTDDTGKYYFRLLADCQEDSAESLTNPRHSSQGPNEFHLNDSSPDIYVYYSTNPY 310

Query: 292 DSKLYVPQNYSIVNDPKDITNIYDQGSFWYKL 323
           D+  Y  +N   +     ITNIYD+G FW  L
Sbjct: 311 DNATYDVKNPKEILSTAAITNIYDEGGFWKNL 342

>SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 555

 Score =  252 bits (644), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 121/291 (41%), Positives = 179/291 (61%), Gaps = 13/291 (4%)

Query: 22  SPFYKVKWPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFYLSLYCYIIFVLIRDVIPVIGN 81
           SP +K   PF WYY  IF PL ++  R+RWK+ VVP FY S+Y Y + +  +D+   +  
Sbjct: 19  SPLFKSVVPFHWYYAHIFHPLFKDTLRYRWKYNVVPLFYTSIYIYCVLMFYKDLYRDLSP 78

Query: 82  RLLSVEKLCIIPVLVVATPVLGWLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTC 141
            LL +E+  I+P+L++   + G+L MT++  +++     +     +D I+++P   C+TC
Sbjct: 79  YLLFLERFLIVPLLLLGPIITGYLCMTIEPDSTKSL---ADCRVPFDEIIFHPGTICQTC 135

Query: 142 HIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRVLW 201
           H  KPARS+HC++C +C+L+ DHHC+WVNNCIGKGNY++FY FL+ NV  LSY FLR+  
Sbjct: 136 HKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFLRLTS 195

Query: 202 ISVMKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGEKDKWYTIQQIM 261
           I +M   +  +  + +L+ TIL G F II  VF Y Q  LV+DGMTT E+DKW+T+Q+ M
Sbjct: 196 IQLMSQ-TENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMTTNEQDKWFTVQEFM 254

Query: 262 REGNLVRTLDGQFFI---------QDQQNPNQFYSTNAYDSKLYVPQNYSI 303
           R+GNLVR   G ++          +DQ+     Y +N     L    N  I
Sbjct: 255 RDGNLVRDKKGHYYFRILDESSSDRDQKEEEDSYRSNNKKKMLLENANTRI 305

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 41/70 (58%), Gaps = 3/70 (4%)

Query: 257 IQQIMREGNLVRTLDGQFFIQDQQNPNQ---FYSTNAYDSKLYVPQNYSIVNDPKDITNI 313
           +  + RE +L + + G F      +P +   FYSTN YD   Y  ++Y ++ DPKD+ NI
Sbjct: 480 VNALGRELDLAKDIGGGFPGHSNVSPKKNYRFYSTNPYDDLTYHVEDYDVIKDPKDLNNI 539

Query: 314 YDQGSFWYKL 323
           YD+G+FW  L
Sbjct: 540 YDKGNFWANL 549

>Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii AGR065W
          Length = 340

 Score =  230 bits (587), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 131/325 (40%), Positives = 189/325 (58%), Gaps = 26/325 (8%)

Query: 22  SPFYKVKWPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFYLSLYCYIIFVLIRDVIPVIGN 81
           SP +K   PF WYY  +FRPL ++++ ++WK+++VPAFY  +Y Y  FV    V   I +
Sbjct: 21  SPLFKSWQPFRWYYAAVFRPLFRQEEEYKWKYWLVPAFYTGIYIYCSFVFYVHVYGEIRS 80

Query: 82  RLLSVEKLCIIPVLVVATPVLGWLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTC 141
            L ++E  C+  VL +      +  +T    T     P    E  +D I+++ N+ CR+C
Sbjct: 81  GLYTLEARCLPVVLALPLLSGYYTIVTSPHDTITYVGP----EIPFDGIIFHDNIVCRSC 136

Query: 142 HIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRVLW 201
            ++K ARS+HC++C  C+LVADHHCVW+NNCIG GNYQ+FY FL+ N   LSY  +R   
Sbjct: 137 RLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSNCSMLSYATIR--- 193

Query: 202 ISVMKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGEKDKWYTIQQIM 261
           +S +    +    +S L   IL   FA+I   FTY+Q  LV DGMTT EKDKWYTI ++M
Sbjct: 194 LSSVAPSGLWRSNKSFLSLMILVCCFAVISISFTYMQFALVRDGMTTNEKDKWYTIHKLM 253

Query: 262 REGNLVR-TLDGQFFIQDQQNPN----------------QFYSTNAYDSKLY--VPQNYS 302
           R   L++   D +F+I+ + +P                 ++YSTN YD K Y     +Y 
Sbjct: 254 RNEQLLKLNNDCKFYIRIKNSPTPSSHTSTSTRTTHYQYEYYSTNPYDPKTYSLSDTSYH 313

Query: 303 IVNDPKDITNIYDQGSFWYKLERLC 327
           +VN  +DI NIYD+ SFW  L++ C
Sbjct: 314 VVNSYQDIPNIYDRCSFWQNLKQRC 338

>AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR126W (SWF1)
          Length = 326

 Score =  228 bits (580), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 123/301 (40%), Positives = 179/301 (59%), Gaps = 18/301 (5%)

Query: 22  SPFYKVKWPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFYLSLYCYIIFVLIRDVIPVIGN 81
           +P  +  WPFSWYY  +FR +LQ+ QR RWK++  PAFY  +Y Y +++   +V   I  
Sbjct: 19  APALRAYWPFSWYYHVVFRTVLQDTQRHRWKYWATPAFYAGVYAYCVWLFYGEVYAEIAK 78

Query: 82  RLLSVEKLCIIPVLVVATPVLGWLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTC 141
            L   E+  +   +V         + T  A  +         +  YD +L++  V+CRTC
Sbjct: 79  ALWVPERWVLPAAVVAPAAAGVAAAATPAAVPA---------DAAYDGLLFHDGVECRTC 129

Query: 142 HIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRVLW 201
            + KPARSRHC +C  CV +ADHHCVW+NNC+G+GNY  FY  L  +   L+YG +R+  
Sbjct: 130 RVRKPARSRHCGVCGRCVPLADHHCVWLNNCVGRGNYGLFYLALGAHCALLTYGAVRL-- 187

Query: 202 ISVMKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGEKDKWYTIQQIM 261
              +  P+   +PR++L   +L  +FA++C  FT  Q+ LV DGMTT E+DKWY +Q+ M
Sbjct: 188 --PLAAPAG-RWPRALLALELLVASFAVLCVWFTATQVALVRDGMTTNEQDKWYAVQESM 244

Query: 262 REGNLVRTLDGQFFIQDQQNPN-QFYSTNAYDSKLYVPQN--YSIVNDPKDITNIYDQGS 318
           REG LVR L G+F+ + +     +FYSTNAYD + Y   N  Y++V   ++I N+YD GS
Sbjct: 245 REGTLVR-LRGRFYHRVEGGDGVEFYSTNAYDHRTYALHNEPYAVVTSHEEIPNVYDTGS 303

Query: 319 F 319
           F
Sbjct: 304 F 304

>Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {ON}
           YDR126W (PSL10) - Hypothetical ORF [contig 174] FULL
          Length = 338

 Score =  225 bits (574), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 121/311 (38%), Positives = 179/311 (57%), Gaps = 32/311 (10%)

Query: 31  FSWYYTRIFRPLLQEDQRFRWKFYVVPAFYLSLYCYIIFVLIRDVIPVIGNRLLSVEKLC 90
           F WYY  +F P+ ++  +FR+KF+VVP  YL++Y Y   +  RD+  +I +RL ++E+  
Sbjct: 28  FKWYYRNVFYPIFEDADKFRFKFHVVPILYLAIYLYCCLLFFRDIEGLIHSRLYAIERWF 87

Query: 91  IIPVLVVATPVLGWLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTCHIEKPARSR 150
           IIPV ++     G L+M VK +++    P       +D IL++  V+CRTC + K ARS+
Sbjct: 88  IIPVALMTPISCGLLTMLVKPESTYIAPPVD----QFDGILFHAGVECRTCKMPKYARSK 143

Query: 151 HCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRVLWISVMKDPSM 210
           HC +C  C  +ADHHCVW NNCIGKGNY++FY FL  NV    YGF R+L++        
Sbjct: 144 HCAICGRCTQLADHHCVWANNCIGKGNYEYFYLFLASNVFLTVYGFTRLLYLQP------ 197

Query: 211 VVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGEKDKWYTIQQIMREGNLVRTL 270
            V  R++L   +L G+FA+I  +F+Y Q+ L+ DGMTT E+ KW  +  +MR   LV   
Sbjct: 198 TVKSRTLLTLALLLGSFALILVIFSYFQVVLIKDGMTTNEESKWLVVHDMMRARKLVVDN 257

Query: 271 DGQFFIQDQQNPNQ----------------------FYSTNAYDSKLYVPQNYSIVNDPK 308
            G+F+ +  +N +                       FYSTN YD+  Y  +    + D +
Sbjct: 258 AGKFYYRIPENEDSLSPELKSNEGPELTTTSPSRYTFYSTNPYDNCTYTVKYPREIVDYE 317

Query: 309 DITNIYDQGSF 319
           +ITNIYD+GSF
Sbjct: 318 EITNIYDKGSF 328

>KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} similar
           to uniprot|Q04629 Saccharomyces cerevisiae YDR126W SWF1
           Spore Wall Formation
          Length = 324

 Score =  219 bits (558), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 119/313 (38%), Positives = 179/313 (57%), Gaps = 22/313 (7%)

Query: 22  SPFYKVKWPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFYLSLYCYIIFVLIRDVIPVIGN 81
           SP +K    F WYY  I+ PL  +  R+RWK+++VP FY  +  + + +    +   +  
Sbjct: 19  SPKFKDLILFRWYYQHIYYPLFTDYTRYRWKYWLVPGFYACILIFCVHLFYNKLNDTVNP 78

Query: 82  RLLSVEKLCIIPVLVVATPVLGWLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTC 141
            L S+EK   IP+ +  T + G  S+ VK     G Q G   ++  DYI+++P+  C+TC
Sbjct: 79  YLYSLEK-AFIPITIAFTSLTGVASVFVKP---LGLQAGP--QFQPDYIIFHPSAVCQTC 132

Query: 142 HIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRVLW 201
              K  RS+HC +C  C+ + DHHC+W+NNC+G GNY++FY+FL+ N + L+Y  LR+L 
Sbjct: 133 KTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNCLLLTYASLRLLT 192

Query: 202 I----SVMKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGEKDKWYTI 257
           +    +  KD       +  L   +L   F++I  VFTY QL+LVNDGMT  E+DKWY +
Sbjct: 193 LFRITAFKKD-------KFFLSLFLLTTAFSLIAIVFTYYQLKLVNDGMTNNEQDKWYLV 245

Query: 258 QQIMREGNLVRTLDGQFFIQDQQNPNQ-----FYSTNAYDSKLYVPQNYSIVNDPKDITN 312
           Q+ MR GNLV+ +DG  + +      Q     FYSTN YD   Y   N + +   ++I N
Sbjct: 246 QEYMRNGNLVKDMDGVLYYRSMSTDAQTAEPIFYSTNLYDHSKYHLINPAKILSHEEIIN 305

Query: 313 IYDQGSFWYKLER 325
           +YD+GSF   L+ 
Sbjct: 306 LYDRGSFLDNLKE 318

>NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389
          Length = 374

 Score = 82.0 bits (201), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 53/82 (64%), Gaps = 1/82 (1%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFL 197
           C+TC I +P RS HC++C  CVL+ DHHCVWVNNC+G+ NY++F  FL  + ++  +  +
Sbjct: 184 CKTCRIWRPPRSSHCSICETCVLMHDHHCVWVNNCVGQRNYRYFLTFLTSSTLTSIFLIV 243

Query: 198 RVLWISVMKDPSMVVYPRSILI 219
               I V + P +   P ++L+
Sbjct: 244 NAA-IDVARTPDVTDTPVAVLL 264

>Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246W
           (REAL)
          Length = 359

 Score = 80.9 bits (198), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 41/54 (75%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVIS 191
           C++C I +P RS HC+ C  CV+V DHHC+WVNNCIGK NY+FF  FL+  VIS
Sbjct: 175 CQSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLVFLLSAVIS 228

>TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.389
           YLR246W
          Length = 360

 Score = 80.9 bits (198), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 62/113 (54%), Gaps = 2/113 (1%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFL 197
           C TCHI +P R+ HC++C+ C+ V DHHC+W+NNC+G  NY++F  FLV  ++S  +  +
Sbjct: 190 CSTCHIWRPPRASHCSICQACIDVHDHHCIWINNCVGNRNYRYFIIFLVGAILSSIFIII 249

Query: 198 RVLWISVMKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGE 250
               I V +       P +IL+    C T  I  G+     + L   G TT E
Sbjct: 250 NCS-IHVARIRRASNAPVAILLIVYGCLTI-IYPGILLGYHIALTGTGQTTRE 300

>NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389
          Length = 389

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 50/82 (60%), Gaps = 1/82 (1%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFL 197
           C TC I +P RS HC++C  C++  DHHC+WVNNCIG+ NY+FF  FL+    +  +  +
Sbjct: 217 CTTCRIWRPPRSSHCSICEACIITHDHHCIWVNNCIGQRNYRFFLTFLLSGTFTSIFLII 276

Query: 198 RVLWISVMKDPSMVVYPRSILI 219
               I + + P +   P ++L+
Sbjct: 277 NAS-IDIARTPKVRDTPVAVLL 297

>ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {ON}
           similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 366

 Score = 78.6 bits (192), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 90/186 (48%), Gaps = 33/186 (17%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFL 197
           C +C I +P R+ HC+ C  C+L  DHHC+WVNNCIG+ NY++F  FL   ++S S   +
Sbjct: 181 CTSCRIWRPPRASHCSTCEACILTHDHHCIWVNNCIGQRNYRYFILFLASAILS-SIFLI 239

Query: 198 RVLWISVMKD---PSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGEKDKW 254
               I +      PS V  P +IL+  ++ G  AII     Y  L L+   + TG +   
Sbjct: 240 ANCSIHIYHHRNLPSKV--PVTILL--LIYGGLAII-----YPMLLLIYHILMTGRQQ-- 288

Query: 255 YTIQQIMREGNLVRTLDGQFFIQDQQNP--NQFYST--NAYDSKLYVPQNYSIVNDPKDI 310
            T ++ +RE N              +NP   + +S   N +D   +     S++  P+ I
Sbjct: 289 -TTREFLREAN-------------SKNPIFTKIHSIEHNPFDRGNFTANMLSLILQPRGI 334

Query: 311 TNIYDQ 316
           + I  Q
Sbjct: 335 STICPQ 340

>SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 352

 Score = 77.8 bits (190), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 87/176 (49%), Gaps = 20/176 (11%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFL 197
           C TC I +P R+ HC+ C  C++  DHHC WVNNCIG+ NY +F+ FLV  VI+ ++  +
Sbjct: 172 CTTCRIWRPPRASHCSTCEACIITHDHHCKWVNNCIGQRNYHYFFTFLVSCVIATAF-II 230

Query: 198 RVLWISVMKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGEKDKWYTI 257
               I V +       P +IL+  I CG   ++C  F  L   +   G            
Sbjct: 231 ANCAIRVSRSVHAKDAPVAILLL-IYCG--LVVCYPFILLVYHIFLTGS----------- 276

Query: 258 QQIMREGNLVRTLDGQFFIQDQQNPNQFYSTNAYDSKLYVPQNYSIVNDPKDITNI 313
           QQ  RE   ++++  +  I  + + +Q    N +    ++   +S++ +P+ ++ +
Sbjct: 277 QQTTRE--YLKSIGSKNPIFHKISSSQ---DNPFQKGSFLANMFSLILEPRGLSMV 327

>CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {ON}
           similar to uniprot|Q06551 Saccharomyces cerevisiae
           YLR246w ERF2
          Length = 326

 Score = 77.4 bits (189), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 56/95 (58%), Gaps = 1/95 (1%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFL 197
           C TC I +P R+ HC++C  CVL  DHHC+WVNNC+G+ NY++F AFL+ + ++ +    
Sbjct: 160 CHTCKIWRPPRASHCSVCECCVLTHDHHCIWVNNCVGQRNYRYFLAFLLSSTLACALLIA 219

Query: 198 R-VLWISVMKDPSMVVYPRSILIFTILCGTFAIIC 231
              L +       + V  R + +  +LC   A++C
Sbjct: 220 NCALHLHRALHEGIRVSHRPLPVAVLLCVYAAVLC 254

>KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]
           {ON} similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 355

 Score = 77.4 bits (189), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVIS 191
           C+TC I +P RS HC++C  CVL  DHHC W+NNCIGK NY+FF  FL+ + IS
Sbjct: 174 CQTCRIWRPPRSAHCSVCDVCVLSHDHHCKWLNNCIGKRNYRFFLEFLMASTIS 227

>YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subunit
           of a palmitoyltransferase, composed of Erf2p and Shr5p,
           that adds a palmitoyl lipid moiety to heterolipidated
           substrates such as Ras1p and Ras2p through a thioester
           linkage; mutants partially mislocalize Ras2p to the
           vacuole
          Length = 359

 Score = 77.4 bits (189), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVIS 191
           C +C I +P RS HC+ C  CV+V DHHC+WVNNCIGK NY+FF  FL+  ++S
Sbjct: 175 CPSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLIFLLGAILS 228

>Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 77.4 bits (189), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 30/54 (55%), Positives = 40/54 (74%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVIS 191
           C++C I +P R+ HC+ C  CV+V DHHCVWVNNC+GK NY+FF  FL+  + S
Sbjct: 175 CQSCRIWRPPRTSHCSTCNVCVMVHDHHCVWVNNCVGKRNYRFFLIFLLSAIFS 228

>Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003C -
           Hypothetical ORF [contig 185] FULL
          Length = 383

 Score = 77.4 bits (189), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 65/220 (29%), Positives = 96/220 (43%), Gaps = 22/220 (10%)

Query: 104 WLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTCHIEKPARSRHCNLCRECVLVAD 163
           W+S  +   T+ G  P   Q   + +     N+ C+ C   KP R+ HC  C +CVLV D
Sbjct: 51  WISYALAIFTNPGKPPTGFQPLPHQW----KNI-CQKCKTYKPERTHHCKTCDQCVLVMD 105

Query: 164 HHCVWVNNCIGKGNYQFFYAFLVVNVISLSY-GFL---RVLWISVMKDPSMVVYPRSILI 219
           HHC W  NC+G  N+  F  FLV  +I+ SY GF+   R+     ++   + V    ++ 
Sbjct: 106 HHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYVQKIELVF 165

Query: 220 FTILCGTFAIICGVFTYLQLQLVND----GMTTGEKDKWYTIQQIMREGNLVRTL---DG 272
             I     A +      L L+   +    GMT  E+ +W  I+     G L+  L     
Sbjct: 166 IFINTPLNAFVWLTIILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLA 225

Query: 273 QFFIQDQQN-PNQFYSTNAYDSKLYVPQNYSIVNDPKDIT 311
           + +  D  N PN     NA D +L       IVN P D+ 
Sbjct: 226 EIYGDDILNSPNAKKLINARDLQL-----EEIVNFPYDLN 260

>KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.389
           YLR246W
          Length = 361

 Score = 77.0 bits (188), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 40/54 (74%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVIS 191
           CRTC I +P R+ HC++C  CV+  DHHC+W+NNC+G+ NY++F  FL+   ++
Sbjct: 178 CRTCRIWRPPRASHCSICEACVMTHDHHCIWINNCVGQRNYRYFVTFLISGTLA 231

>Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 77.0 bits (188), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVIS 191
           C +C I +P RS HC+ C  CV+V DHHC+WVNNCIGK NY+FF  FL+  + S
Sbjct: 175 CTSCRIWRPPRSSHCSTCNICVMVHDHHCIWVNNCIGKRNYRFFLIFLLSAIFS 228

>NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28
          Length = 389

 Score = 77.0 bits (188), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 74/152 (48%), Gaps = 8/152 (5%)

Query: 104 WLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTCHIEKPARSRHCNLCRECVLVAD 163
           W+S  +   T+ G  P + +  D++    + N  C+ C+  KP RS HC  C +CVL+ D
Sbjct: 51  WVSYLLAIFTNPGKPPKNCKPIDFNDQRKW-NTHCKKCNNYKPERSHHCKTCNQCVLMMD 109

Query: 164 HHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRVL------WISVMKDPSMVVYPRSI 217
           HHC W  NC+G  N+  F  FL+  +I+  +  + +L      W ++   PS +     I
Sbjct: 110 HHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMW-NLRHLPSYIFDRNEI 168

Query: 218 LIFTILCGTFAIICGVFTYLQLQLVNDGMTTG 249
           +  TIL    A I    + L ++  N+ +  G
Sbjct: 169 IFLTILIPMDAFILLTISLLFIRCFNNQIVRG 200

>TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.389
           YLR246W
          Length = 404

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 41/55 (74%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISL 192
           CRTC I +P RS HC++C  CV+  DHHC+W+NNC+GK NY++F  FL   ++++
Sbjct: 196 CRTCRIWRPPRSSHCSICDCCVMSLDHHCLWLNNCVGKRNYRYFLIFLTSTIMTV 250

>CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003c
          Length = 376

 Score = 73.9 bits (180), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 78/172 (45%), Gaps = 19/172 (11%)

Query: 104 WLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTCHIEKPARSRHCNLCRECVLVAD 163
           WLS  +   T  G  P + +    ++ +Y     C+ C   KP RS HC  C +CVL+ D
Sbjct: 51  WLSYYLAIYTPPGKPPTNFKPSKNEWKVY-----CKKCKCYKPERSHHCKTCNQCVLMMD 105

Query: 164 HHCVWVNNCIGKGNYQFFYAFL---VVNVISLSYGF---LRVLWISVMKDPSMVVYPRSI 217
           HHC W  NC+G  N+  F  FL   +V   SL+      +  +W+     PS + Y   +
Sbjct: 106 HHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHSIWVH-RSSPSYLYYKSEL 164

Query: 218 LIFTILCGTFAIICGVFTYLQLQLVNDGMTTG-------EKDKWYTIQQIMR 262
           +  TIL    A I    + L ++ + + +  G       E D+  T+ ++ +
Sbjct: 165 IFLTILTPLNAFILLTISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSK 216

>KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 342

 Score = 73.6 bits (179), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 71/149 (47%), Gaps = 11/149 (7%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVN-----VISL 192
           CR C + KP R  HC+ C++C L  DHHC W  +C+G  N ++F  FL+       +I L
Sbjct: 106 CRVCAVWKPDRCHHCSACKKCFLKMDHHCPWFASCVGYANQKYFVQFLIYGTVFSILIFL 165

Query: 193 SYGFLRVLWISVMK-DPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGEK 251
             G   +LW    + +  M+  P  +L+  IL    +I    FT   + L+    TT E 
Sbjct: 166 LSGTELLLWFKNQRYNQEMIQLP--LLVVWILSVAISISMLAFTSYTVYLITKNQTTIEM 223

Query: 252 DKWYTIQQIMREGNLVRTLDGQFFIQDQQ 280
            +W  ++    E N++  + G    +D+ 
Sbjct: 224 YEWSNLKA---EANIMDEVRGTNTFEDKN 249

>KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {ON}
           Anc_6.28 YOL003C
          Length = 386

 Score = 73.2 bits (178), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 56/99 (56%), Gaps = 7/99 (7%)

Query: 104 WLSMTVKAKTSRGCQP-GSAQEY-DYDYILYYPNVQCRTCHIEKPARSRHCNLCRECVLV 161
           W+S  +   T+ G  P GSAQ++ D D   Y     C  C+  KP RS HC  C++CVL+
Sbjct: 51  WISYYMAIYTNPGKPPHGSAQQHTDGDMNRY-----CAKCNGFKPERSHHCKTCQQCVLM 105

Query: 162 ADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRVL 200
            DHHC W  NC+G GN+  F  FL+  +I+ S  F  +L
Sbjct: 106 MDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQLFWYLL 144

>KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 358

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 34/49 (69%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLV 186
           C TC I +P R+ HC+ C  CVL  DHHC WVNNCIG+ NY++F  FL 
Sbjct: 178 CATCRIWRPPRASHCSTCEACVLTHDHHCTWVNNCIGQRNYRYFLTFLA 226

>TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {ON}
           Anc_8.389 YLR246W
          Length = 359

 Score = 72.4 bits (176), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 59/103 (57%), Gaps = 6/103 (5%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFL 197
           C +C I +P R+ HC+ C  CV+  DHHC+WVNNC+G+ NY++F  FL+  V++  +  +
Sbjct: 181 CTSCRIWRPPRASHCSTCGVCVMTHDHHCIWVNNCVGQRNYRYFIIFLIGTVLAELF-LI 239

Query: 198 RVLWISVMKDPSMVVYPRSILIFTILCGTF---AIICGVFTYL 237
               I + +  S V  P +IL+    C +    AI+ G   ++
Sbjct: 240 ANCSIHIARRSSQV--PVTILLLVYACLSILYPAILLGYHVFM 280

>Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar to
           Ashbya gossypii AGL125C
          Length = 368

 Score = 72.4 bits (176), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 66/133 (49%), Gaps = 15/133 (11%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFL 197
           C TC I +P R+ HC+ C  C++  DHHC+WVNNC+G+ NY++F  F+   V+++    L
Sbjct: 189 CTTCRIWRPLRASHCSTCNSCIMTFDHHCIWVNNCVGQRNYRYFLTFIYSAVLTI---IL 245

Query: 198 RVLWISVMKDPSMVVYPRSILIFTILCGT---FAIICGVFTYLQLQLVNDGMTTGEKDKW 254
            V+  SV             L+    CG    + +I G++    + L     TT E  K 
Sbjct: 246 LVINCSVRLSKGSPTAKTPSLLLICYCGVGIWYPLILGIY---HIFLAGTQQTTHEYLK- 301

Query: 255 YTIQQIMREGNLV 267
                +++ GN +
Sbjct: 302 -----LIKSGNPI 309

>KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC- CRD protein
          Length = 377

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 76/290 (26%), Positives = 120/290 (41%), Gaps = 40/290 (13%)

Query: 50  RWKFYVVPAFYLSLYCYIIFVLIRDVIPVIGNRLLSVEKLCIIPVLVVATPVLGWLSMTV 109
           RW    +PAF ++L  Y     I      + N L   E+     +       + W+S  +
Sbjct: 8   RWLGVAIPAFLVALIGYGSHYFI------LSNFLSWNEQ-----IFYQTCQTMIWVSYYL 56

Query: 110 KAKTSRGCQPG----SAQEYDYDYILYYPNVQCRTCHIEKPARSRHCNLCRECVLVADHH 165
              T+ G  P     SA+E+ ++Y        C+ C + KP R+ HC  C +CVL  DHH
Sbjct: 57  AIYTNPGIPPKDFKPSAEEW-HNY--------CKKCRVYKPERAHHCKTCNQCVLAMDHH 107

Query: 166 CVWVNNCIGKGNYQFFYAFLVVNVISLSY------GFLRVLWISVMKDPSMVVYPRSILI 219
           C W  NC+G  N+  F  FL   + S +Y      G + +LW S+            I+ 
Sbjct: 108 CPWTLNCVGHSNFPHFMRFLFWVIFSTAYLLFLLIGRIYLLW-SIRHTAFHHRSTSEIIF 166

Query: 220 FTILCGTFAIICGVFTYLQLQLVND----GMTTGEKDKWYTIQQIMREGNLV-RTLDGQF 274
             I+    A +    + L  + + +    GMT  E  +   IQ +  +  L+ + +D   
Sbjct: 167 ICIMTPMDAFVLLTVSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLV 226

Query: 275 FIQDQQNPNQFYSTNAYDSKLYVPQNYSIVNDPKDI---TNIYDQGSFWY 321
             + +  P + +  N   SK YV Q     N P D+   TNI +    WY
Sbjct: 227 ERRPEILPAKQHEINKLLSKRYVNQE-DFTNFPYDVNPWTNINNAMGPWY 275

>Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W
           (ERF2) - Mutation has an Effect on Ras Function [contig
           251] FULL
          Length = 353

 Score = 71.2 bits (173), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 36/49 (73%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLV 186
           C TC I +P R+ HC++C  C+L  DHHC WVNNCIG+ NY++F  FLV
Sbjct: 173 CPTCRIWRPPRASHCSVCGACILNHDHHCKWVNNCIGQRNYRYFLTFLV 221

>AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR246W
           (ERF2)
          Length = 367

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 28/54 (51%), Positives = 39/54 (72%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVIS 191
           C TC I +P R+ HC +C  C+L  DHHC W+NNCIG+ N+++F AFL  +V+S
Sbjct: 187 CTTCRIWRPPRASHCAVCDSCILSFDHHCDWLNNCIGQRNHRYFLAFLFSSVLS 240

>KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa]
           {ON} Anc_6.28 YOL003C
          Length = 396

 Score = 70.5 bits (171), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 60/129 (46%), Gaps = 17/129 (13%)

Query: 104 WLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTCHIEKPARSRHCNLCRECVLVAD 163
           WLS  +  K   G    + +  D   I  Y    C+ C   KP R+ HC  C +C+L+ D
Sbjct: 51  WLSYYLAIKADPGSPSIADKNEDIKTIRTY----CKKCDAYKPPRAHHCKTCNKCILMMD 106

Query: 164 HHCVWVNNCIGKGNYQFFYAFLVVNVISLSY---------GFLRVLWISVMKDPSMVVYP 214
           HHC W  NC+G  NY  F  FL   +++ ++         GF+   W S     S +V  
Sbjct: 107 HHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYS----SSALVQR 162

Query: 215 RSILIFTIL 223
           + I++ TIL
Sbjct: 163 QEIVMLTIL 171

>TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 28/52 (53%), Positives = 34/52 (65%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNV 189
           CRTC++ KP RS HC+ C  CVL  DHHC W + CIG  N +FF  FL+ N 
Sbjct: 110 CRTCNVWKPDRSHHCSTCNRCVLKMDHHCPWFSECIGFKNQKFFIQFLIYNT 161

>KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {ON}
           weakly similar to uniprot|P42836 Saccharomyces
           cerevisiae YNL326C PFA3 Palmitoyltransferase for Vac8p
           one of three yeast DHHC-cysteine rich domain proteins
           (Pfa3p Erf2p Akr1p) with palmitoyltransferase activity
           required for vacuolar integrity under stress conditions
          Length = 325

 Score = 69.3 bits (168), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/127 (33%), Positives = 59/127 (46%), Gaps = 6/127 (4%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFL 197
           C+TC I KP R  HC+ C +C L  DHHC W  +C+G  N +FF  FL    +   Y  L
Sbjct: 105 CQTCEIWKPDRCHHCSKCNKCFLKMDHHCPWFASCVGFRNQKFFVQFLAYTTVYSLYVLL 164

Query: 198 RV-----LWISVMKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGEKD 252
                   W   MK  S ++    +L+  +L    AI    FT   + LV    TT E+ 
Sbjct: 165 MTSAQLYSWFRQMKYKSELL-DLHLLVVWVLSVIAAIATFAFTTYTIWLVTKNETTIEQY 223

Query: 253 KWYTIQQ 259
           +W  I+ 
Sbjct: 224 EWGNIRH 230

>Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {ON}
           YOL003C (REAL)
          Length = 378

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 38/64 (59%), Gaps = 1/64 (1%)

Query: 133 YPNVQCRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISL 192
           +PN  C+ C   KP RS HC  C +CVL+ DHHC W  NC+G GNY  F  FL   +I+ 
Sbjct: 76  WPNF-CKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITT 134

Query: 193 SYGF 196
           S  F
Sbjct: 135 SILF 138

>KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.389
           YLR246W
          Length = 354

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 50/96 (52%), Gaps = 16/96 (16%)

Query: 116 GCQPG-----SAQEYDYDYILYYPNVQ---------CRTCHIEKPARSRHCNLCRECVLV 161
           G  PG     S QEY Y+ I+  P  Q         C  C I +P R+ HC +C+ CV  
Sbjct: 152 GGPPGQTPVQSPQEY-YN-IVTLPTAQRSAHVEVKYCTACKIWRPPRASHCRICQVCVQT 209

Query: 162 ADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFL 197
            DHHC W+NNC+G+ NY++F  FL     + +  F+
Sbjct: 210 QDHHCAWINNCVGQRNYRYFLTFLTATCATCTVLFV 245

>Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to
           Ashbya gossypii ACL003C
          Length = 377

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 77/177 (43%), Gaps = 16/177 (9%)

Query: 104 WLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTCHIEKPARSRHCNLCRECVLVAD 163
           WLS      T+ G      Q   +++  Y     C+ C   KP R+ HC  C +CVLV D
Sbjct: 51  WLSYYKAIYTNPGSPVPGFQPLKHEWKNY-----CKKCQNFKPERTHHCKTCAQCVLVMD 105

Query: 164 HHCVWVNNCIGKGNYQFFYAFL---VVNVISLSYGFLRVLWI--SVMKDPSMVVYPRSIL 218
           HHC +  NC+G  N+  F  FL   +     LS  F +  W   ++    + +V  + I+
Sbjct: 106 HHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEII 165

Query: 219 IFTILCGTFAIICGVFTYL-----QLQLVNDGMTTGEKDKWYTIQQIMREGNLVRTL 270
             TIL    A +    + L     + Q++N GMT  E  +   I+ +     LV  L
Sbjct: 166 FLTILTPANAFVLLTISILFGRCIKNQVLN-GMTQIEAWEMDRIESMFYNRRLVPQL 221

>NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {ON}
           Anc_6.28
          Length = 376

 Score = 67.8 bits (164), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 62/124 (50%), Gaps = 9/124 (7%)

Query: 104 WLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTCHIEKPARSRHCNLCRECVLVAD 163
           W+S  +   T+ G    S +    ++  +     C+ C + KP R+ HC  C +CVL+ D
Sbjct: 51  WISYALAIFTNPGRPAKSFKPLKKEWTHF-----CKKCQLFKPERAHHCKTCNQCVLMMD 105

Query: 164 HHCVWVNNCIGKGNYQFFYAFL---VVNVISLSYGFL-RVLWISVMKDPSMVVYPRSILI 219
           HHC W  NC+G  N+  F  FL   VV    L Y  L R +++  +KD    ++ ++ + 
Sbjct: 106 HHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEIT 165

Query: 220 FTIL 223
           F I+
Sbjct: 166 FLII 169

>Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {ON}
           YOL003C (REAL)
          Length = 379

 Score = 67.8 bits (164), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 62/126 (49%), Gaps = 6/126 (4%)

Query: 131 LYYPNVQCRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVI 190
           L +PN  C+ C   KP RS HC  C +CVL+ DHHC W  NC+G  NY  F  FL   ++
Sbjct: 74  LIWPNF-CKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIV 132

Query: 191 SLSYGFL----RVLWISVMKDPSMVVYPRSILIF-TILCGTFAIICGVFTYLQLQLVNDG 245
           + S  F     R+ +I   +     ++ +S LIF TIL      +      L L+ +++ 
Sbjct: 133 TTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLTIAILFLRCLSNQ 192

Query: 246 MTTGEK 251
           +  G  
Sbjct: 193 IINGRS 198

>TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {ON}
           Anc_6.28 YOL003C
          Length = 381

 Score = 67.8 bits (164), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 73/142 (51%), Gaps = 9/142 (6%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFL 197
           C+ C   KP R+ HC  C +CVL+ DHHC W  NC+G  N+  F  FLV  +++ ++   
Sbjct: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLY 139

Query: 198 RVLW--ISVMKDPSMV--VYPRSILIF-TILCGTFAIICGVFTYLQLQ-LVN---DGMTT 248
           +++   I + +D ++   ++ RS L+F TIL    A +    T L  + L N   +GM+ 
Sbjct: 140 QLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVLLTITILLCRCLANQIFNGMSQ 199

Query: 249 GEKDKWYTIQQIMREGNLVRTL 270
            E  +   +Q +     LV  L
Sbjct: 200 IETWELERLQALFDSKRLVPLL 221

>ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL326C
          Length = 390

 Score = 67.8 bits (164), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 58/133 (43%), Gaps = 18/133 (13%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFL 197
           C  C + KP R  HC+ C +C L  DHHCVW   CIG  N++FF  FL+       Y  +
Sbjct: 171 CVKCKVWKPDRCHHCSACDKCYLRRDHHCVWFPGCIGYNNHKFFLHFLL-------YASV 223

Query: 198 RVLWISVMKDPSMVV------YPRSILIFTILC-----GTFAIICGVFTYLQLQLVNDGM 246
              WI ++    +VV      Y R +L   ++C         +    F    + LV    
Sbjct: 224 YAFWICIITTWDLVVWFRAHSYERELLNVHLVCLWALSAAATVALTAFCAFNIYLVCKNE 283

Query: 247 TTGEKDKWYTIQQ 259
           TTGE  +  T+  
Sbjct: 284 TTGEYQRRSTLNS 296

>Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {ON}
           complement(51397..52533) [1137 nt, 379 aa]
          Length = 378

 Score = 67.4 bits (163), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 72/153 (47%), Gaps = 28/153 (18%)

Query: 48  RFRWKFYVVPAFYLSLYCYII--FVLIRDVIPVIGNRLLSVEKLCIIPVLVVATPVLGWL 105
           ++ W    +P F +S   Y    F+L+           LS+ K     + V       W+
Sbjct: 6   KYPWMGIAIPCFLISFIAYTAHYFILLN---------FLSIGKQIWFEISVTMI----WI 52

Query: 106 SMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQ----CRTCHIEKPARSRHCNLCRECVLV 161
           S  +   T+ G +PGS      +YI   P+ Q    C+ C+  KP R+ HC  C++CVL+
Sbjct: 53  SYYLAIYTNPG-KPGS------NYIP--PSNQWKNYCKKCNAYKPERTHHCKTCQQCVLM 103

Query: 162 ADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSY 194
            DHHC W  NC+G  N+  F  FL   +++ +Y
Sbjct: 104 MDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTY 136

>SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} similar
           to uniprot|Q12006 Saccharomyces cerevisiae YOL003C
           DHHC-CRD protein
          Length = 379

 Score = 67.4 bits (163), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 74/157 (47%), Gaps = 10/157 (6%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFL--VVNVIS--LS 193
           C  C+  KP R+ HC  C +CVL  DHHC W  NC+G  N+  F  FL  V+   S  L+
Sbjct: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLLT 139

Query: 194 YGFLRVLWISVMKD-PSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVND----GMTT 248
           Y   R+L++   +  P+  V+   ++  TIL    A +    + L L+   +    GMT 
Sbjct: 140 YLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLTISLLLLRCAKNQILKGMTQ 199

Query: 249 GEKDKWYTIQQIMREGNLV-RTLDGQFFIQDQQNPNQ 284
            E  +   I+ +   G L+ R L+    I+     NQ
Sbjct: 200 IESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQ 236

>YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON}
           PFA4Palmitoyltransferase with autoacylation activity,
           required for palmitoylation of amino acid permeases
           containing a C-terminal Phe-Trp-Cys site; required for
           modification of Chs3p; member of the DHHC family of
           putative palmitoyltransferases
          Length = 378

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 65/142 (45%), Gaps = 9/142 (6%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFL 197
           C+ C   KP RS HC  C +CVL+ DHHC W  NC+G  NY  F  FL   +++ S  F 
Sbjct: 80  CKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVLFC 139

Query: 198 ----RVLWISVMKDPSMVVYPRSILIFTILCG---TFAIICGVFTYLQ--LQLVNDGMTT 248
               R+ +I   +      + +S LIF  +     +F ++     +L+     + +G + 
Sbjct: 140 IQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLTITILFLRCLFNQILNGRSQ 199

Query: 249 GEKDKWYTIQQIMREGNLVRTL 270
            E      ++ +   G L + L
Sbjct: 200 IESWDMDRLESLFNSGRLTQKL 221

>KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 34/57 (59%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSY 194
           C+ C   KP R+ HC  C++CVL  DHHC W  NC+G  N+  F  FL   V++ SY
Sbjct: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSY 136

>TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28
           YOL003C
          Length = 380

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 51/93 (54%), Gaps = 8/93 (8%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFL 197
           C+ C+  KP RS HC  C +CVL+ DHHC W  NCIG  N+  F  FL+   I  + GFL
Sbjct: 80  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLL--WIMATTGFL 137

Query: 198 ------RVLWISVMKDPSMVVYPRSILIFTILC 224
                 R++++   ++    ++ RS +I   +C
Sbjct: 138 LFYQIKRIIYMWNNRNLPSYLFERSEVIALFVC 170

>TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON}
           Anc_3.12 YNL326C
          Length = 329

 Score = 65.1 bits (157), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 33/49 (67%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLV 186
           CRTCH+ KP R  HC+ C  C+L  DHHC W+ +C+G  N ++F  FL+
Sbjct: 108 CRTCHVWKPDRCHHCSACNRCILRMDHHCPWLPDCVGFRNQKYFIQFLM 156

>ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 327

 Score = 64.7 bits (156), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 32/49 (65%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLV 186
           CRTCH+ KP R  HC+ C +C+L  DHHC W   CIG  N +FF  +L+
Sbjct: 107 CRTCHVWKPDRCHHCSRCDKCILKMDHHCPWFPGCIGFNNQRFFIQYLL 155

>TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}
           Anc_3.12 YNL326C
          Length = 345

 Score = 64.7 bits (156), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 33/53 (62%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVI 190
           CRTC + KP R  HC+ C  C+L  DHHC W   CIG  N+++F  FL+ N +
Sbjct: 106 CRTCLVWKPDRCHHCSSCDRCILKMDHHCPWFAECIGFKNHKYFINFLIYNSL 158

>Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {ON}
           YOL003C (REAL)
          Length = 398

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 87/200 (43%), Gaps = 26/200 (13%)

Query: 34  YYTRIFRPLLQE-----DQRFRWKFYVVPAFYLSLYCYIIFVLIRDVIPVIGNRLLSVEK 88
           Y+TR +  L+ +       ++ W    +P F +S   Y     I      +  ++     
Sbjct: 7   YHTRFYTELVTDLAMAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESS 66

Query: 89  LCIIPVLVVATPVLGWLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTCHIEKPAR 148
           L +I           W+S  +   T+ G +P    + + +    +PN  C+ C   KP R
Sbjct: 67  LSMI-----------WVSYYLAIYTNPG-KPSPTYQPNPNT---WPNY-CKKCQNYKPER 110

Query: 149 SRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFL----RVLWISV 204
           S HC  C +CVL+ DHHC W  NC+G  NY  F  F+   + +  + F     RV +I  
Sbjct: 111 SHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLFCIQLKRVSFIWQ 170

Query: 205 MKDPSMVVYPRSILIF-TIL 223
            +     ++ +S L+F TIL
Sbjct: 171 QRHLPGYLFKKSELVFLTIL 190

>ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score = 64.3 bits (155), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 56/117 (47%), Gaps = 5/117 (4%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGF- 196
           C+ C   KP R+ HC  C +CVL  DHHC W  NC+G  N+  F  FL   + +  Y   
Sbjct: 80  CKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYLLY 139

Query: 197 ---LRVLWISVMKDPSMVVYPRSILIF-TILCGTFAIICGVFTYLQLQLVNDGMTTG 249
              LR  +I    +    ++ +S LIF TIL      I    + L ++ +++ +  G
Sbjct: 140 ELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLTISILFIRCLSNQIFCG 196

>Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL326C
           - Hypothetical ORF [contig 124] FULL
          Length = 360

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 65/140 (46%), Gaps = 8/140 (5%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLV------VNVIS 191
           CRTC + KP R  HC+ C +C L  DHHC W  +C+G  N ++F  FL+      + V  
Sbjct: 133 CRTCVVWKPDRCHHCSGCNKCYLKMDHHCPWFASCVGYRNQKYFIHFLLYTTAYSILVFF 192

Query: 192 LSYGFLRVLWISVMKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGEK 251
           L+   L + + S   +  ++  P  +LI  IL     I    FT   + LV    TT E 
Sbjct: 193 LTGADLLMWFRSQGYNQELINLP--LLIVWILSLVITISMLAFTSYTIYLVAKNQTTIEM 250

Query: 252 DKWYTIQQIMREGNLVRTLD 271
            +W   +      + VR LD
Sbjct: 251 YEWTNYRNQRNIMDEVRGLD 270

>Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON}
           (48992..49972) [981 nt, 327 aa]
          Length = 326

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVI 190
           CRTC++ KP R  HC+ C +C+L  DHHC W   C+G  N ++F  FL+   +
Sbjct: 106 CRTCNVWKPDRCHHCSACDKCILKMDHHCPWFAECVGFKNQKYFVQFLIYTTV 158

>Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON}
           similar to Ashbya gossypii ADL197C
          Length = 339

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 34/53 (64%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVI 190
           C TC + KP RS HC+ C +C L  DHHC W ++CIG  N +FF  FL+ + +
Sbjct: 110 CATCGVWKPDRSHHCSSCNKCYLKRDHHCPWFSSCIGFNNQKFFVQFLMYSTL 162

>NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12
          Length = 335

 Score = 62.8 bits (151), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 38/66 (57%), Gaps = 3/66 (4%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFL 197
           C+TC + KP R  HC+ C +C+L  DHHC W   CIG  N +FF  FL+   I   Y F+
Sbjct: 109 CQTCQVWKPDRCHHCSTCNKCILKMDHHCPWFAECIGFKNQKFFIQFLIYCTI---YAFV 165

Query: 198 RVLWIS 203
            +  IS
Sbjct: 166 ALGLIS 171

>NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON}
           Anc_3.12
          Length = 327

 Score = 61.2 bits (147), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 31/49 (63%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLV 186
           C+TC + KP R  HC+ C +C+L  DHHC W   CIG  N ++F  FL+
Sbjct: 101 CQTCQVWKPDRCHHCSTCDKCILKMDHHCPWFAECIGFENQKYFVQFLI 149

>SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 333

 Score = 61.2 bits (147), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 30/49 (61%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLV 186
           CR C + KP RS HC+ C +C L  DHHC W  +CIG  N + F  FL+
Sbjct: 105 CRNCKVWKPDRSHHCSSCNKCFLKMDHHCPWFASCIGFKNQKLFIQFLL 153

>Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON}
           YNL326C (REAL)
          Length = 334

 Score = 60.5 bits (145), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 66/161 (40%), Gaps = 18/161 (11%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFL 197
           C+ CH+ KP R  HC+ C  CVL  DHHC W   C G  N +FF  FL+       Y FL
Sbjct: 106 CQVCHVWKPDRCHHCSSCDICVLKMDHHCPWFAECTGFKNQKFFIQFLMYTT---CYAFL 162

Query: 198 RVLWISVMKDP--SMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGEKDKWY 255
            +++         +   + R ++ F +L      +    T L   +             +
Sbjct: 163 VLIYTCYELGTWFNSGSFNRELIDFQLLGVALLAVAVFITVLAFTV-------------F 209

Query: 256 TIQQIMREGNLVRTLDGQFFIQDQQNPNQFYSTNAYDSKLY 296
           +I Q+ +    +     + + +D +  N  Y TN Y   ++
Sbjct: 210 SIYQVCKNQTTIEVHGMRRYRRDLEIINDSYGTNVYSENVF 250

>YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}
           PFA3Palmitoyltransferase for Vac8p, required for
           vacuolar membrane fusion; contains an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain;
           autoacylates; required for vacuolar integrity under
           stress conditions
          Length = 336

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 36/64 (56%), Gaps = 3/64 (4%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFL 197
           C+ CH+ KP R  HC+ C  C+L  DHHC W   C G  N +FF  FL+   +   Y FL
Sbjct: 106 CQVCHVWKPDRCHHCSSCDVCILKMDHHCPWFAECTGFRNQKFFIQFLMYTTL---YAFL 162

Query: 198 RVLW 201
            +++
Sbjct: 163 VLIY 166

>ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL003C
          Length = 375

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 53/117 (45%), Gaps = 5/117 (4%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIG----KGNYQFFYAFLVVNVISLS 193
           C  C   KP R+ HC  C +CVLV DHHC W  NC+G       +  F   +    I L 
Sbjct: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIATTGILLH 139

Query: 194 YGFLRVLWISVMKDPSMVVYPRSILIF-TILCGTFAIICGVFTYLQLQLVNDGMTTG 249
           Y   R+ +  V +  +  +  +  LIF TIL    A I    + L ++ V + +  G
Sbjct: 140 YFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLTISLLFVRCVKNQIVNG 196

>Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}
           YNL326C (REAL)
          Length = 336

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 32/60 (53%), Gaps = 3/60 (5%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFL 197
           C+ CH+ KP R  HC+ C  C+L  DHHC W   C G  N +FF  FL+       Y FL
Sbjct: 106 CQICHVWKPDRCHHCSSCDICILKMDHHCPWFAECTGFKNQKFFIQFLMYTTF---YAFL 162

>KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 58.2 bits (139), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 28/48 (58%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFL 185
           C+TC   KP R  HC+ C  C+L  DHHC W   CIG  N ++F  FL
Sbjct: 106 CQTCMFWKPDRCHHCSSCNRCILKMDHHCPWFAECIGFKNQKYFIQFL 153

>CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326c
          Length = 332

 Score = 58.2 bits (139), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 29/49 (59%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLV 186
           C++C   KP R  HC+ C  CVL  DHHC W   C+G  N +FF  FL+
Sbjct: 106 CKSCSSWKPDRCHHCSTCNVCVLKMDHHCPWFAGCVGYRNQKFFIQFLI 154

>Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON}
           YNL326C (REAL)
          Length = 330

 Score = 58.2 bits (139), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 34/64 (53%), Gaps = 3/64 (4%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFL 197
           C+ CH+ KP R  HC+ C  C+L  DHHC W   C G  N + F  FL+       Y FL
Sbjct: 106 CQICHVWKPDRCHHCSSCDMCILKMDHHCPWFAECTGFKNQKLFIQFLMYTTF---YAFL 162

Query: 198 RVLW 201
            +++
Sbjct: 163 VLIY 166

>KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.12
           YNL326C
          Length = 328

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 29/49 (59%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLV 186
           C++C   KP R  HC+ C  C+L  DHHC W+  C+G  N + F  FL+
Sbjct: 103 CQSCRYWKPDRCHHCSSCDRCILKMDHHCPWIAGCVGFRNQKLFIQFLL 151

>Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {ON}
           YDR459C (REAL)
          Length = 380

 Score = 55.1 bits (131), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 76/190 (40%), Gaps = 38/190 (20%)

Query: 47  QRFRWKFYVVPAFYLSLYCYIIF-----VLIRDVIPVIGNRLLSVEKLCIIPVLVVATPV 101
           +R  W  +V+P   L L CY  +     +  + +    G+R +++  +C++  L V   +
Sbjct: 10  KRRSWFRFVLPTIVLGLLCYCTWAYCHKLCYQQINGQFGHRSVAIGLICVVCFLDVVV-I 68

Query: 102 LGWLSMTV--------------------KAKTSRGCQPGSAQEYD-------YDYILYYP 134
             WL M V                    K +T+ G    ++ EYD       Y    +  
Sbjct: 69  FIWLQMVVWIGPGKQPHVAPFLILPVASKEETNDGGSQSTSAEYDAVIPPKCYQSDPHGY 128

Query: 135 NVQCRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSY 194
            + C  C   K  R+ H +    CV   DH+C+W    IG+ NY+ F  F+    I    
Sbjct: 129 PIWCSPCQSLKTERTHHSSELGHCVPRFDHYCMWAGTVIGRDNYRLFVQFVAYFSI---- 184

Query: 195 GFLRVLWISV 204
             L ++W S+
Sbjct: 185 -LLLIMWASI 193

>TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.579
           YDR459C
          Length = 386

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 20/110 (18%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFL 197
           C  C   K  R+ H +    CV   DH+CVWV   IGK NY  F  F+    I+LS    
Sbjct: 123 CSECQSLKLERTHHSSAMGHCVPRFDHYCVWVGTVIGKDNYLLFLQFVAYYAINLS---- 178

Query: 198 RVLWISVMKDPSMVVYPRS-------------ILIFTILCGTFAIICGVF 234
            ++W+S++    M++  R              IL+F IL   F +  G+F
Sbjct: 179 -IIWVSIVSYIHMIIRKRPNQPHHHFNTNLIIILVFAILGWLFTV--GLF 225

>TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28
           YOL003C
          Length = 377

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 27/46 (58%)

Query: 148 RSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLS 193
           R+ HC  C  CV++ DHHC W  NC+G  NY  F  FL   +IS +
Sbjct: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTT 145

>KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.579
           YDR459C
          Length = 370

 Score = 48.5 bits (114), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 46/100 (46%), Gaps = 10/100 (10%)

Query: 109 VKAKTSRGCQPGS---AQEYDYDYILYYPNVQCRTCHIEKPARSRHCNLCRECVLVADHH 165
           V   T+   QP S   A+ Y  D    YP   C  C   K  RS H ++   C+   DH+
Sbjct: 89  VSTNTTSETQPTSTVPAKLYQCDSN-GYPR-WCSNCEGLKSLRSHHSSVANYCIPRFDHY 146

Query: 166 CVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRVLWISVM 205
           C+W+   IGK NY+ F  FL    +S       ++WIS +
Sbjct: 147 CIWLGTTIGKDNYKQFVIFLFYCTVSFG-----IMWISAI 181

>Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa]
           {ON} complement(123368..124456) [1089 nt, 363 aa]
          Length = 362

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 49/106 (46%), Gaps = 14/106 (13%)

Query: 133 YPNVQCRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISL 192
           YP + C TC   K  R+ H      C+   DHHC+WV   IGK NY  F  F    V   
Sbjct: 120 YP-IWCDTCKSLKIGRTHHSKRLGYCIPRFDHHCMWVGTVIGKSNYLLFTQF----VFYF 174

Query: 193 SYGFLRVLWISVMKDPSMVV-YPRS-------ILIFTILCGTFAII 230
           S   L + WIS++     +V YP +       +++  IL   F+I+
Sbjct: 175 S-CLLLIFWISIVSYIKRIVDYPHTGYKLDPNLIVILILSVPFSIM 219

>KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 367

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 50/107 (46%), Gaps = 12/107 (11%)

Query: 133 YPNVQCRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQ-------FFYAFL 185
           YP + C  C   K  R+ H +    C+   DH+CVW+   +G+ NY+       +F+AF 
Sbjct: 128 YP-IWCTACQSIKANRTHHSSTLGYCIPRFDHYCVWIGTVVGRKNYRLFVQFAFYFWAFA 186

Query: 186 VVNVISLSYGFLRVLWISVMKDPSMVVYPRSILIFTILCGTFAIICG 232
           +  ++S +    ++    +   P +     +ILI   LCG   ++ G
Sbjct: 187 IFVIVSTASFLPKI----IRSQPHVPRVNPNILIMMGLCGMATLMVG 229

>Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}
           similar to Ashbya gossypii ABR203W
          Length = 372

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 32/62 (51%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFL 197
           C TC   K  RS H  L + CV   DH+CVW+   IG+ NY+ F  +++   I L    L
Sbjct: 127 CSTCQSLKIERSHHSELLKYCVPRFDHYCVWLGTVIGRKNYKLFMQYVMYFTIYLVTASL 186

Query: 198 RV 199
            +
Sbjct: 187 TI 188

>KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {ON}
           Anc_5.579 YDR459C
          Length = 354

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 44/103 (42%), Gaps = 12/103 (11%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFL 197
           C  C   K  R+ H      CV   DH+C W+   IG GNY  F  FLV          L
Sbjct: 126 CAHCQSVKSLRTHHSGRTGSCVFKFDHYCGWLGTLIGAGNYLLFIQFLVYMDC-----LL 180

Query: 198 RVLWISVMKDPSMVVYPR-----SILIFTILCGTFAIICGVFT 235
            ++WIS+     +  + R     +I I ++ C  F  + G+ T
Sbjct: 181 LIMWISMSPFIRVYTFRRDGNLIAIYILSVWCSLF--VTGLLT 221

>Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {ON}
           YDR459C (REAL)
          Length = 378

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 74/192 (38%), Gaps = 43/192 (22%)

Query: 47  QRFRWKFYVVPAFYLSLYCYIIF-----VLIRDVIPVIGNRLLSVEKLCIIPVLVVATPV 101
           +R  W  +VVP   L L CY  +     +    V   + +R ++V  +C++  L +   +
Sbjct: 10  KRKSWFRFVVPIIVLGLLCYGTWAYCHKLCYEQVDKKLHHRSVAVGLICVVCFLDIVV-I 68

Query: 102 LGWLSM--------------------TVKAKTSRGCQPGSAQEYDYDYIL------YYPN 135
             W  M                    T K  TS   Q  S +   YD ++        PN
Sbjct: 69  FIWFQMVLWIGPGIQPQVAPFLIVPVTSKELTSDDSQNASVE---YDAVIPPKCYQSDPN 125

Query: 136 ---VQCRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISL 192
              + C  C   K  RS H +    C+   DH+CVW+   IG+ NY+ F  F        
Sbjct: 126 GYPIWCSPCQSLKMERSHHSSELGHCIPRFDHYCVWIGTIIGRDNYRPFVQF-----TGY 180

Query: 193 SYGFLRVLWISV 204
               L ++W+S+
Sbjct: 181 FSSLLLIMWVSI 192

>CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459c
          Length = 352

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 68/177 (38%), Gaps = 35/177 (19%)

Query: 51  WKFYVVPAFYLSLYCYIIFVLIRD-----VIPVIGNRLLSVEKLC---IIPVLVVATPVL 102
           W  Y+VP   L L  Y  +          V    G++  ++  +C   ++  L++A  VL
Sbjct: 13  WTIYIVPLVVLLLMIYGTWAYCHKLCYERVYRDFGHKATAIGLICTCCVLDALIIAIWVL 72

Query: 103 GWLSMTVKAKTSRGCQPGSA-----QEYDYDYILYYPN----------VQCRTCHIEKPA 147
                        G QPG A        D +     PN          V C  C   K  
Sbjct: 73  -------IVSCGPGHQPGVAPHLLVDSADLENTTVAPNCYQSDPHGYPVWCSNCQSLKVG 125

Query: 148 RSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRVLWISV 204
           R++H +    CV   DH+CVW+   IG  NY+ F  F+    +      L ++WI++
Sbjct: 126 RTKHSSHQGHCVPRFDHYCVWLGAVIGFKNYRLFVQFVFYFAV-----LLMIVWITI 177

>Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459C -
           Hypothetical ORF [contig 196] FULL
          Length = 356

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 49/108 (45%), Gaps = 9/108 (8%)

Query: 133 YPNVQCRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAF------LV 186
           YP + C  C   K  R+ H +    C+   DH+CVW+   +G+ NY+ F  F        
Sbjct: 121 YP-IWCTACQSLKSNRTHHSSTLGYCIPRFDHYCVWIGTIVGRKNYRLFVQFAFYFWLFT 179

Query: 187 VNVISLSYGFLRVLWISVMKDPSMVVYPRSILIFTILCGTFAIICGVF 234
           + +I+    FLR +  S  + P   V P  +++  + C    ++  +F
Sbjct: 180 IYMIASIASFLRRIIKSRSQIPR--VNPNILVVLALCCMAMLMVGPLF 225

>Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}
           complement(77926..80259) [2334 nt, 778 aa]
          Length = 777

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISL-SYGF 196
           C    + KP RSR+  L    V   DH C W+ N IG  N++ F  F+++ VI +  Y +
Sbjct: 479 CIESSVRKPLRSRYSYLNSAIVTRFDHFCPWIYNDIGLKNHKLFVLFIILMVIGIWEYTY 538

Query: 197 LRVLWISVMKD 207
           L + +   ++D
Sbjct: 539 LAMEYFDELED 549

>ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 759

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 77/198 (38%), Gaps = 44/198 (22%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQ-FFYAFLVVNVISLSYGF 196
           C    ++KP RSR  +L    V   DH+C WV N IG  N++ F    L+V ++ L + +
Sbjct: 464 CIETWVKKPLRSRFSSLSNSLVARFDHYCPWVYNDIGLRNHKAFLMCILLVEILMLLFNY 523

Query: 197 LRVLWISVMKD----------PSMVVYPRSILIFTILCGTFAIIC-----------GVFT 235
           L + +   ++D          P   +     L        FA +            G+  
Sbjct: 524 LCMEYFDELEDVHKHADNGGEPKCTILRNENLCLGFTYDRFAFLTFVWVVFHSVWVGLLV 583

Query: 236 YLQLQLVNDGMTTGEKDKWYTIQQIMREGNLVRTLDGQFFIQDQQNPNQFYSTNAYDSKL 295
            +QL  V  G+T       Y   ++M+E  + RT D   F       N+F+ T       
Sbjct: 584 IVQLFQVFQGVTN------YEFSKLMKESRINRT-DPVLF-------NEFFGT------- 622

Query: 296 YVPQNYSIVNDPKDITNI 313
             P+    VN   D TN+
Sbjct: 623 -APEELLTVNGEIDNTNL 639

>YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}
           PFA5Palmitoyltransferase with autoacylation activity;
           likely functions in pathway(s) outside Ras; member of a
           family of putative palmitoyltransferases containing an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain
          Length = 374

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 70/175 (40%), Gaps = 38/175 (21%)

Query: 44  QEDQRFRWKFYVVPAFYLSLYCY----IIFVLIRDVIPVIGNRLLSVEKLCIIPVLVVAT 99
           Q D+R R K   V    +   C+    +IF+ ++ VI V       V    I+P+     
Sbjct: 42  QVDKRLRQK--SVSVGLICAVCFLDVVVIFIWLQIVILVGPGTQPHVAPFLILPI----- 94

Query: 100 PVLGWLSMTVKAKTSRGCQPGSAQEYDYDYIL----------YYPNVQCRTCHIEKPARS 149
                     + KTS   Q  S +   YD ++           YP + C  C   K  R+
Sbjct: 95  --------ASEEKTSNTSQNTSVE---YDAVVPPKCYQSDPHGYP-IWCSECQSLKMERT 142

Query: 150 RHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRVLWISV 204
            H +    C+   DH+C+W+   IG+ NY+ F  F      +     L ++W+S+
Sbjct: 143 HHSSELGHCIPRFDHYCMWIGTVIGRDNYRLFVQF-----AAYFSTLLLIMWVSI 192

>ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 365

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 39/85 (45%), Gaps = 12/85 (14%)

Query: 133 YPNVQCRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISL 192
           YP + C  C   K  R+ H      CV   DH C ++ + IGK NY+ F  + V   I  
Sbjct: 123 YP-IWCTNCQSLKTERAHHSRELGHCVPKFDHKCTYLGSIIGKDNYRLFVQYCVFMTI-- 179

Query: 193 SYGFLRVLWISVMKDPSMVVYPRSI 217
              +L ++W S+      V Y RSI
Sbjct: 180 ---WLAIIWTSI------VAYIRSI 195

>KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.626
           YOR034C
          Length = 682

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 58/126 (46%), Gaps = 13/126 (10%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLV-VNVISLSYGF 196
           C    I KP R     L ++ V   DH+C W+ N +G  N++ +  FL+ +    +++G 
Sbjct: 405 CLKTWIRKPVRCSLSKLNQQQVARFDHYCAWIYNDVGLKNHKLYIFFLILLETFLMTFGV 464

Query: 197 LRVLWISVM-KDPSMVVYPRSIL---------IFTILCGTF--AIICGVFTYLQLQLVND 244
           L   +  +M K     ++ R+I+         +F  L  T   AI  G    LQL+ +  
Sbjct: 465 LNWRYFGLMEKTAECFLFNRTIICHGYKNLKVVFLFLVWTIFQAIFVGNLLMLQLRKIAY 524

Query: 245 GMTTGE 250
           G+TT E
Sbjct: 525 GITTFE 530

>TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {ON}
           Anc_5.579 YDR459C
          Length = 365

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%)

Query: 136 VQCRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVI 190
           + C  C   K  R+ H +    CV   DH C W+   IG+ NY+FF  F++   I
Sbjct: 125 IWCSACDSVKTERAHHSSDMEYCVPRFDHKCAWLGAVIGRDNYRFFIQFVMYMAI 179

>Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {ON}
           YDR459C (REAL)
          Length = 388

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 133 YPNVQCRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLV 186
           YP + C  C   K  R+ H +    CV   DH+C+WV   IG+ NY+ F  F+ 
Sbjct: 133 YP-IWCSPCQSLKMERTHHSSELGHCVPRFDHYCLWVGTVIGRDNYRLFVQFVT 185

>ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR459C
          Length = 359

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 133 YPNVQCRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLV 186
           YP V C  C   K  R+ H      CV   DH+CVW+   IG+ NY+ F  FL+
Sbjct: 118 YP-VWCSVCQSLKGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYRLFNQFLM 170

>SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 364

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 60/161 (37%), Gaps = 35/161 (21%)

Query: 55  VVPAFYLSLYCYIIFVLIR-----DVIPVIGNRLLSVEKLCIIPVLVVATPVLGWLSMTV 109
           VVP     L CY  +V        ++    G++ +++  +C   +LV+    + W  M +
Sbjct: 17  VVPLILFGLLCYATWVYCHKLCYDEIYKRFGHKSIAIGLMCPEIILVIVI-FVTWAQMLI 75

Query: 110 KAKTSRGCQP--------------GSAQEYD-YDYILYYPN-----------VQCRTCHI 143
                 G QP              GS    D  D +  +P            + C  C  
Sbjct: 76  LGP---GVQPKVPPFRIVADRDNNGSGTSVDEKDQLSIFPPDIYQCDPQGYPIWCSMCQS 132

Query: 144 EKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAF 184
            K  R+ H      CV   DH+CVW+   +G+ NY+ F  F
Sbjct: 133 LKMERTHHSATLGYCVPRFDHYCVWIGTVVGRKNYRLFIQF 173

>KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} similar
           to uniprot|Q03289 Saccharomyces cerevisiae YDR459C
           likely functions in pathway(s) outside Ras
          Length = 349

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 34/66 (51%), Gaps = 6/66 (9%)

Query: 133 YPNVQCRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAF-----LVV 187
           YP + C  C   K +R+ H      CV   DH+CVW+   +G+ NY+ F  F     LVV
Sbjct: 124 YP-IWCSNCQSLKMSRTHHSTKVGYCVPRFDHYCVWIGTVLGRLNYKLFVQFTFYLDLVV 182

Query: 188 NVISLS 193
            ++ +S
Sbjct: 183 LILMIS 188

>NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {ON}
           Anc_5.579 YDR459C
          Length = 374

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 24/48 (50%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFL 185
           C  C   K +RS H      C+L  DH+C W+   I + NY+ F  ++
Sbjct: 118 CTHCQSLKLSRSHHSKQVGRCILRFDHYCAWIGCVIARNNYRLFLQYV 165

>CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264c
           ankyrin repeat-containing protein
          Length = 763

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 72/165 (43%), Gaps = 29/165 (17%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFL 197
           C    + KP RS++  L    +L  DH+C W+ N +G  N++ F  F++   + + + F+
Sbjct: 456 CLETWVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFILALELGI-FSFV 514

Query: 198 RV---LWISVMKDPSMVVYPRSILI-------FTILCGTFAIICGVFTY----LQLQLVN 243
           +V    +  +  D    +     L        FT L  T+A I  V+ +    +QL  + 
Sbjct: 515 KVCLKYFDELDMDGDCFILGDDDLCSGLIGDRFTFLIMTWACIQAVWIFSLVIVQLFQIT 574

Query: 244 DGMTTGEKDKWYTIQQIMREGNLVRTLDGQFFIQDQQNPNQFYST 288
            G+T  E      +  ++REG  V          D Q  N+F++T
Sbjct: 575 KGLTNSE------LNALIREGRRVDI--------DSQTHNEFFNT 605

>NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {ON}
           Anc_5.579 YDR459C
          Length = 406

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 12/89 (13%)

Query: 133 YPNVQCRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISL 192
           YP + C  C   K  R  H      C+   DH+C W+   IG+ NY+ F  ++    + L
Sbjct: 113 YP-IWCTYCQSLKLERVHHSRQLGYCIFRFDHYCAWIGTVIGRNNYRLFIQYVFYYNLLL 171

Query: 193 SYGFLRVLWISVMKDPSMVVYPRSILIFT 221
           ++     +W+S+        + RSI+ F 
Sbjct: 172 AW-----IWLSI------SAFIRSIVTFN 189

>SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {ON}
           uniprot|Q875S9 Saccharomyces kluyveri AKR1
           Palmitoyltransferase AKR1
          Length = 737

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLV 186
           C +  + KP RS+  N  R  V   DH C W+ N IG  N++ F  F++
Sbjct: 452 CISTWVRKPIRSKFSNFSRALVTRFDHFCPWIYNDIGLRNHKTFLFFIL 500

>KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.626
           YOR034C
          Length = 757

 Score = 37.0 bits (84), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 28/60 (46%), Gaps = 4/60 (6%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFL 197
           C    I KP RS+        V   DH+C WV N IG  N++ F  F    +IS+  G L
Sbjct: 463 CIETWIRKPLRSKFSTFYNSTVSRFDHYCPWVYNDIGLKNHKIFIFF----IISVEIGIL 518

>TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {ON}
           Anc_5.626 YOR034C
          Length = 750

 Score = 36.6 bits (83), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 36/87 (41%), Gaps = 14/87 (16%)

Query: 112 KTSRGCQPGSAQEYDYDYIL-----------YYPNVQCRTCHIEKPARSRHCNLCRECVL 160
           K   GC P    E DY+ I            Y     C    I KP RSR  +L    + 
Sbjct: 428 KEDSGCVP---PERDYEKIRDTVSELLKVGKYDTRHFCIESWIRKPLRSRFSSLNGTLIA 484

Query: 161 VADHHCVWVNNCIGKGNYQFFYAFLVV 187
             DH+C W+ N +G  N++ F  F+ +
Sbjct: 485 RFDHYCPWIYNDVGLKNHKRFLYFVAL 511

>NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.626
           YDR264C
          Length = 786

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 1/71 (1%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAF-LVVNVISLSYGF 196
           C      KP RS++ +L    V   DH C W+ N +G  N++ F  F L+V    +++  
Sbjct: 474 CLESWTRKPLRSKYSHLNNALVARFDHFCPWIYNDVGLKNHKNFIGFILLVEAGIITFAS 533

Query: 197 LRVLWISVMKD 207
           L   +   +KD
Sbjct: 534 LCFEYFDELKD 544

>TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {ON}
           Anc_5.626 YOR034C
          Length = 739

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 51/106 (48%), Gaps = 6/106 (5%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFL 197
           C    + KP RS+   L +  V   DH+C WV N IG  N++ F  F+  + +++ + F+
Sbjct: 468 CLETWVRKPLRSKFSYLNQSVVNRYDHYCPWVYNDIGLRNHKRFIMFIFFSEVTI-WSFV 526

Query: 198 RVLW-----ISVMKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQ 238
            V +     + V +D   ++     +   +L   F ++  V++ LQ
Sbjct: 527 IVCFEYFDELEVEEDAKCLLMGGGSVCKGVLKSRFTLLLMVWSMLQ 572

>Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON}
           YDR264C (REAL)
          Length = 763

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVV 187
           C      KP RSR  +L    V   DH+C W+ N +G  N++ F  F+ +
Sbjct: 471 CIETWARKPLRSRFSSLNNAVVARFDHYCPWIFNDVGLKNHKGFMFFITL 520

>KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 734

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 47/106 (44%), Gaps = 5/106 (4%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFL 197
           C   +  KP RS+        ++  DH C W+ N +G  N++ F  FL+  V  +S  F+
Sbjct: 454 CVDTYKRKPLRSKFSRFNEALIVRFDHFCPWIYNDVGLLNHKQFIYFLLSLVSGVSCFFI 513

Query: 198 R-VLWISVMKDPSMVVYPRSILIFTILCG----TFAIICGVFTYLQ 238
             + +   ++D S   +   I    I  G    TFA +   +T +Q
Sbjct: 514 ACIEYFDFLEDESKTDFKCGIFDDEICAGFHLDTFAFLVLSWTLIQ 559

>NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa]
           {ON} Anc_5.626
          Length = 757

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 26/55 (47%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISL 192
           C    I KP RS    L    V   DH C W+ N IG  N++ F  F+++  + +
Sbjct: 457 CLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFILLTEVGI 511

>KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264C AKR1
           Palmitoyl transferase involved in protein palmitoylation
          Length = 752

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVA-DHHCVWVNNCIGKGNYQFFYAFLVVNVISL 192
           C    I  P RS++ +    C++ A DH C WV N IG  N++ FY F+V+  IS+
Sbjct: 468 CVHTWIRIPLRSKY-DRDSACLISAFDHFCPWVYNQIGLLNHKLFYMFVVLLEISV 522

>Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {ON}
           YOR034C (REAL)
          Length = 744

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 59/153 (38%), Gaps = 18/153 (11%)

Query: 58  AFYLSLYCYIIFVLIRDVIPVIGNRLLSVEKLCIIPVLVVATPVLGWLSMTVKAKTSRGC 117
             +LS +C++IFV  + + P       SV    +  V  + T +L ++      ++  GC
Sbjct: 363 GLFLSTFCFLIFVWTKKLYPY------SVYDYIMKNVQFLVTSLLTFILFLKLVRSDPGC 416

Query: 118 QPG-----SAQEYDYDYIL---YYPNVQCRTCHIEKPARSRHCNLCRECVLVADHHCVWV 169
                   S QE     I    +     C      KP RS+        V   DH C WV
Sbjct: 417 LKTDDSLISIQETIKQLIQLGKFDRENFCVETLERKPLRSKFSPFSGALVARYDHFCPWV 476

Query: 170 NNCIGKGNYQFFYAFLVVNVISLSYGFLRVLWI 202
            N IG  N++ F  F     +++ Y     +W+
Sbjct: 477 YNDIGLKNHKLFLFF----ALTVQYHMFLFMWL 505

>Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 25/49 (51%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLV 186
           C      KP RS++ +L    V   DH+C W+ N +G  N++ F  F+ 
Sbjct: 472 CIETWTRKPLRSKYSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFIT 520

>YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}
           AKR1Palmitoyl transferase involved in protein
           palmitoylation; acts as a negative regulator of
           pheromone response pathway; required for endocytosis of
           pheromone receptors; involved in cell shape control;
           contains ankyrin repeats
          Length = 764

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVV 187
           C    I KP RS+   L    V   DH+C W+ N +G  N++ F  F+ +
Sbjct: 472 CIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFITL 521

>Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVV 187
           C      KP RS+  +L    V   DH+C W+ N +G  N++ F  F+ +
Sbjct: 472 CIETWTRKPLRSKFSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFIAL 521

>TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626
           YOR034C
          Length = 759

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 25/49 (51%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLV 186
           C      KP RSR+  +    V   DH+C WV N +G  N++ F  F++
Sbjct: 464 CIETLTRKPLRSRYSYMNNALVSRFDHYCPWVYNDVGLKNHKTFLFFIL 512

>TBLA0A06990 Chr1 (1707542..1707982) [441 bp, 146 aa] {ON} Anc_5.549
           YDR437W
          Length = 146

 Score = 33.1 bits (74), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 229 IICGVFTYLQLQLVNDGMTTGEKDKWYTIQQIMREGNLVRTLDGQFFIQD 278
           ++  +FTY+ L + N+ + T   D   TI  I ++GNLV T D + FIQD
Sbjct: 75  LMSMMFTYMGLLMYNEDVLTKNLDDITTI--IDKDGNLVITNDTKKFIQD 122

>YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON}
           AKR2Ankyrin repeat-containing protein similar to Akr1p;
           member of a family of putative palmitoyltransferases
           containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD)
           domain; possibly involved in constitutive endocytosis of
           Ste3p
          Length = 749

 Score = 33.9 bits (76), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 4/58 (6%)

Query: 145 KPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRVLWI 202
           KP RS++       V   DH+C W+ N +G  N++ F  F     +++ Y     +W+
Sbjct: 455 KPLRSKYSFFSGALVARYDHYCPWIYNDVGLKNHKLFVFF----AVTVQYHMFLFMWL 508

>Suva_4.49 Chr4 complement(89704..91767) [2064 bp, 687 aa] {ON}
           YDL199C (REAL)
          Length = 687

 Score = 33.9 bits (76), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 32/59 (54%), Gaps = 5/59 (8%)

Query: 29  WPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFYLSLYCYIIFVLIRDVIPVIGNRLLSVE 87
           W F W+ + I  P+L +  R  WKFY++P+  LS +  IIFVL    I     RL S +
Sbjct: 512 WFFKWFASLI-TPILID--RLSWKFYLIPS--LSSFISIIFVLKNFPIETYDERLDSAD 565

>Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {ON}
           YOR034C (REAL)
          Length = 741

 Score = 33.9 bits (76), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 32/159 (20%), Positives = 62/159 (38%), Gaps = 26/159 (16%)

Query: 58  AFYLSLYCYIIFVLIRDVIP-------VIGNRLLSVEKLCIIPVLVVATPVLGWL----- 105
             +LS +C++IF+  + + P       +   + L+     II  L +     G L     
Sbjct: 360 GLFLSTFCFLIFIWTKKLYPYSVSDYTMKNMQFLTTSLFTIIIFLKLVRSDPGCLKTDDS 419

Query: 106 SMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTCHIEKPARSRHCNLCRECVLVADHH 165
           S +++    +  Q G   + ++          C      K  RS++       V   DH+
Sbjct: 420 STSIQETIKKLIQLGKFDKENF----------CVETLERKSLRSKYSVFSGALVARFDHY 469

Query: 166 CVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRVLWISV 204
           C W+ N IG  N++    F     +++ Y     +W+S+
Sbjct: 470 CPWIYNDIGLKNHKLSLFF----AMTVQYHMFLFMWLSL 504

>Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}
           YOR034C (REAL)
          Length = 730

 Score = 33.5 bits (75), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 30/71 (42%), Gaps = 4/71 (5%)

Query: 132 YYPNVQCRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVIS 191
           Y  N  C      KP RS++       V   +H+C WV N IG  N++ F  F      S
Sbjct: 425 YDRNNFCVETLERKPLRSKYSLFSGALVARFNHYCPWVYNDIGLKNHKLFMFF----AFS 480

Query: 192 LSYGFLRVLWI 202
           + Y     +W+
Sbjct: 481 VQYEMFLFMWL 491

>YDL199C Chr4 complement(101290..103353) [2064 bp, 687 aa] {ON}
           Putative transporter, member of the sugar porter family
          Length = 687

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 27/43 (62%), Gaps = 5/43 (11%)

Query: 29  WPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFYLSLYCYIIFVL 71
           W F W+ + I  P+L +  R  WKFY++P+  LS +  IIFVL
Sbjct: 512 WIFKWFVSLI-TPILID--RLSWKFYLIPS--LSSFISIIFVL 549

>Kpol_1060.30 s1060 complement(71627..76168) [4542 bp, 1513 aa] {ON}
           complement(71627..76168) [4542 nt, 1514 aa]
          Length = 1513

 Score = 32.3 bits (72), Expect = 1.9,   Method: Composition-based stats.
 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 3/37 (8%)

Query: 269 TLDGQFFIQDQQNPNQ---FYSTNAYDSKLYVPQNYS 302
           TLD  F+++  QN  Q   FY+T++Y    Y P  YS
Sbjct: 381 TLDTDFYLRRSQNREQGLQFYNTHSYSPTRYSPTRYS 417

>AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR264C
           (AKR1) and YOR034C (AKR2)
          Length = 724

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 23/47 (48%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAF 184
           C    I  P R+++       +L  DH+C W+ N IG  N++ F  F
Sbjct: 448 CIHSWIRLPLRAKYKRFVHSVILRYDHYCPWIYNYIGFRNHKIFIYF 494

>Skud_4.58 Chr4 complement(98588..100651) [2064 bp, 687 aa] {ON}
           YDL199C (REAL)
          Length = 687

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 5/43 (11%)

Query: 29  WPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFYLSLYCYIIFVL 71
           W F W+ + I  P+L +  R  WKFY++P+  LS +  IIF L
Sbjct: 512 WFFKWFASLI-TPILID--RLSWKFYLIPS--LSSFLSIIFTL 549

>KAFR0B05150 Chr2 complement(1059558..1060274) [717 bp, 238 aa] {ON}
           Anc_2.397 YMR134W
          Length = 238

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 22/98 (22%), Positives = 51/98 (52%), Gaps = 8/98 (8%)

Query: 217 ILIFTILCGTFAIICGVFTYLQLQLVN----DGMTTGEKDKWYTIQQIM--REGNLVRTL 270
           I +F I+ G+ A++  ++  +++ L+     D +  G  D+   + +++   E +    L
Sbjct: 41  ITLFLIIMGSLALVQEMWVSIEMTLLQKEAYDELNIGRIDEGLRLHKVLVNDEYHSREFL 100

Query: 271 DGQ--FFIQDQQNPNQFYSTNAYDSKLYVPQNYSIVND 306
           D +    I++ ++ ++F+S   + S LYV  N S+ N+
Sbjct: 101 DEKSGIVIEEFEDRDKFFSKPVHVSNLYVDCNISVSNE 138

>KAFR0C05960 Chr3 complement(1187537..1189720) [2184 bp, 727 aa]
           {ON} Anc_5.626 YOR034C
          Length = 727

 Score = 30.4 bits (67), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 24/45 (53%)

Query: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFY 182
           C T  + +P +S    L ++ V   DH+C+W+ N I   N + F+
Sbjct: 435 CLTTWVRRPFKSHISPLQKKRVAGFDHYCMWLYNDIALKNRKAFF 479

>Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar to
           Ashbya gossypii AER388C
          Length = 739

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 6/62 (9%)

Query: 146 PARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQ---FFYAFLVVNV---ISLSYGFLRV 199
           P RS++       +   DH+C WV N IG  N++   FF  FL + V   + LS  +  +
Sbjct: 464 PLRSKYKTARNVLIARYDHYCPWVYNQIGFCNHKIFLFFIMFLQIGVFIFVRLSIRYFEL 523

Query: 200 LW 201
            W
Sbjct: 524 EW 525

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.329    0.143    0.476 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,032,662
Number of extensions: 1431591
Number of successful extensions: 4459
Number of sequences better than 10.0: 146
Number of HSP's gapped: 4483
Number of HSP's successfully gapped: 147
Length of query: 328
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 218
Effective length of database: 40,868,139
Effective search space: 8909254302
Effective search space used: 8909254302
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 66 (30.0 bits)