Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0F039808.271ON86786745730.0
YBR294W (SUL1)na 1ON85986131000.0
Skud_2.424na 1ON86385730770.0
Smik_2.435na 1ON86385430660.0
Suva_4.554na 1ON85085730280.0
NCAS0B050508.271ON92389429590.0
NDAI0B020208.271ON90588829540.0
Skud_12.1608.271ON89389029510.0
Smik_12.1518.271ON89388529490.0
YLR092W (SUL2)8.271ON89388629450.0
Suva_10.1768.271ON89388129190.0
KNAG0G020708.271ON89988228070.0
SAKL0H16830g8.271ON86286027810.0
CAGL0L12342g8.271ON89189727660.0
TPHA0J008008.271ON91791027460.0
KAFR0B027508.271ON83485827260.0
Kpol_543.438.271ON86686327230.0
ZYRO0C01452g8.271ON90688427190.0
KLLA0F19338g8.271ON89179926370.0
TPHA0A017608.271ON89383425660.0
KLTH0G13486g8.271ON90290325610.0
Kwal_56.237598.271ON86188624630.0
AGR077C8.271ON84886624410.0
Ecym_42998.271ON87485822850.0
TBLA0F030508.271ON89753313791e-177
NDAI0B022108.99ON7064833315e-31
KNAG0D023908.99ON7164763201e-29
SAKL0B03124g8.99ON7444813155e-29
YPR003C8.99ON7544843112e-28
Ecym_7084na 2ON6895373084e-28
CAGL0L09207g8.99ON7255083074e-28
TBLA0C052708.99ON7764613041e-27
ZYRO0F04796g8.99ON7354853022e-27
Suva_16.3228.99ON7424823022e-27
NCAS0B048008.99ON7244773013e-27
Smik_16.2418.99ON7444842942e-26
TPHA0H007208.99ON7874822924e-26
Kwal_27.110398.99ON7264882905e-26
Kpol_467.118.99ON7445102871e-25
KLLA0E14059g8.99ON7065462825e-25
Skud_16.2868.99ON7454792825e-25
AGR213Cna 2ON6895412825e-25
KLTH0G16764g8.99ON7104712817e-25
SAKL0H08800gna 2ON6204442575e-22
TDEL0C012808.99ON7271401763e-12
KAFR0C019103.485ON10205451093e-04
NCAS0B05940singletonON155117770.63
Smik_7.1101.379ON57197743.8
Smik_16.2358.90ON374116733.9
Suva_12.375.261ON168360744.2
Skud_10.1755.261ON168360744.3
YJL039C (NUP192)5.261ON168360744.6
TDEL0E036505.261ON167269727.9
KLLA0E04731g3.485ON10601327110.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0F03980
         (867 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.2...  1766   0.0  
YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High a...  1198   0.0  
Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W ...  1189   0.0  
Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W ...  1185   0.0  
Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W ...  1170   0.0  
NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271   1144   0.0  
NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271   1142   0.0  
Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092...  1141   0.0  
Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092...  1140   0.0  
YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High ...  1139   0.0  
Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092...  1129   0.0  
KNAG0G02070 Chr7 (469623..472322) [2700 bp, 899 aa] {ON} Anc_8.2...  1085   0.0  
SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]...  1075   0.0  
CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON} sim...  1070   0.0  
TPHA0J00800 Chr10 (186144..188897) [2754 bp, 917 aa] {ON} Anc_8....  1062   0.0  
KAFR0B02750 Chr2 (562981..565485) [2505 bp, 834 aa] {ON} Anc_8.2...  1054   0.0  
Kpol_543.43 s543 (93697..96297) [2601 bp, 866 aa] {ON} (93697..9...  1053   0.0  
ZYRO0C01452g Chr3 complement(103175..105895) [2721 bp, 906 aa] {...  1051   0.0  
KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} simi...  1020   0.0  
TPHA0A01760 Chr1 complement(356771..359452) [2682 bp, 893 aa] {O...   993   0.0  
KLTH0G13486g Chr7 complement(1156678..1159386) [2709 bp, 902 aa]...   991   0.0  
Kwal_56.23759 s56 complement(693180..695765) [2586 bp, 861 aa] {...   953   0.0  
AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON} S...   944   0.0  
Ecym_4299 Chr4 complement(639078..641702) [2625 bp, 874 aa] {ON}...   884   0.0  
TBLA0F03050 Chr6 complement(738517..741210) [2694 bp, 897 aa] {O...   535   e-177
NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {O...   132   5e-31
KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.9...   127   1e-29
SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {...   125   5e-29
YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON} ...   124   2e-28
Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}...   123   4e-28
CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]...   122   4e-28
TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa] ...   121   1e-27
ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} simila...   120   2e-27
Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {...   120   2e-27
NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {O...   120   3e-27
Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {...   117   2e-26
TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {O...   117   4e-26
Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {...   116   5e-26
Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON} (26194..2...   115   1e-25
KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} simi...   113   5e-25
Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {...   113   5e-25
AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}...   113   5e-25
KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]...   112   7e-25
SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} simila...   103   5e-22
TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {O...    72   3e-12
KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3....    47   3e-04
NCAS0B05940 Chr2 complement(1126985..1127452) [468 bp, 155 aa] {...    34   0.63 
Smik_7.110 Chr7 (195430..197145) [1716 bp, 571 aa] {ON} YGL160W ...    33   3.8  
Smik_16.235 Chr16 (431691..432815) [1125 bp, 374 aa] {ON} YPL001...    33   3.9  
Suva_12.37 Chr12 complement(49774..54825) [5052 bp, 1683 aa] {ON...    33   4.2  
Skud_10.175 Chr10 (326685..331736) [5052 bp, 1683 aa] {ON} YJL03...    33   4.3  
YJL039C Chr10 complement(368748..373799) [5052 bp, 1683 aa] {ON}...    33   4.6  
TDEL0E03650 Chr5 (684366..689384) [5019 bp, 1672 aa] {ON} Anc_5....    32   7.9  
KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] ...    32   10.0 

>TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.271
           YLR092W
          Length = 867

 Score = 1766 bits (4573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 856/867 (98%), Positives = 856/867 (98%)

Query: 1   MGTREAESVPADSAFKLDDLEAEYDLYKANEQLEDNEVTVNGSEDDYGNKKGIDLVKETE 60
           MGTREAESVPADSAFKLDDLEAEYDLYKANEQLEDNEVTVNGSEDDYGNKKGIDLVKETE
Sbjct: 1   MGTREAESVPADSAFKLDDLEAEYDLYKANEQLEDNEVTVNGSEDDYGNKKGIDLVKETE 60

Query: 61  VRYYGSPGPEAIGGNIPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHY 120
           VRYYGSPGPEAIGGNIPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHY
Sbjct: 61  VRYYGSPGPEAIGGNIPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHY 120

Query: 121 NLTWGYADLVAGITVGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIG 180
           NLTWGYADLVAGITVGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIG
Sbjct: 121 NLTWGYADLVAGITVGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIG 180

Query: 181 PVAVMSLQTAKVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELIS 240
           PVAVMSLQTAKVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELIS
Sbjct: 181 PVAVMSLQTAKVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELIS 240

Query: 241 LNAVAGFMTGSAFNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVP 300
           LNAVAGFMTGSAFNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVP
Sbjct: 241 LNAVAGFMTGSAFNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVP 300

Query: 301 LCLLYLWKWWCGTYGPKLADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRIT 360
           LCLLYLWKWWCGTYGPKLADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRIT
Sbjct: 301 LCLLYLWKWWCGTYGPKLADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRIT 360

Query: 361 KNKDKEHRPIKVLGTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGR 420
           KNKDKEHRPIKVLGTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGR
Sbjct: 361 KNKDKEHRPIKVLGTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGR 420

Query: 421 INDYKVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLV 480
           INDYKVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLV
Sbjct: 421 INDYKVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLV 480

Query: 481 AIYCLTDAFFFIPSATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSS 540
           AIYCLTDAFFFIPSATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSS
Sbjct: 481 AIYCLTDAFFFIPSATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSS 540

Query: 541 IENGIYFAMCWSCAMLLLKHAFPAGQFLGRVEVAEVINPTVVEDVEAISINDQIEGSVGK 600
           IENGIYFAMCWSCAMLLLKHAFPAGQFLGRVEVAEVINPTVVEDVEAISINDQIEGSVGK
Sbjct: 541 IENGIYFAMCWSCAMLLLKHAFPAGQFLGRVEVAEVINPTVVEDVEAISINDQIEGSVGK 600

Query: 601 SKSLKADKGAISASSGSNYKFHSKWVAEQYAYNRELNPDVKILPPPPGVVVYRMSDSFTY 660
           SKSLKADKGAISASSGSNYKFHSKWVAEQYAYNRELNPDVKILPPPPGVVVYRMSDSFTY
Sbjct: 601 SKSLKADKGAISASSGSNYKFHSKWVAEQYAYNRELNPDVKILPPPPGVVVYRMSDSFTY 660

Query: 661 INCSRHYDTIFDHIKKHTRRGQLLHLRKKSDRPWNDPGEWEISPSIKKFFKLGKKNQNDI 720
           INCSRHYDTIFDHIKKHTRRGQLLHLRKKSDRPWNDPGEWEISPSIKKFFKLGKKNQNDI
Sbjct: 661 INCSRHYDTIFDHIKKHTRRGQLLHLRKKSDRPWNDPGEWEISPSIKKFFKLGKKNQNDI 720

Query: 721 ESQDEDVAIDNTRDERPLLKIICLDFSQVVQVDSTAIQSLVDLRKAVHKYADRQVEFHFT 780
           ESQDEDVAIDNTRDERPLLKIICLDFSQVVQVDSTAIQSLVDLRKAVHKYADRQVEFHFT
Sbjct: 721 ESQDEDVAIDNTRDERPLLKIICLDFSQVVQVDSTAIQSLVDLRKAVHKYADRQVEFHFT 780

Query: 781 GIISSWVKRSLLSMGFGTVNASYSDESIIAGHSSYHIAKTTKPLADDFTTDXXXXXXXXX 840
           GIISSWVKRSLLSMGFGTVNASYSDESIIAGHSSYHIAKTTKPLADDFTTD         
Sbjct: 781 GIISSWVKRSLLSMGFGTVNASYSDESIIAGHSSYHIAKTTKPLADDFTTDSSGSSQLQQ 840

Query: 841 XXEIYAATGTNMPFFHLDIPDFSKWDL 867
             EIYAATGTNMPFFHLDIPDFSKWDL
Sbjct: 841 SQEIYAATGTNMPFFHLDIPDFSKWDL 867

>YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High
           affinity sulfate permease of the SulP anion transporter
           family; sulfate uptake is mediated by specific sulfate
           transporters Sul1p and Sul2p, which control the
           concentration of endogenous activated sulfate
           intermediates
          Length = 859

 Score = 1198 bits (3100), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 581/861 (67%), Positives = 682/861 (79%), Gaps = 29/861 (3%)

Query: 17  LDDLEAEYDLYKANEQLEDNEVTVNGSEDDYG-----NKKGIDLVKETEVRYYGSPGPEA 71
           ++  E+EY  Y+ +E  E+ +   NG E+++       K G+   + ++V Y        
Sbjct: 18  IEVFESEYRTYRESEAAENRDGLHNGDEENWKVNSSKQKFGVTKNELSDVLY-------- 69

Query: 72  IGGNIPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYADLVA 131
              +IP +EESTV++K+YY+  I+  LT  SAGSY+ SLFPI+KWFPHYN TWGYADLVA
Sbjct: 70  --DSIPAYEESTVTLKEYYDHSIKNNLTAKSAGSYLVSLFPIIKWFPHYNFTWGYADLVA 127

Query: 132 GITVGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAK 191
           GITVGCVLVPQSMSYAQIASL P+YGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAK
Sbjct: 128 GITVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAK 187

Query: 192 VIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVAGFMTGS 251
           VIA+V  KYPE+   VTAP+IAT L LLCGIVA G+G+LRLGFLVELISLNAVAGFMTGS
Sbjct: 188 VIAEVLKKYPEDQTEVTAPIIATTLCLLCGIVATGLGILRLGFLVELISLNAVAGFMTGS 247

Query: 252 AFNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYLWKWWC 311
           AFNI+WGQ+PALMGY+S VNTR +TYKVVI++LKHLP+TKLDAVFGL+PL +LY+WKWWC
Sbjct: 248 AFNIIWGQIPALMGYNSLVNTREATYKVVINTLKHLPNTKLDAVFGLIPLVILYVWKWWC 307

Query: 312 GTYGPKLADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNKDKEHRPIK 371
           GT+G  LADR   + PK    LK FYFY+ AMRNAV+I+VFTAISW IT+NK  + RPI 
Sbjct: 308 GTFGITLADRYYRNQPKVANRLKSFYFYAQAMRNAVVIVVFTAISWSITRNKSSKDRPIS 367

Query: 372 VLGTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRINDYKVVPDQE 431
           +LGTVPSGL +VGV KIP+GLL+ M+ +IPASIIVL+LEHIAISKSFGRINDYKVVPDQE
Sbjct: 368 ILGTVPSGLNEVGVMKIPDGLLSNMSSEIPASIIVLVLEHIAISKSFGRINDYKVVPDQE 427

Query: 432 LIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFFF 491
           LIAIG TNLIGTFF++YPATGSFSRSALKAKC VRTPFSGVFTG CVL+A+YCLTDAFFF
Sbjct: 428 LIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGGCVLLALYCLTDAFFF 487

Query: 492 IPSATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIYFAMCW 551
           IP ATLSAVIIHAVSDLL SYKTTW FWK NPLDC +FIVTV ITVFSSIENGIYFAMCW
Sbjct: 488 IPKATLSAVIIHAVSDLLTSYKTTWTFWKTNPLDCISFIVTVFITVFSSIENGIYFAMCW 547

Query: 552 SCAMLLLKHAFPAGQFLGRVEVAEVINPTVVEDVEAISINDQIEGSVGKSKSLKADKGAI 611
           SCAMLLLK AFPAG+FLGRVEVAEV+NPTV ED++A+  ++++   + K       K  +
Sbjct: 548 SCAMLLLKQAFPAGKFLGRVEVAEVLNPTVQEDIDAVISSNELPNELNKQV-----KSTV 602

Query: 612 SASSGSNYKFHSKWVAEQYAYNRELNPDVKILPPPPGVVVYRMSDSFTYINCSRHYDTIF 671
                  YKF  KWV   + Y+RELN +  + PPPPGV+VYR+ DSFTY+NCSRHYD IF
Sbjct: 603 EVLPAPEYKFSVKWVPFDHGYSRELNINTTVRPPPPGVIVYRLGDSFTYVNCSRHYDIIF 662

Query: 672 DHIKKHTRRGQLLHLRKKSDRPWNDPGEWEISPSIKKFFKLGKKNQNDIESQDEDVAIDN 731
           D IK+ TRRGQL+ LRKKSDRPWNDPGEW++  S+K  FK  + +     + + D+ I N
Sbjct: 663 DRIKEETRRGQLITLRKKSDRPWNDPGEWKMPDSLKSLFKFKRHSA----TTNSDLPISN 718

Query: 732 TRD-----ERPLLKIICLDFSQVVQVDSTAIQSLVDLRKAVHKYADRQVEFHFTGIISSW 786
                   E+PLLK++CLDFSQV QVDSTA+QSLVDLRKAV++YADRQVEFHF GIIS W
Sbjct: 719 GSSNGETYEKPLLKVVCLDFSQVAQVDSTAVQSLVDLRKAVNRYADRQVEFHFAGIISPW 778

Query: 787 VKRSLLSMGFGTVNASYSDESIIAGHSSYHIAKTTKPLADDFTTDXXXXXXXXXXXEIYA 846
           +KRSLLS+ FGT N  YSD+SIIAGHSS+H+AK  K   D    D            + A
Sbjct: 779 IKRSLLSVKFGTTNEEYSDDSIIAGHSSFHVAKVLKDDVDYTDEDSRISTSYSNYETLCA 838

Query: 847 ATGTNMPFFHLDIPDFSKWDL 867
           ATGTN+PFFH+DIPDFSKWD+
Sbjct: 839 ATGTNLPFFHIDIPDFSKWDV 859

>Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W
           (REAL)
          Length = 863

 Score = 1189 bits (3077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 573/857 (66%), Positives = 678/857 (79%), Gaps = 22/857 (2%)

Query: 17  LDDLEAEYDLYKANEQLEDNEVTVNGSEDDYG-NKKGIDLVKETEVRYYGSPGPEAIGGN 75
           ++  E+EY  Y+ +E  E+ +   NG +  +  N K    V ++EV        +    +
Sbjct: 23  IEVFESEYRTYRESEAAENRDNFQNGDDQSWKINGKQKYEVTKSEVS-------DVAYDS 75

Query: 76  IPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYADLVAGITV 135
           IP +EESTV++K+YY+  I+  LT+ SAG Y+YSLFPI+KW PHYN TWGYADLVAGITV
Sbjct: 76  IPAYEESTVTLKEYYDHSIKSSLTVKSAGDYLYSLFPIIKWLPHYNFTWGYADLVAGITV 135

Query: 136 GCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAQ 195
           GCVLVPQSMSYAQIASL P+YGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIA+
Sbjct: 136 GCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAE 195

Query: 196 VSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVAGFMTGSAFNI 255
           V  KYPE    VT P+IATAL  LCG+V+  +G+LRLGFLVELISLNAVAGFMTGSAF+I
Sbjct: 196 VLKKYPEGQTEVTGPIIATALCFLCGVVSTALGVLRLGFLVELISLNAVAGFMTGSAFSI 255

Query: 256 LWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYLWKWWCGTYG 315
           +WGQ+PALMGY+S VNTR +TYKVVI++LKHLP+TKLDAVFGL+PL +LY+WKWWCGT+G
Sbjct: 256 IWGQIPALMGYNSLVNTREATYKVVINTLKHLPNTKLDAVFGLIPLVILYVWKWWCGTFG 315

Query: 316 PKLADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNKDKEHRPIKVLGT 375
             LADR   + PK    LK FYFY+ AMRNAV+IIVFTAISWRIT+NK  + RPI +LGT
Sbjct: 316 ITLADRYYRNQPKIANRLKSFYFYAQAMRNAVVIIVFTAISWRITRNKSSKERPISILGT 375

Query: 376 VPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAI 435
           VPSGL +VGV KIPEGLL+ M+ ++PASIIVL+LEHIAISKSFGRINDYKV+PDQELIAI
Sbjct: 376 VPSGLNEVGVMKIPEGLLSNMSSELPASIIVLVLEHIAISKSFGRINDYKVIPDQELIAI 435

Query: 436 GATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFFFIPSA 495
           G TNLIGTFF++YPATGSFSRSALKAKC VRTPFSG+FTG CVL+A+YCLT AFFFIP A
Sbjct: 436 GVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGIFTGACVLLALYCLTSAFFFIPKA 495

Query: 496 TLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIYFAMCWSCAM 555
           TLSAVIIHAVSDLL SYKTTW FWK NPLDC +FI TV ITVFSSIENGIYFAMCWSCAM
Sbjct: 496 TLSAVIIHAVSDLLTSYKTTWIFWKTNPLDCISFIATVFITVFSSIENGIYFAMCWSCAM 555

Query: 556 LLLKHAFPAGQFLGRVEVAEVINPTVVEDVEAISINDQIEGSVGKSKSLKADKGAISASS 615
           LLLK AFPAG+FLGRVEVAEV+NPTV E + A++ ++++   + K       K  +    
Sbjct: 556 LLLKQAFPAGKFLGRVEVAEVLNPTVQEGINAVTSSNELPNELSKQV-----KSTVDVLP 610

Query: 616 GSNYKFHSKWVAEQYAYNRELNPDVKILPPPPGVVVYRMSDSFTYINCSRHYDTIFDHIK 675
              YKF  KW+   + Y+RELN   K+ PPPPGV+VYR++DSFTY+NCSRHYD IFD IK
Sbjct: 611 APEYKFSVKWIPFDHDYSRELNRYTKVRPPPPGVIVYRLADSFTYVNCSRHYDIIFDRIK 670

Query: 676 KHTRRGQLLHLRKKSDRPWNDPGEWEISPSIKKFFKLGKKNQNDIESQDEDVAIDNTRD- 734
           + TRRGQL+ LRKKSDRPWNDPGEW++  S K  FK  +K+     + D ++ + + R+ 
Sbjct: 671 EETRRGQLISLRKKSDRPWNDPGEWKMPNSFKALFKFKRKSA----TTDNELPVSSGRNN 726

Query: 735 ----ERPLLKIICLDFSQVVQVDSTAIQSLVDLRKAVHKYADRQVEFHFTGIISSWVKRS 790
               E+PLLK++CLDFSQV QVDSTA+QSLVDLRKAV+KYADRQVEFHF GIIS W+KRS
Sbjct: 727 QESYEKPLLKVVCLDFSQVAQVDSTAVQSLVDLRKAVNKYADRQVEFHFAGIISPWIKRS 786

Query: 791 LLSMGFGTVNASYSDESIIAGHSSYHIAKTTKPLADDFTTDXXXXXXXXXXXEIYAATGT 850
           LLS+ FGT N  YSD+SIIAGHSS+H+AK  K   D    D            + AATGT
Sbjct: 787 LLSVKFGTTNEEYSDDSIIAGHSSFHVAKVLKDDVDYTEEDSRISTSYSNYETLCAATGT 846

Query: 851 NMPFFHLDIPDFSKWDL 867
           N+PFFH+DIPDFSKWD+
Sbjct: 847 NLPFFHIDIPDFSKWDV 863

>Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W
           (REAL)
          Length = 863

 Score = 1185 bits (3066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 579/854 (67%), Positives = 679/854 (79%), Gaps = 16/854 (1%)

Query: 17  LDDLEAEYDLYKANEQLEDNEVTVNGSEDDYGNKKGIDLVKETEVRYYGSPGPEAIGGNI 76
           ++  E+EY  Y+  E  E+ E   N    D+     ++L          S   E    +I
Sbjct: 23  IEVFESEYRTYREAEAAENREEIQNDDNQDWKVPSKLNL------ELTNSKVSEVFYDSI 76

Query: 77  PGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYADLVAGITVG 136
           P +EE+TV++KDYY+  I++ LTL SAGSY+YSLFPI+KW PHYN TWGYADLVAGITVG
Sbjct: 77  PAYEENTVTLKDYYDHTIKDNLTLKSAGSYLYSLFPIIKWLPHYNFTWGYADLVAGITVG 136

Query: 137 CVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAQV 196
           CVLVPQSMSYAQIASL P+YGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIA+V
Sbjct: 137 CVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAEV 196

Query: 197 SAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVAGFMTGSAFNIL 256
             KYPE+   VT P+IAT L LLCG+VA G+G+LRLGFLVELISLNAVAGFMTGSAF+I+
Sbjct: 197 LKKYPEDQVEVTGPIIATTLCLLCGLVATGLGVLRLGFLVELISLNAVAGFMTGSAFSII 256

Query: 257 WGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYLWKWWCGTYGP 316
           WGQ+PALMGY+  VNTR +TYKVVI++LKHLP+TKLDAVFGL+PL +LYLWKWWCG++G 
Sbjct: 257 WGQIPALMGYNKLVNTREATYKVVINTLKHLPNTKLDAVFGLIPLVILYLWKWWCGSFGI 316

Query: 317 KLADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNKDKEHRPIKVLGTV 376
           KL DR  ++ PK    +K FYFY+ AMRNAV+IIVFTAIS+RIT+NK KE RPI +LGTV
Sbjct: 317 KLVDRHYSNQPKTANRIKSFYFYAQAMRNAVVIIVFTAISFRITRNKSKEKRPISILGTV 376

Query: 377 PSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIG 436
           PSGL +VGV KIP+GLL+ M+ ++PASIIVL+LEHIAISKSFGRINDYKV+PDQELIAIG
Sbjct: 377 PSGLNEVGVMKIPDGLLSNMSSELPASIIVLVLEHIAISKSFGRINDYKVIPDQELIAIG 436

Query: 437 ATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFFFIPSAT 496
            TNLIGTFF++YPATGSFSRSALKAKC VRTPFSGVFTG CVL+A+YCLT AFF+IP AT
Sbjct: 437 VTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGACVLLALYCLTSAFFYIPKAT 496

Query: 497 LSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIYFAMCWSCAML 556
           LSAVIIHAVSDLLASY+TTWNFWKMNPLDC +FIVTVLITVFSSIENGIYFAMCWSCAML
Sbjct: 497 LSAVIIHAVSDLLASYETTWNFWKMNPLDCISFIVTVLITVFSSIENGIYFAMCWSCAML 556

Query: 557 LLKHAFPAGQFLGRVEVAEVINPTVVEDVEAISINDQIEGSVGKSKSLKADKGAISASSG 616
           LLK AFPAG+FLGRVEVAEV+NPT+   +++I     +  +   ++  K  K ++ A   
Sbjct: 557 LLKQAFPAGKFLGRVEVAEVLNPTIQGHIDSI-----VSPNESPNEFSKQVKSSVDALPS 611

Query: 617 SNYKFHSKWVAEQYAYNRELNPDVKILPPPPGVVVYRMSDSFTYINCSRHYDTIFDHIKK 676
           S YKF  KWV   +AY RELN   ++ PPPPGV+VYR SDSFTY+NCSRHYD IFD IK+
Sbjct: 612 SEYKFSVKWVPFDHAYTRELNSYTRVRPPPPGVIVYRFSDSFTYVNCSRHYDVIFDRIKE 671

Query: 677 HTRRGQLLHLRKKSDRPWNDPGEWEISPSIKKFFKLGKKNQNDIESQDEDVAIDNTRD-- 734
            TRRGQL+ LRKKSDRPWNDPGEW++  S K  F++  K     ++ +     DNT    
Sbjct: 672 ETRRGQLVSLRKKSDRPWNDPGEWKLPNSFKNIFRV--KRGLATKNSELPAVNDNTNSES 729

Query: 735 -ERPLLKIICLDFSQVVQVDSTAIQSLVDLRKAVHKYADRQVEFHFTGIISSWVKRSLLS 793
            E+PLLK++CLDFSQV QVDSTA+QSLVDLRKAV+KYADRQVEFHF GIIS W+KRSLLS
Sbjct: 730 YEKPLLKVVCLDFSQVAQVDSTAVQSLVDLRKAVNKYADRQVEFHFAGIISPWIKRSLLS 789

Query: 794 MGFGTVNASYSDESIIAGHSSYHIAKTTKPLADDFTTDXXXXXXXXXXXEIYAATGTNMP 853
           + FGT+N  +SD SII GHSS+HIAK  K   D    D            + AATGTN+P
Sbjct: 790 VKFGTINEEFSDTSIITGHSSFHIAKVLKDEVDYTDEDSPISVTCSNYDTLCAATGTNLP 849

Query: 854 FFHLDIPDFSKWDL 867
           FFH+DIPDFSKWD+
Sbjct: 850 FFHIDIPDFSKWDV 863

>Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W
           (REAL)
          Length = 850

 Score = 1170 bits (3028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 569/857 (66%), Positives = 675/857 (78%), Gaps = 23/857 (2%)

Query: 15  FKLDDLEAEYDLYKANEQLEDNEVTVNGSEDDYGNKKGIDLVKETEVRYYGSPGPEAIGG 74
             ++  +++Y  Y+ +E           + DD  N++   +    +  +  +   +    
Sbjct: 13  LNIEIFDSKYSSYRESE--------AAANRDDSHNEQSWKVNGNRKFEHTKTESSDVSYD 64

Query: 75  NIPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYADLVAGIT 134
           +IP +EESTV++K+YY   I+  LT  SAG+YV SLFPIVKW PHYN TW YADLVAGIT
Sbjct: 65  SIPRYEESTVTLKEYYGHSIKNSLTAKSAGNYVSSLFPIVKWLPHYNFTWCYADLVAGIT 124

Query: 135 VGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIA 194
           VGCVLVPQSMSYAQIASL P+YGLYSSF+GAFIYSLFATSKDVCIGPVAVMSLQTAKVIA
Sbjct: 125 VGCVLVPQSMSYAQIASLSPEYGLYSSFVGAFIYSLFATSKDVCIGPVAVMSLQTAKVIA 184

Query: 195 QVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVAGFMTGSAFN 254
           +V  KYP++   VT P+IATAL LLCGIV   +G+LRLGFLVELISLNAVAGFMTGSAF+
Sbjct: 185 EVLKKYPQDQTEVTGPIIATALCLLCGIVTTALGVLRLGFLVELISLNAVAGFMTGSAFS 244

Query: 255 ILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYLWKWWCGTY 314
           I+WGQVPALMGY+  VNTR STYKVVI++LKHLP+TKLDAVFGL+PL +LY+WKWWCGTY
Sbjct: 245 IIWGQVPALMGYNKLVNTRESTYKVVINTLKHLPETKLDAVFGLIPLVILYVWKWWCGTY 304

Query: 315 GPKLADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNKDKEHRPIKVLG 374
           G  LA+R   + PK    LK FYFY+ AMRNAV+I+VFTAISW IT+NK  E RPI +LG
Sbjct: 305 GITLANRHYQNHPKIANNLKSFYFYAQAMRNAVVIVVFTAISWSITRNKASEDRPISILG 364

Query: 375 TVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRINDYKVVPDQELIA 434
           TVPSGL +VGV KIPEGLL+ M+ ++PASIIVL+LEHIAISKSFGRINDYKVVPDQELIA
Sbjct: 365 TVPSGLNEVGVMKIPEGLLSNMSSELPASIIVLVLEHIAISKSFGRINDYKVVPDQELIA 424

Query: 435 IGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFFFIPS 494
           IG TNL+GTFF++YPATGSFSRSALKAKC VRTPFSG+FTG CVL+A+YCLTDAFFFIP 
Sbjct: 425 IGVTNLVGTFFHSYPATGSFSRSALKAKCNVRTPFSGLFTGGCVLLALYCLTDAFFFIPK 484

Query: 495 ATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIYFAMCWSCA 554
           ATLSAVIIHAVSDLL SY+TTW FWK NPLDC +FIVTV ITVFSSIENGIYFAMCWSCA
Sbjct: 485 ATLSAVIIHAVSDLLTSYETTWTFWKTNPLDCVSFIVTVFITVFSSIENGIYFAMCWSCA 544

Query: 555 MLLLKHAFPAGQFLGRVEVAEVINPTVVEDVEAISINDQIEGSVGKSKSLKADKGAISAS 614
           +LLLK AFPAG+FLGRVEVAE++NPT+  +V A+         V  ++S K  K  +   
Sbjct: 545 ILLLKQAFPAGRFLGRVEVAEILNPTLQNNVSAV---------VSLNESNKQVKTTVDVL 595

Query: 615 SGSNYKFHSKWVAEQYAYNRELNPDVKILPPPPGVVVYRMSDSFTYINCSRHYDTIFDHI 674
             S Y+F +KWV   + Y+RELN   KI PPPPGV+VYR+SDSFTY+NCSRHYD IFDH+
Sbjct: 596 RSSEYRFTTKWVPFDHEYSRELNRCAKICPPPPGVIVYRLSDSFTYVNCSRHYDIIFDHV 655

Query: 675 KKHTRRGQLLHLRKKSDRPWNDPGEWEISPSIKKFFKLGKKNQNDIESQDEDVAIDNTRD 734
           K+ TRRGQL++LRKKSDRPWNDPGEW++  S+K  F+  +K+    E+++  V+  +T  
Sbjct: 656 KEETRRGQLVNLRKKSDRPWNDPGEWKMPTSLKTLFRFKRKSVT--ENEEPSVSNGSTNR 713

Query: 735 ---ERPLLKIICLDFSQVVQVDSTAIQSLVDLRKAVHKYADRQVEFHFTGIISSWVKRSL 791
              E+PLLK+ICLDFSQV QVDSTAIQSLVDLRKAV+KYADRQVEFHF GIIS W+KRSL
Sbjct: 714 GSYEKPLLKVICLDFSQVAQVDSTAIQSLVDLRKAVNKYADRQVEFHFAGIISPWIKRSL 773

Query: 792 LSMGFGTVNASYSDESIIAGHSSYHIAKTTKPLADDFTTDXXXXXX-XXXXXEIYAATGT 850
            S+ FGTVN  YSDES+IAGHSS H+ K +     D+T +             + AATGT
Sbjct: 774 SSVDFGTVNEEYSDESVIAGHSSVHVTKFSSDDDADYTDEESHISAPYSNYGTLCAATGT 833

Query: 851 NMPFFHLDIPDFSKWDL 867
           N+PFFH+DIPDFSKWD+
Sbjct: 834 NLPFFHIDIPDFSKWDI 850

>NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271
          Length = 923

 Score = 1144 bits (2959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 565/894 (63%), Positives = 678/894 (75%), Gaps = 43/894 (4%)

Query: 11  ADSAFKLDDLEAEYDLYKANEQLEDNEVTVNGSED--------DYGNKKGIDLV------ 56
            +S   LDDLE EYD YK +E   +++V  N + +        +   ++ +D+       
Sbjct: 36  GNSTQNLDDLELEYDQYKVSETNNNDDVINNNNNNNNNNNNIPELETQQNLDVQFSNTTN 95

Query: 57  -KETEVRYYGSPGPEAIGGNIPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVK 115
            KE + R   +  P  I    P ++E TVS+KDYY+  IRE +TL     Y  S+FPI +
Sbjct: 96  NKENQYRIVSTVNPVII----PNYDEKTVSIKDYYDHSIRENVTLVGVRDYFLSIFPITR 151

Query: 116 WFPHYNLTWGYADLVAGITVGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSK 175
           W PHYNLTW  +DL+AGITVGCVLVPQSMSYAQIA+LP QYGLYSSFIGAF YSLFATSK
Sbjct: 152 WLPHYNLTWFTSDLIAGITVGCVLVPQSMSYAQIATLPAQYGLYSSFIGAFCYSLFATSK 211

Query: 176 DVCIGPVAVMSLQTAKVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFL 235
           DVCIGPVAVMSL+TAKV+ +V AKYP+NDP +TAP++ATALSLLCGIV  GVG+LRLGFL
Sbjct: 212 DVCIGPVAVMSLETAKVVTKVLAKYPDNDPTITAPIVATALSLLCGIVTAGVGVLRLGFL 271

Query: 236 VELISLNAVAGFMTGSAFNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAV 295
           VELISLNAV GFMTGSA NILWGQVP LMGY+SKVNTR + YKV+I++LKHLPDTKLDAV
Sbjct: 272 VELISLNAVTGFMTGSALNILWGQVPGLMGYNSKVNTRTANYKVIIETLKHLPDTKLDAV 331

Query: 296 FGLVPLCLLYLWKWWCGTYGPKLADRQLAHSPKKQRI---LKRFYFYSNAMRNAVIIIVF 352
           FGL+PL LLYLWKWWC   GPKL D+    + K +R     K+FYFY+ A +NA+IIIVF
Sbjct: 332 FGLIPLFLLYLWKWWCDNMGPKLVDKWFPKN-KNERANFYFKKFYFYAQAAKNAIIIIVF 390

Query: 353 TAISWRITKNKDKEHRPIKVLGTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHI 412
           TAISW IT+ K K  RPI +LGTVP GL++VGV K+P+GLL+K+AP++PAS+IVLLLEHI
Sbjct: 391 TAISWSITRGKAKADRPISILGTVPKGLKEVGVMKLPDGLLSKLAPELPASVIVLLLEHI 450

Query: 413 AISKSFGRINDYKVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGV 472
           AI+KSFGRINDYKVVPDQELIAIG TNLIGTFFNAYPATGSFSRSALKAKC+VRTP SG+
Sbjct: 451 AIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCKVRTPLSGI 510

Query: 473 FTGCCVLVAIYCLTDAFFFIPSATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVT 532
           FTG CVL+A+YCLT AFF+IP ATLSAVII AVSDL+ASYK TWNFWKMNPLDC  F+VT
Sbjct: 511 FTGACVLLALYCLTGAFFYIPKATLSAVIIQAVSDLIASYKITWNFWKMNPLDCLCFLVT 570

Query: 533 VLITVFSSIENGIYFAMCWSCAMLLLKHAFPAGQFLGRVEVAEVINPTVVEDVEAISI-- 590
           V ITVFSSIENGIYFA+CWSCA+LLLK  FPAG+FLGR+EVAEVI+  V   +E+ +   
Sbjct: 571 VFITVFSSIENGIYFAVCWSCAILLLKVCFPAGKFLGRIEVAEVIDGYVDNSIESATTAE 630

Query: 591 ----------NDQIEGSVGKSKSLK--ADKGAISASS-----GSNYKFHSKWVAEQYAYN 633
                     N+     + K+ S+    D  A++ S+         ++++KWV   +AY 
Sbjct: 631 YSSASSPSSDNETDTKKIQKTSSISFGKDAKAVAVSTSPVDCNPKVRYYTKWVPFDHAYT 690

Query: 634 RELNPDVKILPPPPGVVVYRMSDSFTYINCSRHYDTIFDHIKKHTRRGQLLHLRKKSDRP 693
           RELNP V ILPPPPGV+VYR++DSFTYINCSRHYD IFD +K+ TRRGQLL  RKK+DRP
Sbjct: 691 RELNPSVNILPPPPGVIVYRLTDSFTYINCSRHYDVIFDEVKRQTRRGQLLRHRKKADRP 750

Query: 694 WNDPGEWEISPSIKKFFKLGKKNQNDIESQDEDVAIDNTRDERPLLKIICLDFSQVVQVD 753
           WNDPGEWE    +K  F   KKN  D ES  +     + RD RPLLKI+CLDFSQV Q+D
Sbjct: 751 WNDPGEWEAPQFLKNLFHRKKKNSTDEESAVDVSDNSSIRDNRPLLKIVCLDFSQVAQID 810

Query: 754 STAIQSLVDLRKAVHKYADRQVEFHFTGIISSWVKRSLLSMGFGTVNASYSDESIIAGHS 813
           ++AIQSLVDLRK++++YADRQVEFHF GI+S WVKR L++ GFGT+N  +SD SIIAGHS
Sbjct: 811 ASAIQSLVDLRKSINRYADRQVEFHFAGIVSPWVKRGLINRGFGTINDEFSDASIIAGHS 870

Query: 814 SYHIAKTTKPLADDFTTDXXXXXXXXXXXEIYAATGTNMPFFHLDIPDFSKWDL 867
           SYH+ +T  P +D                 ++AATGTN+PFFH+DIPDFSKWDL
Sbjct: 871 SYHLTRTL-PDSDFDLESNFRDTYSRSQYHVFAATGTNLPFFHIDIPDFSKWDL 923

>NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271
          Length = 905

 Score = 1142 bits (2954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 560/888 (63%), Positives = 678/888 (76%), Gaps = 47/888 (5%)

Query: 13  SAFKLDDLEAEYDLYKANE---------QLEDNEVTVNGSED-DYGNKKGIDLVKETEVR 62
           S+  L DLE EYD YKA+E          LE N + V  S   + G+KK  + +K  +++
Sbjct: 32  SSQNLADLELEYDQYKASETNNKSNHGPDLETNNLDVQFSNTYNTGDKK--NSIKNHQIQ 89

Query: 63  YYGSPGPEAIGGNIPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNL 122
                    I   IP FEE  +S KDYY   ++E  +L S   Y  S+FPI++W PHYNL
Sbjct: 90  INTFNADSVI---IPSFEEHAISFKDYYRHSLKENFSLKSVKEYALSIFPIIRWLPHYNL 146

Query: 123 TWGYADLVAGITVGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPV 182
            W  +DL+AGITVGCVLVPQSMSYAQIA+LPPQYGLYSSFIGAF YSLFATSKDVCIGPV
Sbjct: 147 AWFSSDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFTYSLFATSKDVCIGPV 206

Query: 183 AVMSLQTAKVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLN 242
           AVMSL+T KVI +V AKYPE DP +TAPVIAT L+ LCG++  G+G LRLGFLVELISLN
Sbjct: 207 AVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVITAGIGFLRLGFLVELISLN 266

Query: 243 AVAGFMTGSAFNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLC 302
           AV GFMTGSA NI+WGQ+PALMGY SKVNTR STYKV+I+SLKHLPDTKLDAVFGL+PL 
Sbjct: 267 AVTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPDTKLDAVFGLIPLF 326

Query: 303 LLYLWKWWCGTYGPKLADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKN 362
           +LYLWKWWCG  GP++AD+  A++ K    LK+FYFY+ A +NAVIIIVFTAI+W ITK 
Sbjct: 327 ILYLWKWWCGNMGPRMADKWFANNEKGNFYLKKFYFYAQAAKNAVIIIVFTAIAWSITKG 386

Query: 363 KDKEHRPIKVLGTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRIN 422
           K K+ RPI +LG+VP GL++VGV K+P+GL +K+AP++PAS+IVLLLEHIAI+KSFGRIN
Sbjct: 387 KTKDERPISILGSVPKGLKEVGVMKLPDGLASKIAPELPASVIVLLLEHIAIAKSFGRIN 446

Query: 423 DYKVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAI 482
           DYKVVPDQELIAIG TNLIGTFFNAYPATGSFSRSALKAKCEVRTP SG+FTG CVL+A+
Sbjct: 447 DYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCEVRTPLSGLFTGSCVLLAL 506

Query: 483 YCLTDAFFFIPSATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIE 542
           YCLT  F +IP ATLSAVIIHAVSDL+ASY TTWNFWKMNPLDC +FIVTV ITVFSSIE
Sbjct: 507 YCLTGVFLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNPLDCFSFIVTVFITVFSSIE 566

Query: 543 NGIYFAMCWSCAMLLLKHAFPAGQFLGRVEVAEVINPTVVEDVE-------------AIS 589
           NGIYFAMCWSCA+L+LK AFPAG+FLGRVE+AEV+N  V +  E             A +
Sbjct: 567 NGIYFAMCWSCAILVLKVAFPAGKFLGRVEIAEVVNGCVDDSFEVTDYSSNSNLSLSADT 626

Query: 590 INDQIEGSVGKSKSLKADKGAI-----SASSGSNYKFHSKWVAEQYAYNRELNPDVKILP 644
           IN   +  +     LK  K  +     S    S  ++++KW+   +AY +ELNP+V ILP
Sbjct: 627 INHNKKLKILHIPLLKTLKDQLFSDISSIQGKSKIRYYTKWLPFDHAYTKELNPNVIILP 686

Query: 645 PPPGVVVYRMSDSFTYINCSRHYDTIFDHIKKHTRRGQLLHLRKKSDRPWNDPGEWEISP 704
           PPPGV+VYR++DSFTY+NCS+HYD IF+ IKK T+RGQL+  RKKSDRPWNDPGEWE +P
Sbjct: 687 PPPGVIVYRLTDSFTYMNCSKHYDVIFEEIKKQTKRGQLIRHRKKSDRPWNDPGEWE-AP 745

Query: 705 SIKKF-----FKLGKKNQNDIESQDEDVAIDNTRDERPLLKIICLDFSQVVQVDSTAIQS 759
           +  K      F+  K N ++ E+   DV + + RD+RPLLK++CLDFSQV QVD+TA+QS
Sbjct: 746 NFSKLWKKLSFRRNKNNNDNEETHIPDVPV-SKRDDRPLLKVLCLDFSQVAQVDATALQS 804

Query: 760 LVDLRKAVHKYADRQVEFHFTGIISSWVKRSLLSMGFGTVNASYSDESIIAGHSSYHIAK 819
           LVDLRKA++KYADRQVEFHF GI+S W+K+ L+++GFGT+N  YSDESIIAGH+SYH+A+
Sbjct: 805 LVDLRKAINKYADRQVEFHFAGIVSPWIKKGLINIGFGTINEEYSDESIIAGHTSYHLAR 864

Query: 820 TTKPLADDFTTDXXXXXXXXXXXEIYAATGTNMPFFHLDIPDFSKWDL 867
                      D           ++Y ATGTN+PFFH+DIPDF +WD+
Sbjct: 865 IPG-------DDLELPTMRGGNYKVYTATGTNLPFFHIDIPDFYQWDV 905

>Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 1141 bits (2951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/890 (62%), Positives = 671/890 (75%), Gaps = 52/890 (5%)

Query: 12  DSAFKLDDLEAEYDLYKANEQ---LEDNEVTVN--GSEDDYGNKKGIDLVKETEVRYYGS 66
           DS   LDDLE EYD YK NE      DN++  N   + +   + KG   VK +++ Y+  
Sbjct: 22  DSVPNLDDLELEYDQYKNNENNGVFSDNDLESNSVANRNAVNDAKG---VKGSKIEYFDP 78

Query: 67  PGPEAIGGNIPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGY 126
                   ++  FEES VS+K+YYN  IR  LTL  AG Y+ S+FPI+ W PHYN  W  
Sbjct: 79  SDVSLYDNSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIINWLPHYNFNWFI 138

Query: 127 ADLVAGITVGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMS 186
           ADL+AGIT+GCVLVPQSMSYAQ+A+LP QYGLYSSFIGA+ YS FATSKDVCIGPVAVMS
Sbjct: 139 ADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGPVAVMS 198

Query: 187 LQTAKVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVAG 246
           LQTAKVIA+V AKYP+ D  +T PVIAT L+LLCGI++  VG LRLGFLVELISLNAVAG
Sbjct: 199 LQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAG 258

Query: 247 FMTGSAFNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYL 306
           FMTGSAFNILWGQVPALMGY+  VNTRA+TYKVVI++LKHLPDTKLDAVFGL+PL LLY+
Sbjct: 259 FMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYV 318

Query: 307 WKWWCGTYGPKLADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNKDKE 366
           WKWWCGTYGP+L DR  + + +  +I+K  YFY+ A RN +IIIVFT I W IT+ K   
Sbjct: 319 WKWWCGTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGIIIIVFTCIGWAITRGKSSS 378

Query: 367 HRPIKVLGTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRINDYKV 426
            RPI +LG+VPSGL++VGV  +P GL++K+ P +P+SIIVLLLEHIAISKSFGRINDYKV
Sbjct: 379 ERPISILGSVPSGLKEVGVFHVPSGLMSKLGPSLPSSIIVLLLEHIAISKSFGRINDYKV 438

Query: 427 VPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLT 486
           VPDQELIAIG +NL+GTFFNAYPATGSFSRSALKAKC VRTP SG+F+G CVL+A+YCLT
Sbjct: 439 VPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLT 498

Query: 487 DAFFFIPSATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIY 546
            AFF+IP ATLSAVIIHAVSDLLASY+TTWNFWKMNPLD   FIVTVLITVF+SIE+GIY
Sbjct: 499 GAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIY 558

Query: 547 FAMCWSCAMLLLKHAFPAGQFLGRVEVAEVINPTVVEDVEAISINDQIEGSVGKSKSLKA 606
           FAMCWSCAMLLLK AFPAG+FLGRVE+AEV +  V  D +A+S   +    +   +    
Sbjct: 559 FAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAVSYVSENNNRISTLEENGE 618

Query: 607 DKGAISASSGSN-------------------------YKFHSKWVAEQYAYNRELNPDVK 641
           D+  ISA   +N                          K+H+KW+   + Y RELNPDV 
Sbjct: 619 DEKEISAKYITNSSKKIETNVQTKGFASPSSSIGQPRIKYHTKWLPFDHKYTRELNPDVH 678

Query: 642 ILPPPPGVVVYRMSDSFTYINCSRHYDTIFDHIKKHTRRGQLLHLRKKSDRPWNDPGEWE 701
           ILPPP  V+VYR+S+S+TY+NCSRHY+ I D +K+ TRRGQ++  RKKSDRPWNDPG WE
Sbjct: 679 ILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQIIRHRKKSDRPWNDPGPWE 738

Query: 702 ISPSIKKFFKLGKKNQNDIE--SQDEDVAIDNTRDERPLLKIICLDFSQVVQVDSTAIQS 759
            +P+  K  K  KK ++D+E      + +ID  RDERPLLKI+CLDFSQV Q D+TA+QS
Sbjct: 739 -APAFLKNLKFWKKKESDLEFTQNAPNNSIDAERDERPLLKILCLDFSQVAQTDATALQS 797

Query: 760 LVDLRKAVHKYADRQVEFHFTGIISSWVKRSLLSMGFGTVNASYSDESIIAGHSSYHIAK 819
           LVDLRKA+++YADRQVEFHF GIIS WVKR L+S GFGT+N  YSDESI+AGH+SYH+A+
Sbjct: 798 LVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTINEEYSDESIVAGHTSYHVAR 857

Query: 820 T--TKPLADDFTTDXXXXXXXXXXXEIYAATGTNMPFFHLDIPDFSKWDL 867
               K   D ++              +Y A+GTN+PFFH+DIPDF+KWD+
Sbjct: 858 VPRNKENPDKYS--------------VYTASGTNLPFFHIDIPDFAKWDI 893

>Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 1140 bits (2949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/885 (63%), Positives = 678/885 (76%), Gaps = 52/885 (5%)

Query: 17  LDDLEAEYDLYKANEQ---LEDNEVTVN--GSEDDYGNKKGIDLVKETEVRYYGSPGPEA 71
           LDDLE EYD YK NE     +DN++  N     +  GN KG    K +++ Y+       
Sbjct: 27  LDDLELEYDQYKNNENNDAFKDNDLESNSVAKPNAVGNGKG---AKGSKIEYFNPSDVSL 83

Query: 72  IGGNIPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYADLVA 131
              ++  FEESTVS+K+YY+  IR  LTL  A  Y+ S+FPI+ W PHYN  W  ADL+A
Sbjct: 84  YDNSVSQFEESTVSLKEYYDHSIRSHLTLKGARDYLKSVFPIINWLPHYNFNWFTADLIA 143

Query: 132 GITVGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAK 191
           GIT+GCVLVPQSMSYAQ+A+LP QYGLYSSFIGA+ YS FATSKDVCIGPVAVMSLQTAK
Sbjct: 144 GITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAK 203

Query: 192 VIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVAGFMTGS 251
           VIA V+AKYP+ DP +T PVIAT L+LLCGI++  +G LRLGFLVELISLNAVAGFMTGS
Sbjct: 204 VIADVTAKYPDGDPAITGPVIATTLALLCGIISAAIGFLRLGFLVELISLNAVAGFMTGS 263

Query: 252 AFNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYLWKWWC 311
           AFNILWGQVPALMGY+S VNTRA+TYKVVI++LKHLPDTKLDAVFGL+PL LLY+WKWWC
Sbjct: 264 AFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWC 323

Query: 312 GTYGPKLADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNKDKEHRPIK 371
           GTYGP L DR  + +P+  +ILK  YFY+ A RN VII+VFT I W IT+ K K  RPI 
Sbjct: 324 GTYGPILNDRYNSKNPRLHKILKWTYFYAQASRNGVIIVVFTCIGWAITRGKSKSERPIS 383

Query: 372 VLGTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRINDYKVVPDQE 431
           +LG+VPSGL++VGV  +P GL++K+ P++PASIIVLLLEHIAISKSFGRINDYKVVPDQE
Sbjct: 384 ILGSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQE 443

Query: 432 LIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFFF 491
           LIAIG +NL+GTFFNAYPATGSFSRSALKAKC VRTP SG+F+G CVL+A+YCLT AFF+
Sbjct: 444 LIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFY 503

Query: 492 IPSATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIYFAMCW 551
           IP ATLSAVIIHAVSDLLASY+TTWNFWKMNPLD   FIVTVLITVF+SIE+GIYFAMCW
Sbjct: 504 IPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCW 563

Query: 552 SCAMLLLKHAFPAGQFLGRVEVAEVINPTVVEDVEAISI----NDQIEGS---------- 597
           SCAMLLLK AFPAG+FLGRVE+AEV +  +  + +A+S     N+ I  S          
Sbjct: 564 SCAMLLLKMAFPAGKFLGRVEIAEVTDAYIKANSDAVSYTSENNNGIRTSEEGDEYEKDS 623

Query: 598 -----VGKSKSLKADKGAISASSGSN------YKFHSKWVAEQYAYNRELNPDVKILPPP 646
                   SK ++ +    S  S S+       K+H+KWV   + Y RELNPD++ILPPP
Sbjct: 624 STKYITNSSKKIETNVQTKSFDSPSSLITQPRMKYHTKWVPFDHKYTRELNPDIQILPPP 683

Query: 647 PGVVVYRMSDSFTYINCSRHYDTIFDHIKKHTRRGQLLHLRKKSDRPWNDPGEWEISPSI 706
            GV+VYR+S+S+TY+NCSRHY+ I + +K+ TRRGQL+  RKKSDRPWNDPG WE +P+ 
Sbjct: 684 EGVLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQLIRHRKKSDRPWNDPGPWE-APAF 742

Query: 707 KKFFKLGKKNQNDIESQDE--DVAIDNTRDERPLLKIICLDFSQVVQVDSTAIQSLVDLR 764
            K  K  KK ++D E  +   D +I   RD+RPLLKI+CLDFSQV Q D+TA+QSLVDLR
Sbjct: 743 LKNLKFWKKRESDSEFLENAPDNSIGTERDDRPLLKILCLDFSQVAQTDATALQSLVDLR 802

Query: 765 KAVHKYADRQVEFHFTGIISSWVKRSLLSMGFGTVNASYSDESIIAGHSSYHIAKT--TK 822
           K +++YADRQVEFHF GIIS WVKR L+S GFGT+N  YSDESI+AGH+SYH+A+   +K
Sbjct: 803 KVINQYADRQVEFHFVGIISPWVKRGLVSRGFGTLNEEYSDESIVAGHTSYHVARVPQSK 862

Query: 823 PLADDFTTDXXXXXXXXXXXEIYAATGTNMPFFHLDIPDFSKWDL 867
             +D ++              +Y A+GTN+PFFH+DIPDF+KWD+
Sbjct: 863 ENSDKYS--------------VYTASGTNLPFFHIDIPDFAKWDI 893

>YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High
           affinity sulfate permease; sulfate uptake is mediated by
           specific sulfate transporters Sul1p and Sul2p, which
           control the concentration of endogenous activated
           sulfate intermediates
          Length = 893

 Score = 1139 bits (2945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/886 (63%), Positives = 676/886 (76%), Gaps = 54/886 (6%)

Query: 17  LDDLEAEYDLYKANEQ--------LEDNEVTVNGSEDDYGNKKGIDLVKETEVRYYGSPG 68
           LDDLE EYD YK NE         LE N V      +   + KG   VK +++ Y+    
Sbjct: 27  LDDLELEYDQYKNNENNDTFNDKDLESNSV---AKHNAVNSSKG---VKGSKIDYFNPSD 80

Query: 69  PEAIGGNIPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYAD 128
                 ++  FEE+TVS+K+YY+  IR  LT+  A SY+ S+FPI+ W PHYN +W  AD
Sbjct: 81  VSLYDNSVSQFEETTVSLKEYYDHSIRSHLTVKGACSYLKSVFPIINWLPHYNFSWFTAD 140

Query: 129 LVAGITVGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQ 188
           L+AGIT+GCVLVPQSMSYAQ+A+LP QYGLYSSFIGA+ YS FATSKDVCIGPVAVMSLQ
Sbjct: 141 LIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQ 200

Query: 189 TAKVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVAGFM 248
           TAKVIA V+AKYP+ D  +T PVIAT L+LLCGI++  VG LRLGFLVELISLNAVAGFM
Sbjct: 201 TAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFM 260

Query: 249 TGSAFNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYLWK 308
           TGSAFNILWGQVPALMGY+S VNTRA+TYKVVI++LKHLPDTKLDAVFGL+PL LLY+WK
Sbjct: 261 TGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWK 320

Query: 309 WWCGTYGPKLADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNKDKEHR 368
           WWCGTYGP+L DR  + +P+  +I+K  YFY+ A RN +IIIVFT I W IT+ K K  R
Sbjct: 321 WWCGTYGPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGIIIIVFTCIGWAITRGKSKSER 380

Query: 369 PIKVLGTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRINDYKVVP 428
           PI +LG+VPSGL++VGV  +P GL++K+ P++PASIIVLLLEHIAISKSFGRINDYKVVP
Sbjct: 381 PISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVP 440

Query: 429 DQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDA 488
           DQELIAIG +NL+GTFFNAYPATGSFSRSALKAKC VRTP SG+F+G CVL+A+YCLT A
Sbjct: 441 DQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGA 500

Query: 489 FFFIPSATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIYFA 548
           FF+IP ATLSAVIIHAVSDLLASY+TTWNFWKMNPLD   FIVTVLITVF+SIE+GIYFA
Sbjct: 501 FFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFA 560

Query: 549 MCWSCAMLLLKHAFPAGQFLGRVEVAEVINPTVVEDVEAISI---------------NDQ 593
           MCWSCAML+LK AFPAG+FLGRVEVAEV +  V  D + +S                 D 
Sbjct: 561 MCWSCAMLILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVVSYVSENNNGISTLEDGGEDD 620

Query: 594 IEGS----VGKSKSLKAD---KGAISASSG---SNYKFHSKWVAEQYAYNRELNPDVKIL 643
            E S       SK ++ +   KG  S SS       K+H+KW+   + Y RELNPDV+IL
Sbjct: 621 KESSTKYVTNSSKKIETNVQTKGFDSPSSSISQPRIKYHTKWIPFDHKYTRELNPDVQIL 680

Query: 644 PPPPGVVVYRMSDSFTYINCSRHYDTIFDHIKKHTRRGQLLHLRKKSDRPWNDPGEWEIS 703
           PPP GV+VYR+S+S+TY+NCSRHY+ I + +KK TRRGQL+  RKKSDRPWNDPG WE +
Sbjct: 681 PPPDGVLVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQLIRHRKKSDRPWNDPGPWE-A 739

Query: 704 PSIKKFFKLGKKNQNDIESQDE--DVAIDNTRDERPLLKIICLDFSQVVQVDSTAIQSLV 761
           P+  K  K  KK +ND ES +     ++D  RD+RPLLKI+CLDFSQV Q D+TA+QSLV
Sbjct: 740 PAFLKNLKFWKKRENDPESMENAPSTSVDVERDDRPLLKILCLDFSQVAQTDATALQSLV 799

Query: 762 DLRKAVHKYADRQVEFHFTGIISSWVKRSLLSMGFGTVNASYSDESIIAGHSSYHIAKTT 821
           DLRKA+++YADRQVEFHF GIIS WVKR L+S GFGT+N  YSDESI+AGH+SYH+A+  
Sbjct: 800 DLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEEYSDESIVAGHTSYHVARV- 858

Query: 822 KPLADDFTTDXXXXXXXXXXXEIYAATGTNMPFFHLDIPDFSKWDL 867
            P  ++                +Y A+GTN+PFFH+DIPDF+KWD+
Sbjct: 859 -PQGEE----------NPEKYSVYTASGTNLPFFHIDIPDFAKWDI 893

>Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 1129 bits (2919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/881 (63%), Positives = 673/881 (76%), Gaps = 44/881 (4%)

Query: 17  LDDLEAEYDLYKANEQ---LEDNEVTVNGSEDDYGNKKGIDLVKETEVRYYGSPGPEAIG 73
           LDDLE EYD YK NE      DN++  N S  ++        VK ++V Y+ +       
Sbjct: 27  LDDLELEYDQYKNNENNGAFNDNDLESN-SLTNHNTASEAKGVKGSKVEYFNTSDISLYD 85

Query: 74  GNIPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYADLVAGI 133
            ++  F+E TVS K+YY+  IR  LTL +AG+Y+ S+FPI+ W PHYN+ W  ADL+AGI
Sbjct: 86  NSVSQFDEPTVSFKEYYDHSIRSHLTLKAAGNYLKSVFPIIYWLPHYNVNWFIADLIAGI 145

Query: 134 TVGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVI 193
           T+GCVLVPQSMSYAQ+A+LP QYGLYSSFIGA+ YS FATSKDVCIGPVAVMSLQTAKVI
Sbjct: 146 TIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGPVAVMSLQTAKVI 205

Query: 194 AQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVAGFMTGSAF 253
           A V+A+YP+ D  +T P+IAT L+LLCGI++  VG LRLGFLVELISLNAVAGFMTGSAF
Sbjct: 206 ADVTARYPDGDTTITGPIIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAF 265

Query: 254 NILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYLWKWWCGT 313
           NILWGQVPALMGY+  VNTR +TYK+VIDSLKHLPDT LDA FGL+PL +LY WKWWCGT
Sbjct: 266 NILWGQVPALMGYNKLVNTRVATYKIVIDSLKHLPDTTLDAAFGLIPLFILYTWKWWCGT 325

Query: 314 YGPKLADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNKDKEHRPIKVL 373
           YGP+L DR  +  P+  +I+K   FY+ A RN +IIIVFT I+W IT+ K    RPI +L
Sbjct: 326 YGPRLNDRFNSKKPRLHKIVKWTCFYAQASRNGIIIIVFTCIAWAITRGKSSADRPISIL 385

Query: 374 GTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRINDYKVVPDQELI 433
           G+VPSGL++VGV  +P GL++K+ P++PASIIVLLLEHIAISKSFGR+NDYKVVPDQELI
Sbjct: 386 GSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRVNDYKVVPDQELI 445

Query: 434 AIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFFFIP 493
           AIG +NL+GTFFNAYPATGSFSRSALKAKC VRTP SG+F+G CVL+A+YCLT AFF+IP
Sbjct: 446 AIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIP 505

Query: 494 SATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIYFAMCWSC 553
            ATLSAVIIHAVSDLLASY+TTWNFWKMNPLD   FIVTVLITVFSSIENGIYFAMCWSC
Sbjct: 506 KATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFSSIENGIYFAMCWSC 565

Query: 554 AMLLLKHAFPAGQFLGRVEVAEVINPTVVEDVEAISI----NDQI----EGSVGKSK--- 602
           A+ +LK AFPAG+FLGRVE+AEV +  V  D +++S     N++I    E  VG+ +   
Sbjct: 566 AIFILKVAFPAGKFLGRVEIAEVTDAYVRADSDSVSFTSENNNRISTLEEDGVGEKEGPT 625

Query: 603 -----SLKADKGAI--------SASSGS-NYKFHSKWVAEQYAYNRELNPDVKILPPPPG 648
                S K  +  +        SAS G    K+H+KW+   + Y +ELNPDV ILPPP G
Sbjct: 626 NYIINSFKKLETKVQTKGFESPSASIGQPRIKYHTKWLPFDHKYTKELNPDVNILPPPEG 685

Query: 649 VVVYRMSDSFTYINCSRHYDTIFDHIKKHTRRGQLLHLRKKSDRPWNDPGEWEISPSIKK 708
           V+VYR+S+S+TYINCSRHY+ I D IKK TRRGQL+  RKKSDRPWNDPG WE  P+  K
Sbjct: 686 VLVYRLSESYTYINCSRHYNVITDEIKKVTRRGQLIRHRKKSDRPWNDPGPWE-PPTFFK 744

Query: 709 FFKLGKKNQNDIESQDEDV--AIDNTRDERPLLKIICLDFSQVVQVDSTAIQSLVDLRKA 766
             K  KK + DIES +  V    D  RD+RPLLKI+CLDFSQV Q D+TA+QSLVDLRKA
Sbjct: 745 NLKFWKKKETDIESSENAVNNPTDAVRDDRPLLKILCLDFSQVAQTDATALQSLVDLRKA 804

Query: 767 VHKYADRQVEFHFTGIISSWVKRSLLSMGFGTVNASYSDESIIAGHSSYHIAKTTKPLAD 826
           +++YADRQVEFHF GIIS WVKR L+S GFGT+N  YSDESI+AGH+SYH+A+  +   +
Sbjct: 805 INQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEEYSDESIVAGHTSYHVARVPQ---N 861

Query: 827 DFTTDXXXXXXXXXXXEIYAATGTNMPFFHLDIPDFSKWDL 867
           + T D            +Y A+GTN+PFFH+DIPDF+KWD+
Sbjct: 862 EETPD---------KYSVYTASGTNLPFFHIDIPDFAKWDI 893

>KNAG0G02070 Chr7 (469623..472322) [2700 bp, 899 aa] {ON} Anc_8.271
           YLR092W
          Length = 899

 Score = 1085 bits (2807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/882 (61%), Positives = 651/882 (73%), Gaps = 50/882 (5%)

Query: 17  LDDLEAEYDLYKANEQLEDNEVTVNGSEDDYGNKKGIDLVKETEVRYYGSPGP------- 69
           LD+LE EYD YKA+E      +  N ++ D      +  V+E  VR    P         
Sbjct: 37  LDNLELEYDQYKADELHPQRTILSNQADTDREKIANV-FVEEQSVRDSNIPSASIEELQY 95

Query: 70  ---EAIGGN-IPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWG 125
              E+ G   IP + E  V+  +++N  +R K TLN+A +Y+ S+FPI+ W PHYN+ W 
Sbjct: 96  FAHESDGAKVIPSYVEGNVTELEFFNHSLRSKFTLNAAKNYILSIFPIIHWLPHYNVYWF 155

Query: 126 YADLVAGITVGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVM 185
             DL+AGITVGCVLVPQSMSYAQIA+LPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVM
Sbjct: 156 IQDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVM 215

Query: 186 SLQTAKVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVA 245
           SL+TAK+IA+V  ++P NDP V  P+IAT  +LLCG +A GVG LRLGFLVELISLNAVA
Sbjct: 216 SLETAKIIARVMKRFP-NDPDVQGPIIATTTALLCGGIAAGVGFLRLGFLVELISLNAVA 274

Query: 246 GFMTGSAFNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLY 305
           GFMTGSA NI+ GQVPALMGY   VNTR +TYKV++++LKHLPDTKLDAVFGL+PL +LY
Sbjct: 275 GFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDTKLDAVFGLIPLFILY 334

Query: 306 LWKWWCGTYGPKLADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNKDK 365
            W+WWC  YGPKL DR      +   + K+FYFY+ A R+ +IIIVFTAISW IT++   
Sbjct: 335 FWRWWCNGYGPKLTDRYYPKGSRGNFLWKKFYFYAQASRSGIIIIVFTAISWSITRHVPS 394

Query: 366 EHRPIKVLGTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRINDYK 425
           + R I +LGTVP GL+DVG  K+P  L AK+AP++PA++IVLLLEHIAISKSFGRINDYK
Sbjct: 395 KERRISILGTVPKGLKDVGAIKVPPELPAKIAPELPAAVIVLLLEHIAISKSFGRINDYK 454

Query: 426 VVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCL 485
           VVPDQELIAIG TNLIGTFF+AYP TGSFSRSALKAKC V+TP SG+FTG CVL+A+YCL
Sbjct: 455 VVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPLSGLFTGSCVLLALYCL 514

Query: 486 TDAFFFIPSATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGI 545
           T AFF+IP ATLSAVIIH+VSDL+ASY TTWNF+KMNPLD   F+ T++ITVFSSIENGI
Sbjct: 515 TGAFFYIPKATLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCFLTTIIITVFSSIENGI 574

Query: 546 YFAMCWSCAMLLLKHAFPAGQFLGRVEVAEVINPTVVEDVEAISINDQIEGSVGKSKSLK 605
           YFA+CWSCA+LL K AFPAG+FLGRVE+AEV++  ++ D   +   D      G +K   
Sbjct: 575 YFAICWSCALLLFKVAFPAGKFLGRVEIAEVVDGEIINDNSVVMTTDDCVSEFGGNKEFS 634

Query: 606 ADK---------------GAISASSGSN-YKFHSKWVAEQYAYNRELNPDVKILPPPPGV 649
            DK                A S+S   N  K+++KWV   +AY RELNPDV I PPPPGV
Sbjct: 635 KDKLNGKSDFIVKDKLDSTASSSSIAENKLKYYTKWVPFDHAYTRELNPDVTIQPPPPGV 694

Query: 650 VVYRMSDSFTYINCSRHYDTIFDHIKKHTRRGQLLHLRKKSDRPWNDPGEW---EISPSI 706
           +VYRMSDS+TYIN S HYD I D IK+ TRRGQLL  RKKSDRPWNDPGEW   +   ++
Sbjct: 695 IVYRMSDSYTYINASNHYDIIIDEIKRVTRRGQLLQHRKKSDRPWNDPGEWKPPKFLSNV 754

Query: 707 KKFFKLGKKNQN-DIESQDEDVAIDNTRDERPLLKIICLDFSQVVQVDSTAIQSLVDLRK 765
             + K  KKNQ  D+ES +  +     RDERP+LK++CLDFSQV QVDST++QSLVDLRK
Sbjct: 755 LHWRKNKKKNQTADVESLETGIV----RDERPVLKVLCLDFSQVAQVDSTSLQSLVDLRK 810

Query: 766 AVHKYADRQVEFHFTGIISSWVKRSLLSMGFGTVNASYSDESIIAGHSSYHIAKTTKPLA 825
           AV+ YADRQVEFHF GIIS W+KR L+ +GFGTVN  +SDESIIAGHSSYH+ K T  + 
Sbjct: 811 AVNAYADRQVEFHFAGIISPWIKRGLVKIGFGTVNEEFSDESIIAGHSSYHLVKNT--IG 868

Query: 826 DDFTTDXXXXXXXXXXXEIYAATGTNMPFFHLDIPDFSKWDL 867
           D                ++  ATGTN+PFFH+DIPDF KWD+
Sbjct: 869 D-----------IENGYQVKTATGTNLPFFHIDIPDFKKWDI 899

>SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 862

 Score = 1075 bits (2781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/860 (62%), Positives = 665/860 (77%), Gaps = 31/860 (3%)

Query: 16  KLDDLEAEYDLYKANEQ--LEDNEVTVNGSEDDYGNK-KGIDLVKETEVRYYGSPGPEAI 72
            LDDLEAEYD YK  EQ   E ++V        + N  KG+    +T V  YG+    + 
Sbjct: 26  NLDDLEAEYDNYKNAEQNPREKSDVVETLPPTTHQNDAKGLKNDGQTTVELYGT---TSS 82

Query: 73  GGNIPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYADLVAG 132
           GG IPG+ E TV+ KDYY+Q +   ++ +S   Y+ SLFP+++W PHYN  W Y D+VAG
Sbjct: 83  GGVIPGYHEDTVNFKDYYDQSLSSNISFSSFREYLISLFPVIRWIPHYNFAWMYGDVVAG 142

Query: 133 ITVGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKV 192
           +TVGCVLVPQSMSYAQIASLP QYGLYSSFIGAFIYS FATSKDVCIGPVAVMSL+TAKV
Sbjct: 143 VTVGCVLVPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLETAKV 202

Query: 193 IAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVAGFMTGSA 252
           IA+V+   P+ D  +T P+IATALSLLCG + +G+G+LRLGFLVELISLNAVAGFMTGSA
Sbjct: 203 IARVTEHLPD-DTEITGPIIATALSLLCGAITLGIGVLRLGFLVELISLNAVAGFMTGSA 261

Query: 253 FNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYLWKWWCG 312
           F+I+ GQ+PALMGY+ KVNTR +TYKVVI++LKHLPDTKLDAVFGL+PL +LYLWK+ C 
Sbjct: 262 FSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGLIPLLILYLWKYGCN 321

Query: 313 TYGPKLADRQL-AHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNKDKEHRPIK 371
           T GP   DR++  HSP+  +  K F+FY+ A+RNA +I++FT I+W IT++K K   PI 
Sbjct: 322 TIGPNWVDRRMNPHSPRA-KFWKSFFFYAQALRNAFVIVLFTLIAWGITRHKKKH--PIS 378

Query: 372 VLGTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRINDYKVVPDQE 431
           +L TVPSGL++VGV K P+ L   +AP++PA+ I+LLLEHIAI+K+FGRINDYKVVPDQE
Sbjct: 379 LLNTVPSGLKNVGVMKFPDHLATNLAPELPAAAIILLLEHIAIAKAFGRINDYKVVPDQE 438

Query: 432 LIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFFF 491
           LIAIG TNL+GTFFNAYPATGSFSRSALKAKC VRTP SGVFTG CVL+A+YCLT+AF++
Sbjct: 439 LIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVLLALYCLTEAFYY 498

Query: 492 IPSATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIYFAMCW 551
           IP ATLSAVIIHAVSDL+ASY+TTWNFWKMNPLDC  F+VTV IT+FSSIENGIYFA+CW
Sbjct: 499 IPKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITIFSSIENGIYFAICW 558

Query: 552 SCAMLLLKHAFPAGQFLGRVEVAEVINPTVVEDVEAI----SINDQIEGSVGKSKSLKAD 607
           SCA+LL K AFP+G+FLGRVEV+EVINPTV ED+  +    S N  +  S      L AD
Sbjct: 559 SCAILLFKIAFPSGKFLGRVEVSEVINPTVREDLGVVEDFDSENINVASSTKPKLGLSAD 618

Query: 608 KGAISASSGSNYKFHSKWVAEQYAYNRELNPDVKILPPPPGVVVYRMSDSFTYINCSRHY 667
             +IS +  S  +FH+KW+  +  Y RE N  + + PPPPGV+VYR S+S+TYINCSR Y
Sbjct: 619 NSSIS-TGPSRVRFHTKWIPLENNYGREYNSGIVVQPPPPGVIVYRPSESWTYINCSRQY 677

Query: 668 DTIFDHIKKHTRRGQLLHLRKKSDRPWNDPGEWEISPSIKKFFKLGKKNQNDIESQDEDV 727
           D IFD +K+ TRRG +L   KKSDRPWNDPG+WE    +KK FK GK+        ++++
Sbjct: 678 DIIFDEVKRLTRRGIVLAHTKKSDRPWNDPGQWEPPLFLKKLFKRGKR-------LEQEL 730

Query: 728 AIDNTRDERPLLKIICLDFSQVVQVDSTAIQSLVDLRKAVHKYADRQVEFHFTGIISSWV 787
           + +  RDERP+LKI+ +D+SQV Q+D+T +Q+LVDLRKA++KYADRQVEFHF+GIIS W+
Sbjct: 731 SPELGRDERPVLKILAMDWSQVTQIDATGVQNLVDLRKAINKYADRQVEFHFSGIISPWI 790

Query: 788 KRSLLSMGFGTVNASYSDESIIAGHSSYHIAKTTKPLADDFTTDXXXXXXXXXXXEIYAA 847
           KR+L+++GFGTVN  ++DES+I GHSSYHI K T+P  ++                I AA
Sbjct: 791 KRALVAVGFGTVNDEFADESLILGHSSYHIVK-TRPQDEE-------NHIGQGRYNISAA 842

Query: 848 TGTNMPFFHLDIPDFSKWDL 867
           +GTNMPFFH+++PDFSKW L
Sbjct: 843 SGTNMPFFHVEMPDFSKWSL 862

>CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON}
           similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092w SEL2 sulfate transporter or uniprot|P38359
           Saccharomyces cerevisiae YBR294w SUL1
          Length = 891

 Score = 1070 bits (2766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/897 (59%), Positives = 651/897 (72%), Gaps = 53/897 (5%)

Query: 16  KLDDLEAEYDLYKANEQLEDNEVTVNGSEDDYGNKKGIDLVKETEVRYYGSPGPEAIGGN 75
           +LD+LE EY+ +K NE+  +     N   D    +KG+D  K  E     +        +
Sbjct: 3   ELDNLELEYNQFKNNERPSN----TNAGADI---EKGLDTKKYFERSITDNSTYGKKSYS 55

Query: 76  IPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYADLVAGITV 135
           IP +EE T+++KDYY+  +R+  T  S   Y+ SLFP+V W P YN  W  +DL+AGITV
Sbjct: 56  IPSYEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSDLIAGITV 115

Query: 136 GCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAQ 195
           G VLVPQSMSYAQIA+LPP+YGLYSSFIGA +YS FATSKDVCIGPVAVMSLQTAKVIA+
Sbjct: 116 GTVLVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQTAKVIAR 175

Query: 196 VSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVAGFMTGSAFNI 255
           V  K+P+ DP +T P+IAT L+ +CGI+A GVGLLRLGFLVELISLNAVAGFMTGSAFNI
Sbjct: 176 VKEKHPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFMTGSAFNI 235

Query: 256 LWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYLWKWWCGTYG 315
           +WGQ+P LMGYS KVNTR STY VVIDSLKHLPDTKLDA FGL+PL  L+ WKWWC + G
Sbjct: 236 IWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWKWWCNSMG 295

Query: 316 PKLADRQLAHS--PKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNKDKEHRPIKVL 373
           PKL DR    +  P+  +  K FYFY  A RN +III+FTA+S+ ITK   K+ R I VL
Sbjct: 296 PKLTDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAKDKRRISVL 355

Query: 374 GTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRINDYKVVPDQELI 433
           GTVP GL   GV K+P G+L  +A +IP+SIIVLLLEHIAISKSFGR+NDYK+ P+QE+I
Sbjct: 356 GTVPKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKINPNQEII 415

Query: 434 AIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFFFIP 493
           AIG +NL+GTFFNAYPATGSFSRSALKAKC V TP SG+F+  CVL+AIYCLT AFF+IP
Sbjct: 416 AIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGAFFYIP 475

Query: 494 SATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIYFAMCWSC 553
            ATLSAVIIHAV DL+ASY TTW+ WKMN  D   FI TV ITVFSSIENGIYFA+CWSC
Sbjct: 476 KATLSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGIYFAVCWSC 535

Query: 554 AMLLLKHAFPAGQFLGRVEVAEVINPTVVE-------------DVEAISINDQI-EGSVG 599
           A+LL  +AFPAG+FLGR+E+AEV+NP +V+             D E I  ++ + E  +G
Sbjct: 536 AILLYNNAFPAGKFLGRIEIAEVVNPKIVDDDDFSFENSNESFDDEGIYFDNSVAEDKLG 595

Query: 600 KS-----------KSLKADKGAISASSGSNYKFHSKWVAEQYAYNRELNPDVKILPPPPG 648
            S           K+   +   ++  + S+ ++++KWV   +AY++ELNP V+I PPPPG
Sbjct: 596 TSSNDLKKFNAGVKTRSINGELVNGQTSSDIRYYTKWVPFDHAYSKELNPSVRITPPPPG 655

Query: 649 VVVYRMSDSFTYINCSRHYDTIFDHIKKHTRRGQLLHLRKKSDRPWNDPGEWEISPSIKK 708
           V+VYR+SDS+TYINCSRHYD IFD IK+ TRRGQL+  R K DRPWNDPGEWE +P +KK
Sbjct: 656 VIVYRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWNDPGEWE-APDLKK 714

Query: 709 FFKLGK---------------KNQNDIES-QDEDVAIDNTRDERPLLKIICLDFSQVVQV 752
           FF + K               +N+N+IE   D +    N +DERPLL+++CLDFSQV   
Sbjct: 715 FFNVKKFVSVFKRKVTDVDTFENENEIEHIHDGEHYKKNDKDERPLLRVVCLDFSQVANT 774

Query: 753 DSTAIQSLVDLRKAVHKYADRQVEFHFTGIISSWVKRSLLSMGFGTVNASYSDESIIAGH 812
           D+TA+QSL DLRKAV+KYADRQVEFHF GI S W+KR L ++GFGT N  YSDESIIAGH
Sbjct: 775 DATALQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTTNEEYSDESIIAGH 834

Query: 813 SSYHIAKTTKPLADDFTT--DXXXXXXXXXXXEIYAATGTNMPFFHLDIPDFSKWDL 867
           SSYH+++  +   D F                ++ AA+GTN+PFFH+DIPDFSKWD+
Sbjct: 835 SSYHLSRFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFFHVDIPDFSKWDI 891

>TPHA0J00800 Chr10 (186144..188897) [2754 bp, 917 aa] {ON} Anc_8.271
           YLR092W
          Length = 917

 Score = 1062 bits (2746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/910 (58%), Positives = 659/910 (72%), Gaps = 59/910 (6%)

Query: 5   EAESVPADSAFKLDDLEAEYDLYKANEQLE-------------DNEVTVNGSEDDYGNKK 51
           E  S    +   L+ LE EYD YK  E++E             +  VT N   ++Y   K
Sbjct: 20  ELSSYSNSNTVDLEALEEEYDQYKKEEEIEYISGNYLNSSPTQNINVTSNPKYEEYKKLK 79

Query: 52  GIDLVKETEVRYYGSPGPEAIGGN--IPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYS 109
            +D       + Y     E +  +  IP   E+ ++ K+YYN  ++E  T N+A +Y  S
Sbjct: 80  HLD-------QSYNYVSTEYLDTDYLIPAHNENIITFKEYYNHSLKEYFTFNAAKNYALS 132

Query: 110 LFPIVKWFPHYNLTWGYADLVAGITVGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYS 169
           +FPI+ W P YN  W  +DL+AGIT+GCVLVPQSMSYAQIA+L PQYGLYSSFIGAF+Y+
Sbjct: 133 IFPIIHWLPFYNFNWFISDLIAGITIGCVLVPQSMSYAQIATLDPQYGLYSSFIGAFVYA 192

Query: 170 LFATSKDVCIGPVAVMSLQTAKVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGL 229
           LFATSKDVCIGPVAVMSL+TAKVIA VS+ + +NDP VT P+IAT L+LLCG +A  VG 
Sbjct: 193 LFATSKDVCIGPVAVMSLETAKVIADVSSHF-QNDPDVTGPIIATTLALLCGGIAAAVGF 251

Query: 230 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPD 289
           LRLGFLVELISLNAV GFMTGSAFNILWGQVP LMGYS  VNTR +TYKVVID+LKHLPD
Sbjct: 252 LRLGFLVELISLNAVTGFMTGSAFNILWGQVPGLMGYSKLVNTRQATYKVVIDTLKHLPD 311

Query: 290 TKLDAVFGLVPLCLLYLWKWWCGTYGPKLADRQLAHSPKKQRILKRFYFYSNAMRNAVII 349
           TKLDAVFGL+PL +LY+ KWWC  YG +LA++Q + + + +  LK+FYFY+NAMRNAV+I
Sbjct: 312 TKLDAVFGLIPLFILYVVKWWCTNYGLQLAEKQFSSNERYRFYLKKFYFYTNAMRNAVVI 371

Query: 350 IVFTAISWRITKNKDKEHRPIKVLGTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLL 409
           I+FTAISW IT+NK    RPI VLGTVPSGL+D+GV K    ++ K+ P +PASIIVLLL
Sbjct: 372 IIFTAISWSITRNKSSSERPITVLGTVPSGLKDIGVFKPQTKIVQKIGPQLPASIIVLLL 431

Query: 410 EHIAISKSFGRINDYKVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPF 469
           EHIAI+KSFGRINDYK+VPDQELIAIG +NL+GTFF+AYPATGSFSRSAL AKC V+TP 
Sbjct: 432 EHIAIAKSFGRINDYKIVPDQELIAIGISNLVGTFFSAYPATGSFSRSALNAKCNVKTPL 491

Query: 470 SGVFTGCCVLVAIYCLTDAFFFIPSATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAF 529
           SG+FTG CVL+A+YCLT AFF+IP ATLSAVIIHAVSDL+ASY+TT +FW MNPLD   F
Sbjct: 492 SGIFTGGCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLIASYQTTLSFWNMNPLDTLCF 551

Query: 530 IVTVLITVFSSIENGIYFAMCWSCAMLLLKHAFPAGQFLGRVEVAEVINPTVVEDVEAIS 589
           +VTVLITVFSSIENGIYFAMC+SCA+ + + AFPAG+FLGR+E+AEVIN T  +D +   
Sbjct: 552 LVTVLITVFSSIENGIYFAMCYSCALFIFRSAFPAGKFLGRIEIAEVINATPKDDFQM-- 609

Query: 590 INDQIEG-SVGKSKSLKADK--GAISASSGSNYK---------FHSKWVAEQYAYNRELN 637
             D   G    +  +  AD+  G    ++ + +K         F++KWV   + Y +ELN
Sbjct: 610 --DNFNGFETSEYNNFPADQSYGKFDIANKNTHKYNSPHCSKNFYTKWVPFDHTYTKELN 667

Query: 638 PDVKILPPPPGVVVYRMSDSFTYINCSRHYDTIFDHIKKHTRRGQLLHLRKKSDRPWNDP 697
            DV+IL PPPGV+VYR+SDSF Y+NCSRH+DTIFD +K+ T+RG+ +   KKS RPWNDP
Sbjct: 668 KDVEILEPPPGVIVYRLSDSFIYLNCSRHFDTIFDEVKRKTKRGKFIGNIKKSQRPWNDP 727

Query: 698 GEWEISP------SIKKFFKLGKKNQNDIESQD--EDVAIDNTR----DERPLLKIICLD 745
           GEWE         SI+  FK  ++ ++++ ++D   D+ I N +    D RP+L++ICLD
Sbjct: 728 GEWEAPTWMTKKFSIRNLFKRKQEAESNVPNEDASTDLDISNNKDIDMDHRPVLQVICLD 787

Query: 746 FSQVVQVDSTAIQSLVDLRKAVHKYADRQVEFHFTGIISSWVKRSLLSMGFGTVNASYSD 805
           FSQV Q D+TA+QSL DLRK+V+ YADRQVEFHF GIIS WVKR L+ +GFGTVN +YSD
Sbjct: 788 FSQVSQTDNTALQSLFDLRKSVNSYADRQVEFHFCGIISPWVKRGLIKLGFGTVNEAYSD 847

Query: 806 ESIIAGHSSYHIAKT--------TKPLADDFTTDXXXXXXXXXXXEIYAATGTNMPFFHL 857
            S I GH SYHI K         +   ++D  +D            I AA+GTN PFFH+
Sbjct: 848 ASTIVGHVSYHIVKNPTFRNKSFSSHTSEDTISDMNIEAKDYNNYSIEAASGTNYPFFHI 907

Query: 858 DIPDFSKWDL 867
           DIP+FSKWD+
Sbjct: 908 DIPNFSKWDV 917

>KAFR0B02750 Chr2 (562981..565485) [2505 bp, 834 aa] {ON} Anc_8.271
           YLR092W
          Length = 834

 Score = 1054 bits (2726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/858 (60%), Positives = 639/858 (74%), Gaps = 43/858 (5%)

Query: 16  KLDDLEAEYDLYKANEQLEDNEVTVNGSEDDYGNKKGIDLVKETEVRYYGSPGPEAIGGN 75
            LDDLE E++ YK  E L  +    N   D     K    VK +      S   +     
Sbjct: 14  NLDDLEQEFNQYKKIE-LTISSTRQNEEVDSKRQGKSDKNVKSSSFDSIFSLTQQQ---Q 69

Query: 76  IPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYADLVAGITV 135
           +P +EE+++++ DYY   +R   T  +   Y+ SLFPI  W PHYNLTW  +DL+AGITV
Sbjct: 70  VPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLPHYNLTWFISDLIAGITV 129

Query: 136 GCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAQ 195
           GCVLVPQSMSYAQIA+L PQ+GLYSSFIGAF YSLFATSKDVCIGPVAVMSLQTAKVIA+
Sbjct: 130 GCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCIGPVAVMSLQTAKVIAR 189

Query: 196 VSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVAGFMTGSAFNI 255
           V  K P +D  +TA  IAT L+LLCGI+A GVGLLRLGFLVELISLNAVAGFMTGSA NI
Sbjct: 190 VQDKLP-SDTDITASEIATTLALLCGIIATGVGLLRLGFLVELISLNAVAGFMTGSALNI 248

Query: 256 LWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYLWKWWCGTYG 315
           + GQVP LMGY+S+VNTR STYKV+ID+LKHLPDTKLDAVFGL+PL LL+ WKW C   G
Sbjct: 249 ISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLIPLFLLFAWKWVCDVLG 308

Query: 316 PKLADRQLAH--SPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNKDKEHRPIKVL 373
           P+L +R   +  +P+  RI+K FYFY+   +NA+IIIVFT ISW IT+ K  E RPI VL
Sbjct: 309 PRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISWAITRGKTSETRPISVL 368

Query: 374 GTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRINDYKVVPDQELI 433
           G+VP GL+DV    +P GL+AK+AP++PASIIVLLLEHIAI+KSFGRINDYK+VPDQE++
Sbjct: 369 GSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKSFGRINDYKIVPDQEIV 428

Query: 434 AIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFFFIP 493
           AIG TNL+GTFF+AYPATGSFSRSALKAKC VRTP SG+F+G CVL+A+YCLT AFF+IP
Sbjct: 429 AIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVLLALYCLTGAFFYIP 488

Query: 494 SATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIYFAMCWSC 553
            ATL AVIIHAVS+L+ASYK T NFWKMNPLDC  F+VTV+ITVF+SIE+GIYFAMCWS 
Sbjct: 489 KATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITVFASIEDGIYFAMCWSV 548

Query: 554 AMLLLKHAFPAGQFLGRVEVAEVINPTVVEDVEAISINDQIEGSVGKSKSLKADKGAISA 613
           A+LL K AFP G+FLG++E+ EV++  +V D   ++ +D+       S+ L   K   S 
Sbjct: 549 AVLLFKVAFPPGKFLGQIEITEVLDGKLVGDSSVLTSSDE------NSEILPTTKAGYSV 602

Query: 614 SSGSNY----KFHSKWVAEQYAYNRELNPDVKILPPPPGVVVYRMSDSFTYINCSRHYDT 669
              SN+     +++KWV   ++Y +ELNPD  I PPPPGV+VYRM+DSFTY+NCSRH+D 
Sbjct: 603 EVVSNHNENTNYYTKWVPFDFSYTKELNPDAHIKPPPPGVIVYRMADSFTYMNCSRHFDI 662

Query: 670 IFDHIKKHTRRGQLLHLRKKSDRPWNDPGEWEISPSIKKFFKLGKKNQNDIESQDEDVAI 729
           +FD IK+ T+RG+L  + +KSDRPWNDPG+WE    IKK+ +    ++++++ +D  +  
Sbjct: 663 LFDEIKRSTKRGKLTQIMRKSDRPWNDPGKWEPRVFIKKYLRRENYDEDNVDIEDRVI-- 720

Query: 730 DNTRDERPLLKIICLDFSQVVQVDSTAIQSLVDLRKAVHKYADRQVEFHFTGIISSWVKR 789
               D+RP LKIICLDFSQV Q+D+TAIQ L DLRK+V+KYADRQVEFHF GIIS W+K+
Sbjct: 721 ----DDRPFLKIICLDFSQVSQIDATAIQCLYDLRKSVNKYADRQVEFHFVGIISPWIKK 776

Query: 790 SLLSMGFGTVNASYSDESIIAGHSSYHIAKTTKPLADDFTTDXXXXXXXXXXXEIYAATG 849
           SL + GFGT+N  YSDESII GHSSYH+ K                        I AATG
Sbjct: 777 SLRNFGFGTINNEYSDESIIMGHSSYHLTKDVD--------------------GIKAATG 816

Query: 850 TNMPFFHLDIPDFSKWDL 867
           TN+PFFH+DIP+F+KWD+
Sbjct: 817 TNLPFFHIDIPNFNKWDI 834

>Kpol_543.43 s543 (93697..96297) [2601 bp, 866 aa] {ON}
           (93697..96297) [2601 nt, 867 aa]
          Length = 866

 Score = 1053 bits (2723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/863 (60%), Positives = 654/863 (75%), Gaps = 30/863 (3%)

Query: 24  YDLYKANEQLEDNEVTVNGSEDDYGNKKGIDLVKETEVRY-----YGSPGPEAI------ 72
           Y+ YK  E+  +++V  +   DD GN  G  L K+++  +     Y     E        
Sbjct: 15  YNQYKTVEEQGNSDVGDSSGNDDLGNA-GDGLTKDSKFVFEKDLGYTDDSNELTRESFLN 73

Query: 73  -GGNIPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYADLVA 131
              N+P + E TV++K+YYN  IR  LT  S G+Y+ S+FPI+KW P YN  W  +DL+A
Sbjct: 74  SSENVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDLIA 133

Query: 132 GITVGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAK 191
           GIT+GCVLVPQSMSYAQIA+LPPQYGLYSSF+GA+ YSLFATSKDVCIGPVAVMSLQTAK
Sbjct: 134 GITIGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQTAK 193

Query: 192 VIAQVSAKYPENDPI-VTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVAGFMTG 250
           VI  V++   E     +TAP+IAT L+LLCGI++ GVGLLRLGFLVELISLNAV GFMTG
Sbjct: 194 VIQHVNSSLTEEQKTYITAPLIATTLALLCGIISAGVGLLRLGFLVELISLNAVTGFMTG 253

Query: 251 SAFNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYLWKWW 310
           SA NI+ GQVPALMGY+S+VNTR +TYKV+I++LKHLPDTK+DA+FGL+PL +LY WKWW
Sbjct: 254 SALNIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLVILYFWKWW 313

Query: 311 CGTYGPKLADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNKDKEHRPI 370
             + GPKL DR   +S K ++ +K FYFY NAMR+ +IIIV T+ISW +T+ K K  RPI
Sbjct: 314 FSSMGPKLVDRYYPNS-KYKKYIKAFYFYGNAMRSGIIIIVMTSISWSVTRGKSKSERPI 372

Query: 371 KVLGTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRINDYKVVPDQ 430
            +LGTVPSGL++VGV   P GLLAK+AP++P+SIIVLLLEHIAI+KSFGR+NDYKVVPDQ
Sbjct: 373 SILGTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGRVNDYKVVPDQ 432

Query: 431 ELIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFF 490
           ELIAIG +NLIGTFFN+YP TGSFSRSALKAKC V+TP SG+FTG CVL+A+YCLT AFF
Sbjct: 433 ELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAFF 492

Query: 491 FIPSATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIYFAMC 550
           +IP ATLSAVIIHAVSDL+ASYKTTW+FWKMNPLD   FI TV ITVF+SIE+GIYF MC
Sbjct: 493 YIPKATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIYFTMC 552

Query: 551 WSCAMLLLKHAFPAGQFLGRVEVAEVINPTVVEDVEAISINDQIEGSVGKSKSL-KADKG 609
           WS A+LL K AFPAG+FLG V++AE++NP +V+    +   ++ E SV  S  L   +KG
Sbjct: 553 WSAAILLFKVAFPAGKFLGYVKIAEIVNPEIVDSDYLV---EKAETSVQYSTVLMNPEKG 609

Query: 610 ----AISASSGSNYKFHSKWVAEQYAYNRELNPDVKILPPPPGVVVYRMSDSFTYINCSR 665
                 S SS S  K+H KW+   +AY +E+NP+V++ PPP GV+VYR+++SFTYINCSR
Sbjct: 610 ELSYLSSKSSESQLKYHIKWIPYDHAYTKEMNPNVEVTPPPDGVIVYRLTESFTYINCSR 669

Query: 666 HYDTIFDHIKKHTRRGQLLHLRKKSDRPWNDPGEWEISPSIKKFFKLGKKNQNDIESQDE 725
           +Y+T++D +K+ TR GQL+   KKSDRPWNDPG+W+  P   K     +KN+N     DE
Sbjct: 670 NYETLYDKVKELTRPGQLMTHIKKSDRPWNDPGDWK-PPKFLKNIINWRKNKN---KDDE 725

Query: 726 DVAIDN-TRDERPLLKIICLDFSQVVQVDSTAIQSLVDLRKAVHKYADRQVEFHFTGIIS 784
               DN   D RP+LKIICLDFSQV Q DSTA+QSL+DLR+A++KYADRQVEFHF+GI+S
Sbjct: 726 PTTFDNKVVDTRPILKIICLDFSQVAQTDSTALQSLLDLRRAINKYADRQVEFHFSGILS 785

Query: 785 SWVKRSLLSMGFGTVNASYSDESIIAGHSSYHIAKTTKPLADDFTTDXXXXXXXXXXXEI 844
            WVK+ L+++GFGTVN  YSDESII GH+SYH+ KT     +  TT             I
Sbjct: 786 PWVKKGLVNLGFGTVNKEYSDESIIIGHTSYHVVKTEDLENNPMTT--VEEPNQNSSYYI 843

Query: 845 YAATGTNMPFFHLDIPDFSKWDL 867
           +A TGTN PFFH++IPDFSKW++
Sbjct: 844 HAGTGTNFPFFHIEIPDFSKWNI 866

>ZYRO0C01452g Chr3 complement(103175..105895) [2721 bp, 906 aa] {ON}
           similar to uniprot|P38359 Saccharomyces cerevisiae
           YBR294W SUL1 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|Q12325 Saccharomyces cerevisiae YLR092W SUL2
          Length = 906

 Score = 1051 bits (2719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/884 (60%), Positives = 649/884 (73%), Gaps = 46/884 (5%)

Query: 17  LDDLEAEYDLYKANEQLEDNEVTVNGSEDDYGN--KKGIDLVKETEVRYY----GSPGPE 70
           LDDLE EYD YKA    ED E  V   +D+Y +  +KG    KETE+ Y+    G+    
Sbjct: 36  LDDLEQEYDQYKA---AEDRERVVGRGDDEYDDDLRKGKVDYKETELEYWNSTNGTTNLL 92

Query: 71  AIGGNIPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYADLV 130
           A    +P +EE  V   D +   +++++TL +   Y  S FPI+KW P YN  WGYADLV
Sbjct: 93  APKATVPSYEEGQVGPFDIFYHDLKDRMTLGAVKHYFESAFPIIKWLPFYNWKWGYADLV 152

Query: 131 AGITVGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTA 190
           AGITVGCVLVPQSMSYAQIA+LPPQYGLYSSF+GAFIYS FATSKDVCIGPVAVMSL+TA
Sbjct: 153 AGITVGCVLVPQSMSYAQIATLPPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETA 212

Query: 191 KVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVAGFMTG 250
           KVI +   K+P+ D  VT P+IATAL+LLCGIVA+G G+LRLGFLVELISLNAVAGFMTG
Sbjct: 213 KVIQETLEKFPKEDHEVTGPLIATALALLCGIVAMGAGVLRLGFLVELISLNAVAGFMTG 272

Query: 251 SAFNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYLWKWW 310
           S+ NI+ GQVPALMG+   V+TR STYK++I+SLK+L  T+LDAVFGL+PL LLY WKWW
Sbjct: 273 SSLNIISGQVPALMGFKKYVHTRDSTYKIIINSLKNLKHTQLDAVFGLIPLVLLYTWKWW 332

Query: 311 CGTYGPKLADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNKDKEHRPI 370
           C +YGPKLADR   ++PKK+ ILK FYFY+ AMR+AVIIIVFTAIS+ ITK +      I
Sbjct: 333 CSSYGPKLADRHFKNNPKKRDILKTFYFYAQAMRSAVIIIVFTAISYGITKGRKTPR--I 390

Query: 371 KVLGTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRINDYKVVPDQ 430
            VLG VP GL+DV V +IPEGLL+KM   IP++II+LLLEHI+I+KSFGR+N+YKVVPDQ
Sbjct: 391 SVLGKVPKGLKDVHVMRIPEGLLSKMGSSIPSAIIILLLEHISIAKSFGRVNNYKVVPDQ 450

Query: 431 ELIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFF 490
           ELIAIGATNLIGTFFNAYPATGSFSRSALKAKC VRTP SGVF+G CVL+A+YCLT  F+
Sbjct: 451 ELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFSGACVLLALYCLTQTFY 510

Query: 491 FIPSATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIYFAMC 550
           +IPSATLSAVIIHAVSDL ASYKT+WNF+KMNP D  AFIVTV ITVFSSI+ GIYFAMC
Sbjct: 511 YIPSATLSAVIIHAVSDLCASYKTSWNFYKMNPGDFIAFIVTVFITVFSSIDYGIYFAMC 570

Query: 551 WSCAMLLLKHAFPAGQFLGRVEVAEVINPTVVEDVEAIS-----------INDQIEGSVG 599
           WS AM LLK+ F  G+FLGRVEVAEV+N  V  +VE++S               IE S  
Sbjct: 571 WSAAMFLLKNMFAPGRFLGRVEVAEVVNAQVDPNVESVSESAGSHLDGFQAQSSIESSSK 630

Query: 600 KSKSLK-----------ADKGA---ISASSGSNYKFHSKWVAEQYAYNRELNPDVKILPP 645
           K   L             D G+   I+   G    +H+KW++   +Y+RE NP+V I PP
Sbjct: 631 KLDPLDKSAVHSNYLNGGDDGSDNNINNQIGQKLVYHTKWISYDRSYSREFNPEVPIQPP 690

Query: 646 PPGVVVYRMSDSFTYINCSRHYDTIFDHIKKHTRRGQLLHLRKKSDRPWNDPGEWEISPS 705
           PPGV+VYR  DS+TY+NCSRHYD I+D +++ TRRGQ++   KK DRPWNDPGEWE    
Sbjct: 691 PPGVIVYRFGDSYTYLNCSRHYDIIYDEVRRTTRRGQMISAVKKVDRPWNDPGEWEAPRW 750

Query: 706 IKKFFKLGKKNQN--DIESQDEDVAIDNTRDERPLLKIICLDFSQVVQVDSTAIQSLVDL 763
            KK     K  +   + E+Q+   A    +D RPLLKIICLDFSQ  Q D+TAIQ+L DL
Sbjct: 751 FKKLTSKKKTAEEWAETEAQESKAAEQKLQDNRPLLKIICLDFSQCSQTDATAIQNLTDL 810

Query: 764 RKAVHKYADRQVEFHFTGIISSWVKRSLLSMGFGTVNASYSDESIIAGHSSYHIAKTTKP 823
           RK V++YADRQVEFH  G+ + WVKR+L++ GFGTVN  YSDES++AGH SYH+A+    
Sbjct: 811 RKQVNRYADRQVEFHICGLYAPWVKRALVNFGFGTVNEEYSDESLLAGHRSYHVARAPTS 870

Query: 824 LADDFTTDXXXXXXXXXXXEIYAATGTNMPFFHLDIPDFSKWDL 867
           L D   +             +Y A+GTN+PFFH++IPDFSKWDL
Sbjct: 871 LEDGLGSP--------AQYSVYPASGTNLPFFHVEIPDFSKWDL 906

>KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} similar
           to uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
           High affinity sulfate permease sulfate uptake is
           mediated by specific sulfate transporters Sul1p and
           Sul2p which control the concentration of endogenous
           activated sulfate intermediates and uniprot|Q12325
           Saccharomyces cerevisiae YLR092W SUL2
          Length = 891

 Score = 1020 bits (2637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/799 (62%), Positives = 617/799 (77%), Gaps = 23/799 (2%)

Query: 76  IPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYADLVAGITV 135
           +P +EE+ V  K  Y++ +R  LT ++   Y+ SLFP++KW  HYN  W Y DLVAGITV
Sbjct: 109 VPNYEETVVDAKQLYDEKLRPYLTFSAIVEYLTSLFPLLKWVHHYNFNWLYNDLVAGITV 168

Query: 136 GCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAQ 195
           GCVLVPQSMSYAQIA+LP QYGLYSSF+GAFIYS FATSKDVCIGPVAVMSL+TAKVIA+
Sbjct: 169 GCVLVPQSMSYAQIATLPAQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVIAR 228

Query: 196 VSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVAGFMTGSAFNI 255
           V  K  E++P +TAP+IAT LSL+CG VA+GVGLLRLGFLVE ISLNAVAGFMTGSA NI
Sbjct: 229 VLEKVGEDNPEITAPIIATTLSLICGGVALGVGLLRLGFLVEFISLNAVAGFMTGSAINI 288

Query: 256 LWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYLWKWWCGTYG 315
           + GQVP LMGYS  VNTR STYKV+I++LKHLPDTKLDAVFGL+PL +LY WK++CGT G
Sbjct: 289 MSGQVPGLMGYSKNVNTRDSTYKVIINTLKHLPDTKLDAVFGLIPLFILYSWKYFCGTLG 348

Query: 316 PKLADRQLAHSP-KKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNKDKEHRPIKVLG 374
           PKL DR +A S  K+    K   FY  A+RNA +II+FT ISW IT++K KE  PI +LG
Sbjct: 349 PKLVDRYVARSDVKRAAAYKYILFYLQALRNAFVIIIFTLISWGITRHKAKEDLPISLLG 408

Query: 375 TVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRINDYKVVPDQELIA 434
           TVPSGL++VGV K+P+GL++ +A ++P++II+L+LEHIAISK+FGR+N YKVVPDQELIA
Sbjct: 409 TVPSGLKNVGVMKLPDGLVSNLASELPSAIIILVLEHIAISKAFGRVNGYKVVPDQELIA 468

Query: 435 IGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFFFIPS 494
           IG TNLI TFFNAYPATGSFSRSALKAKC V+TP SG+FTG CVL+++YCLTDAF+FIP 
Sbjct: 469 IGVTNLISTFFNAYPATGSFSRSALKAKCNVKTPLSGIFTGACVLLSLYCLTDAFYFIPK 528

Query: 495 ATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIYFAMCWSCA 554
           A LSA+IIHAVSDL+ASYKTTWNFW MNPLD   FIVTV+IT+FSSIENGIYFA+CWSCA
Sbjct: 529 AALSAIIIHAVSDLVASYKTTWNFWLMNPLDFVCFIVTVIITIFSSIENGIYFAVCWSCA 588

Query: 555 MLLLKHAFPAGQFLGRVEVAEVINPTVVEDVEAISINDQ-----IEGSVGKSKS-LKADK 608
           +LLLK  FP GQFLG VE+ +V N  V E+++ I +++      IE +V K+ + +K   
Sbjct: 589 LLLLKVVFPTGQFLGYVEICQVSNAEVDENIDRIVLSEDSQPKTIEDNVTKNNTAVKVGV 648

Query: 609 GAISASSGSNYKFHSKWVAEQYAYNRELNPDVKILPPPPGVVVYRMSDSFTYINCSRHYD 668
            A  +   S  ++H+KW+     Y RELNPDV +  PPPGV+VYR S+S+TY+NCSR YD
Sbjct: 649 VANESFGHSQLQYHTKWLPLNNHYQRELNPDVVVQAPPPGVIVYRPSESWTYVNCSRQYD 708

Query: 669 TIFDHIKKHTRRGQLLHLRKKSDRPWNDPGEWEISPSIKKFFKLGKKNQNDIESQDEDVA 728
           TIFD +K+ TR G+LL    K D+ WNDPGEWE    +KK FKLG  N++D+E  +    
Sbjct: 709 TIFDRVKELTRPGKLLKHVSKHDKMWNDPGEWEPPFLVKKLFKLG--NKHDLEGGE---- 762

Query: 729 IDNTRDERPLLKIICLDFSQVVQVDSTAIQSLVDLRKAVHKYADRQVEFHFTGIISSWVK 788
                DERP+LKI+ +D+SQV Q+DST +Q+LVDLRKA++KYA+RQVEFHF+GIIS W+K
Sbjct: 763 ---VIDERPVLKILAMDWSQVTQIDSTGVQNLVDLRKAINKYANRQVEFHFSGIISPWIK 819

Query: 789 RSLLSMGFGTVNASYSDESIIAGHSSYHIAKTTKPLADDFTTDXXXXXXXXXXXEIYAAT 848
           RSL++ GFGTVN  +SDESII GH+SY + K    L D                 ++ A 
Sbjct: 820 RSLINAGFGTVNEEFSDESIIVGHTSYSLVKNRPDLQDP-------EAALPEPIALHTAL 872

Query: 849 GTNMPFFHLDIPDFSKWDL 867
           G N+PFFHL++P+F KW L
Sbjct: 873 GVNLPFFHLEMPEFHKWHL 891

>TPHA0A01760 Chr1 complement(356771..359452) [2682 bp, 893 aa] {ON}
           Anc_8.271 YLR092W
          Length = 893

 Score =  993 bits (2566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/834 (59%), Positives = 626/834 (75%), Gaps = 44/834 (5%)

Query: 75  NIPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYADLVAGIT 134
           +IP + E  V++KD+Y + I +  ++     Y+ SLFP++KW PHYNL W   DL+AGIT
Sbjct: 63  SIPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAGIT 122

Query: 135 VGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIA 194
           VGCVLVPQSMSYAQIA+L PQYGLYSSFIGAFIYS FATSKDVCIGPVAVMSLQTAKVI 
Sbjct: 123 VGCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVIE 182

Query: 195 QVSAKYPENDP-IVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVAGFMTGSAF 253
           +V++    ++  I TAP+IATAL+LLCGI++ G+G LRLGFL+E ISLNAVAGFMTGSAF
Sbjct: 183 RVTSGLTADEQTIYTAPIIATALALLCGIISTGIGFLRLGFLIEFISLNAVAGFMTGSAF 242

Query: 254 NILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYLWKWWCGT 313
           NI+ GQVPALMGY+ KVNTRASTY+VVI++LKHLPDTKLDAVFGL+PL +LYL KW+  +
Sbjct: 243 NIICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWFFSS 302

Query: 314 YGP----KLADRQLAHSPKKQRILK---RFYFYSNAMRNAVIIIVFTAISWRITKNKDKE 366
            GP    KL++R+   + ++++I+K    ++FYSNAMRN V+IIVFTAISW IT+ K   
Sbjct: 303 LGPQYLNKLSNRR-NLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRGKSST 361

Query: 367 HRPIKVLGTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRINDYKV 426
             PI +LGTVP GL++V V K+P GL  K+APD+P+SII+LLLEHIAISKSFGR+NDYK+
Sbjct: 362 SVPISILGTVPKGLKEVAVFKVPGGLFEKLAPDLPSSIIILLLEHIAISKSFGRVNDYKI 421

Query: 427 VPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLT 486
           VPDQELIAIG TNLIGTFF AYPATGSFSRSALKAKC+V+TP SG+F+G CVL+A+YCLT
Sbjct: 422 VPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCLT 481

Query: 487 DAFFFIPSATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIY 546
            AF++IP ATLSAVIIHAVSDLLASYKTT NF+KMNPLD   FI TV ITVFSSIE GIY
Sbjct: 482 GAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIEYGIY 541

Query: 547 FAMCWSCAMLLLKHAFPAGQFLGRVEVAEVINPT--------VVEDVEAI-----SINDQ 593
           FA+C+SCA L+ K+ FP G FLG +++AEV+NPT        +++D  ++     + +D 
Sbjct: 542 FAICFSCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSSSVLGEENTKDDS 601

Query: 594 IEGSVGKSKSLKADKGAISA---------SSGSNYKFHSKWVAEQYAYNRELNPDVKILP 644
           ++  + ++++ K+ +   S          S  +N  ++ +WV  +  Y+RE+NP +KI P
Sbjct: 602 VKNRLDQNENPKSSEKEYSEFKSYEMSSNSKTTNLSYYVRWVPMKNDYHREVNPLIKITP 661

Query: 645 PPPGVVVYRMSDSFTYINCSRHYDTIFDHIKKHTRRGQLLHLRKKSDRPWNDPGEWEISP 704
           PPPG++VYR  DSFTY+NCSRHYD I+D +KK+TR+G     ++K DRPWND GEWE  P
Sbjct: 662 PPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRPWNDVGEWE-CP 720

Query: 705 SIKKFFKLGKKNQNDI---ESQDEDVAID-----NTRDERPLLKIICLDFSQVVQVDSTA 756
              K      K + DI   E +D + AI+     N  D +P LKIIC DFSQVVQ D+TA
Sbjct: 721 KSLKNLFNKFKKKTDIGGDEDKDGNEAIESNSKANNTDNKPELKIICFDFSQVVQTDATA 780

Query: 757 IQSLVDLRKAVHKYADRQVEFHFTGIISSWVKRSLLSMGFGTVNASYSDESIIAGHSSYH 816
           IQSL DLRKAV++Y+++Q+E+HF+GIIS+WVK+SL+ MGFGTVN +YSD+SII GH SYH
Sbjct: 781 IQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDKSIIIGHQSYH 840

Query: 817 IAKTTKPLADDFTTDXXXXXXXXXXXEIY---AATGTNMPFFHLDIPDFSKWDL 867
           ++K      D                 IY     TGTN PFFH+DIPDFS W+L
Sbjct: 841 VSKINNQ-EDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDFSNWEL 893

>KLTH0G13486g Chr7 complement(1156678..1159386) [2709 bp, 902 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 902

 Score =  991 bits (2561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/903 (56%), Positives = 631/903 (69%), Gaps = 76/903 (8%)

Query: 12  DSAFKLDDLEAEYDLYKANEQLEDNEVTVNGSEDDYGNKKGIDLVKETEVRYY------- 64
           D+   LDDL+AEY  +K  E    +         +YG +   +   E             
Sbjct: 25  DAPIDLDDLDAEYGQFKNAEH--SDATAGRDLTSEYGAQFAAEFGGEPGSGSGSGSGFPE 82

Query: 65  GSPGPEAIGGNIPG----FEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHY 120
             P   A  GN+P     F E  V+V ++Y+Q +R   TL +  +Y+ SL PI++W PHY
Sbjct: 83  AKPVAPAAPGNVPSALYEFHERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIMRWLPHY 142

Query: 121 NLTWGYADLVAGITVGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIG 180
           N  W Y DLVAGITVGCVLVPQSMSYAQIA+L PQYGLYSSF+GAFIYS FATSKDVCIG
Sbjct: 143 NARWLYQDLVAGITVGCVLVPQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDVCIG 202

Query: 181 PVAVMSLQTAKVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELIS 240
           PVAVMSLQTAK I+ V +  PE D  +T+P+IATAL+LLCGI+++G+G+LRLGFLVELIS
Sbjct: 203 PVAVMSLQTAKAISHVVSSLPE-DTEITSPMIATALALLCGIISLGLGVLRLGFLVELIS 261

Query: 241 LNAVAGFMTGSAFNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVP 300
             AVAGFMTGSA NI+ GQVPALMGY+  VNTR STYKV+I+SL+HLPDTKLDAVFGLVP
Sbjct: 262 STAVAGFMTGSALNIIAGQVPALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAVFGLVP 321

Query: 301 LCLLYLWKWWCGTYGPKLADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRIT 360
           L +LY+WKW C T GP+L  R   +  ++ R+    + Y+ A+RNAV+I+VFTAI+W ++
Sbjct: 322 LVILYVWKWGCSTGGPRLVQR---YGSRRSRMWDNVFLYTQALRNAVVIVVFTAIAWGMS 378

Query: 361 KNKDKE--HRPIKVLGTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSF 418
               KE     I +LGTVPSGL+DVGV K+P GLL+K+AP++PAS+IVL+LEHIAISK+F
Sbjct: 379 HRALKEGGSARISLLGTVPSGLKDVGVMKVPSGLLSKIAPELPASVIVLVLEHIAISKAF 438

Query: 419 GRINDYKVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCV 478
           GR+NDY+VVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKC V TP SG+F+G CV
Sbjct: 439 GRVNDYRVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGACV 498

Query: 479 LVAIYCLTDAFFFIPSATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVF 538
           L+AIYCLT AF FIP ATLSAVIIHAVSDL+ASYKTTW+FW+++P D   F+VTV+ITVF
Sbjct: 499 LLAIYCLTSAFKFIPKATLSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTVVITVF 558

Query: 539 SSIENGIYFAMCWSCAMLLLKHAFPAGQFLGRVEVAE--VINPTVVEDV----------- 585
           SSIENGIYFAMCWS A+LL + AFPAG+FLGRV++AE  V N      V           
Sbjct: 559 SSIENGIYFAMCWSVAVLLFRTAFPAGKFLGRVQIAEARVTNSGAGAGVGMSSGNSAGTA 618

Query: 586 -----------EAISINDQ-----------IEGSVGKSKSLKADKGAISASSGSNYKFHS 623
                       A+S++ +              S G  K  K +       S    +FH+
Sbjct: 619 VNREKERETTFTAVSVSSESLSHTAPGKAKAANSAGTDKLGKVEGHVTDGGSPRAPRFHT 678

Query: 624 KWVAEQYAYNRELNPDVKILPPPPGVVVYRMSDSFTYINCSRHYDTIFDHIKKHTRRGQL 683
           KWV     Y RELNP+V + PPPPGV+V+R S+S+TY+NCSR YD IFD + + TRRG+ 
Sbjct: 679 KWVPFDR-YTRELNPEVFVAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEVVRLTRRGRP 737

Query: 684 LHLRKKSDRPWNDPGEWEISPSIKKFFKLGKKNQNDIESQDEDVAIDNTRDERPLLKIIC 743
             + K S RPWNDPGEW     ++K F   K +  D+E++         RDERP+L++I 
Sbjct: 738 QIVAKSSSRPWNDPGEWHPPKFLRKLF---KSSSEDLENRAV------ARDERPVLRVIA 788

Query: 744 LDFSQVVQVDSTAIQSLVDLRKAVHKYADRQVEFHFTGIISSWVKRSLLSMGFGTVNASY 803
           +D+SQV QVDST +Q+L DLRKAV+KYADRQVEFHF GII  WVKR L++ GFGTVN  +
Sbjct: 789 MDWSQVAQVDSTGLQTLQDLRKAVNKYADRQVEFHFAGIIEPWVKRGLINSGFGTVNDEF 848

Query: 804 SDESIIAGHSSYHIAKTTKPLADDFTTDXXXXXXXXXXXEIYAATGTNMPFFHLDIPDFS 863
           +DES++ GH S HIA++ +P  D+                 + ATGTN+PFFHL++PDFS
Sbjct: 849 ADESLLVGHKSCHIARSAEPTEDE------------ESRLAHPATGTNLPFFHLELPDFS 896

Query: 864 KWD 866
           +WD
Sbjct: 897 EWD 899

>Kwal_56.23759 s56 complement(693180..695765) [2586 bp, 861 aa] {ON}
           YBR294W (SUL1) - Probable sulfate transport protein
           [contig 173] FULL
          Length = 861

 Score =  953 bits (2463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/886 (56%), Positives = 620/886 (69%), Gaps = 63/886 (7%)

Query: 12  DSAFKLDDLEAEYDLYKANEQLE---------DNEVTVNGS----EDDYGNKKGIDLVKE 58
            ++  LDDL+AEY  +K  E  E            V V  S    +D  G+K G      
Sbjct: 7   QTSLDLDDLDAEYGHFKNTEHSEIGGGPSSNPGAAVGVGASTKLGQDQNGDKSGATGGGN 66

Query: 59  TEVRYYGSPGPEAIGGNIPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFP 118
                     P A+  +   + E  V+ ++YY+  IR  LT ++   Y+  L P++ W P
Sbjct: 67  GANE------PLALYDSPEAYYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLP 120

Query: 119 HYNLTWGYADLVAGITVGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVC 178
           HYN  W Y D+VAGITVGCVLVPQSMSYA IA+LPPQ+GLYSSF+GA IYS FATSKDVC
Sbjct: 121 HYNGRWFYQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVC 180

Query: 179 IGPVAVMSLQTAKVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVEL 238
           IGPVAVMSLQTAK +++V A+ P  D  +TAPV+ATAL+ LCG++++G+G+LRLGFLVEL
Sbjct: 181 IGPVAVMSLQTAKAVSKVMAELPA-DTDITAPVVATALAFLCGLISLGLGVLRLGFLVEL 239

Query: 239 ISLNAVAGFMTGSAFNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGL 298
           IS  AVAGFMTGSA NI+ GQ+PALMGY+  VNTR STYKV+I++LKHLPDTKLDAVFGL
Sbjct: 240 ISSTAVAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGL 299

Query: 299 VPLCLLYLWKWWCGTYGPKLADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWR 358
           +PL +LY WKW C + GP+L +R      +KQRI     FY+ A+RNAVIIIVFTAI+W 
Sbjct: 300 IPLVMLYTWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQALRNAVIIIVFTAIAWS 359

Query: 359 ITKNKDKEHRPIKVLGTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSF 418
           I+ +K K   PI +LG VPSGL+DVGV K+P+GL AK+AP++PAS+IVLLLEHIAI+K+F
Sbjct: 360 ISHHKKKA--PISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAF 417

Query: 419 GRINDYKVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCV 478
           GR+NDY+VVPDQELIAIGATNL+GTFFNAYPATGSFSRSALKAKC V TP SGVF+G CV
Sbjct: 418 GRVNDYRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACV 477

Query: 479 LVAIYCLTDAFFFIPSATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVF 538
           L+AIYCLT AF +IP ATLSAVIIHAVSDL+ASYKTTW+ W++NPLD   F+ TV I VF
Sbjct: 478 LLAIYCLTSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVF 537

Query: 539 SSIENGIYFAMCWSCAMLLLKHAFPAGQFLGRVEVAEV-INPTVVEDVEAISINDQIEGS 597
           SSIENGIYFAMCWS A+LL K AFP  QFLGRVE+AE+  N  V    E   ++   E  
Sbjct: 538 SSIENGIYFAMCWSVAVLLFKVAFPRAQFLGRVEIAELATNEGVSAGSEFAPLSKDFEKG 597

Query: 598 VG--------KSKSLKADKGAISASS--------GSNYKFHSKWVAEQYAYNRELNPDVK 641
            G         S+S  A K  I   S         +   FH+KWV  +  Y RELNP V 
Sbjct: 598 KGVSYASGSVSSESFNAKKQGIEGGSQFVGGASNAAGAGFHTKWVPFE-PYTRELNPQVP 656

Query: 642 ILPPPPGVVVYRMSDSFTYINCSRHYDTIFDHIKKHTRRGQLLHLRKKSDRPWNDPGEWE 701
           +  PPPGV+V+R S+S+TY+NC+R Y+ IFD + + TRRG+ + +  KS RPWNDPGEW 
Sbjct: 657 VAQPPPGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGK-VQVTSKSGRPWNDPGEWH 715

Query: 702 ISPSIKKFFKLGKKNQNDIESQDEDVAIDNTRDERPLLKIICLDFSQVVQVDSTAIQSLV 761
               ++K+F  GKK     ES ++ V      D+RP+L++I +D+SQV QVDST +Q+L 
Sbjct: 716 PPKFLRKWF--GKKYS---ESLEQGV----VSDDRPVLRVIAMDWSQVAQVDSTGLQTLH 766

Query: 762 DLRKAVHKYADRQVEFHFTGIISSWVKRSLLSMGFGTVNASYSDESIIAGHSSYHIAKTT 821
           DLRKAV KYADRQVEFHF+GIIS W+KR LL+ GFGTVN  ++DES++ GH +Y +A+  
Sbjct: 767 DLRKAVSKYADRQVEFHFSGIISPWIKRGLLNTGFGTVNEEHADESLLVGHKTYQVARGG 826

Query: 822 KPLADDFTTDXXXXXXXXXXXEIYAATGTNMPFFHLDIPDFSKWDL 867
                  T D               ATG NMPFFH ++PDFSKWD 
Sbjct: 827 A------TGDEEALLPQ-------PATGVNMPFFHAEMPDFSKWDF 859

>AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR092W
           (SUL2)
          Length = 848

 Score =  944 bits (2441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/866 (55%), Positives = 617/866 (71%), Gaps = 69/866 (7%)

Query: 17  LDDLEAEYDLYKANEQLEDNEVTVNGSEDDYGNKKGIDLVKETEVRYYGSPGPEA--IGG 74
           ++ L+AEYD  KA E       T      D G+++           Y GS  P A  +G 
Sbjct: 31  IEALQAEYDQLKAGEVHSAQGAT----HGDIGSRQ-----------YSGSGKPAAQYLGL 75

Query: 75  NI------PGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYAD 128
           N+      P +EE+ VSVKDYYN  +R  ++LN+A  Y  S+FP+ +W  HYN+ W YAD
Sbjct: 76  NVNSREAVPEYEETVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRWIHHYNVAWMYAD 135

Query: 129 LVAGITVGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQ 188
           +VAGITVGCVLVPQSMSYAQ+ASL PQYGLYSSF+GAFIYS FATSKDVCIGPVAVMSL+
Sbjct: 136 MVAGITVGCVLVPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLE 195

Query: 189 TAKVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVAGFM 248
           TAKVIA+V+   PE D  +T P+IATAL+LLCG +A+ +G+LRLGFLVE IS+ AV GFM
Sbjct: 196 TAKVIARVTENLPE-DTNITGPIIATALTLLCGAIAMVIGILRLGFLVEFISITAVTGFM 254

Query: 249 TGSAFNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYLWK 308
           TGSA +I+ GQVP+LMGYS KVNTRA+TYKV+I+SLKHL DT ++A FGLVPL LL+LWK
Sbjct: 255 TGSALSIISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWK 314

Query: 309 WWCGTYGPKLADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNKDKEHR 368
           W CG+ GP+L DR L   P +       +FY  A+RNAVII+VFTAISW I+++K  E  
Sbjct: 315 WICGSLGPRLVDRYLQFKPSRASRWNAAFFYLQALRNAVIIVVFTAISWGISRHK-LEKP 373

Query: 369 PIKVLGTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRINDYKVVP 428
           PI +LG VPSGL++VG  ++PEGL+ K+ P++PA+ I+LLLEHIAI+KSFGRIN+YKVVP
Sbjct: 374 PISLLGKVPSGLKNVGPLELPEGLVEKLLPELPAATIILLLEHIAIAKSFGRINNYKVVP 433

Query: 429 DQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDA 488
           DQELIAIG TNL  TFFNAYPATGSFSRSALKAKC V+TP SG+FTG CVL+A+YCLT+A
Sbjct: 434 DQELIAIGVTNLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEA 493

Query: 489 FFFIPSATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIYFA 548
           F+FIP ATLSAVIIHAV+DL+ASYK TW FW+ NPLD  AFIVTV+ITVFSSIE+GIYF+
Sbjct: 494 FYFIPKATLSAVIIHAVADLIASYKVTWMFWRTNPLDFFAFIVTVIITVFSSIEHGIYFS 553

Query: 549 MCWSCAMLLLKHAFPAGQFLGRVEVAEVIN----PTVVEDVEAISIND-----QIEGSVG 599
           + WSCA+LL K AFP G+FLG ++VAEVI     P++  + +  SI++     QI+   G
Sbjct: 554 ISWSCAVLLCKVAFPDGKFLGYIDVAEVIEPAGPPSINSEADLASIDNSATFQQIDKDGG 613

Query: 600 KSKSLKADKGAISASSGSNYKFHSKWVAEQYAYNRELNPDVKILPPPPGVVVYRMSDSFT 659
           K  +++      S     + +FH +W+   +AY+RELNP+  + PPPPGV+VYR +DS+T
Sbjct: 614 KLNTVE------SVLPDPHTRFHRRWIPLDHAYSRELNPEAVVNPPPPGVIVYRPTDSWT 667

Query: 660 YINCSRHYDTIFDHIKKHTRRGQLLHLRKKSDRPWNDPGEWEISPSIKKFFKLGKKNQND 719
           Y+NCSRH+D I DH+K+HTR GQL++     +R W DPG W   P I + F   K+  + 
Sbjct: 668 YLNCSRHFDIILDHVKEHTRPGQLVNHLSNKERLWCDPGPWR-PPRIFRRFIADKRTGSA 726

Query: 720 IESQDEDVAIDNTRDERPLLKIICLDFSQVVQVDSTAIQSLVDLRKAVHKYADRQVEFHF 779
           +             D RP+L+++ +D+SQV QVDST IQ+LVDLR A++KYADR VEFHF
Sbjct: 727 VA------------DARPVLRVLAMDWSQVSQVDSTGIQNLVDLRNALNKYADRPVEFHF 774

Query: 780 TGIISSWVKRSLLSMGFGTVNASYSDESIIAGHSSYHIAKTTKPLADDFTTDXXXXXXXX 839
            GI+S W+KR+L++ GFG      +D  +I+   SYH+ +     AD             
Sbjct: 775 AGIVSPWIKRALVNTGFGI-----ADPPLISSRVSYHLVRLP---ADP--------PHIV 818

Query: 840 XXXEIYAATGTNMPFFHLDIPDFSKW 865
               +  A GTN PFFHLD+PDF  W
Sbjct: 819 HGHSVVFALGTNTPFFHLDMPDFETW 844

>Ecym_4299 Chr4 complement(639078..641702) [2625 bp, 874 aa] {ON}
           similar to Ashbya gossypii AGR077C
          Length = 874

 Score =  884 bits (2285), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/858 (50%), Positives = 602/858 (70%), Gaps = 30/858 (3%)

Query: 17  LDDLEAEYDLYKANEQLEDNEVTVNGSEDDYGNKKGIDLVKETE--VRYYGSPGPEAIGG 74
           LD+LE +Y  +K NE    +    +G+E++       D V  +    +Y G+  P+    
Sbjct: 40  LDELETDYTRFKTNE----DSAGYSGAENERSRIDKFDSVGSSLQFAKYDGNALPDF--- 92

Query: 75  NIPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYADLVAGIT 134
             P + E+TV+  +YY++ IR ++  +   SY  SLFPI+KW  HYN  W Y+D +AGIT
Sbjct: 93  KAPPYYETTVTFMEYYDRTIRSRVGRSFFRSYFLSLFPIIKWIHHYNFAWMYSDFIAGIT 152

Query: 135 VGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIA 194
           VGCVLVPQSMSYAQ+A L P+YGLYSSFIGAFIYS FATSKDVCIGPVAVMS+Q +KVI+
Sbjct: 153 VGCVLVPQSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSVQVSKVIS 212

Query: 195 QVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVAGFMTGSAFN 254
            V  + PE  PI TAP++A+AL+L   I+ I +GLLRLGF++ELIS+ AVAGFMTGSA +
Sbjct: 213 HVIDQLPEGTPI-TAPMVASALALFSSILVIPIGLLRLGFILELISVTAVAGFMTGSALS 271

Query: 255 ILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYLWKWWCGTY 314
           IL  Q+P+L+G   K+NTR  TY+V+I +LKHL  + ++A FGL+ L LL+ WKW CG  
Sbjct: 272 ILASQLPSLLGIQ-KINTRVETYRVLISTLKHLNGSDINAAFGLICLALLFFWKWTCGYL 330

Query: 315 GPKLADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNKDKEHRPIKVLG 374
           GPKL  + L  + KK RI + F+FY+ A+RNA ++ + T +SW +   + K+   I VLG
Sbjct: 331 GPKLISKYLRPNSKKARIWQSFFFYAQALRNAFVLFLATFVSWLVI-GRHKKKTSISVLG 389

Query: 375 TVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRINDYKVVPDQELIA 434
           TVPSGL+ VGV  IP GL+ K+ P +P ++I+LLLEHI I+KSFGRIN+YK+VPDQELIA
Sbjct: 390 TVPSGLKHVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKSFGRINNYKIVPDQELIA 449

Query: 435 IGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFFFIPS 494
           IG TNLIG+FFNAYPATGSFSRSALKAKC V+TP SG+F+G CVL+A+Y LT AF++IP 
Sbjct: 450 IGVTNLIGSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSGACVLLALYYLTSAFYYIPK 509

Query: 495 ATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIYFAMCWSCA 554
           A LSAVIIHAV DL+ASYK ++  W  NP D  +F+ T+L+T+FSSIENGIYFA+ +S A
Sbjct: 510 AALSAVIIHAVVDLIASYKLSFYLWNTNPFDLISFLATILLTIFSSIENGIYFAVAFSMA 569

Query: 555 MLLLKHAFPAGQFLGRVEVAEVINPTVVEDVEAISIND-QIEGSVGKSKSLKAD----KG 609
            LL+K+AFP+G+FLG V++ EV N  V ED+++I  ND ++   + K   L  D      
Sbjct: 570 TLLMKNAFPSGKFLGYVKITEVSNLNVFEDLDSIGNNDPELPQEISKDSKLAKDPDVHAS 629

Query: 610 AISASSGSNYKFHSKWVAEQYAYNRELNPDVKILPPPPGVVVYRMSDSFTYINCSRHYDT 669
           A   +S  + +FH+KWV     Y+RELNP++ +  PPPGV+VYR ++S+ Y+NCSR +D 
Sbjct: 630 ANLMASKLDVRFHTKWVPLDNGYSRELNPEIAVHMPPPGVIVYRPTESWHYLNCSRQFDI 689

Query: 670 IFDHIKKHTRRGQLLHLRKKSDRPWNDPGEWEISPSIKKFFKLGKKNQNDIESQDEDVAI 729
           I D +K  TR G+L++  +KS++ W +PG+W     ++KFFK  +      E  ++    
Sbjct: 690 IVDRVKTLTRPGKLVNHLRKSEQLWCEPGDWVPPLFLRKFFKKYRHKAAKPEVVEQ---- 745

Query: 730 DNTRDERPLLKIICLDFSQVVQVDSTAIQSLVDLRKAVHKYADRQVEFHFTGIISSWVKR 789
               D RP+LKI+ +D++QV  VDST+IQSL+DLRK +++YADRQV FHF+GI+S W+KR
Sbjct: 746 ---VDNRPVLKILAMDWTQVTHVDSTSIQSLIDLRKTINRYADRQVGFHFSGIVSPWIKR 802

Query: 790 SLLSMGFGTVNASYSDESIIAGHSSYHIAKTTKPLADDFTTDXXXXXXXXXXXEIYAATG 849
           +L+  GFGT+N +YS++ ++  +S+YH+ +         + D            +  A+G
Sbjct: 803 ALVHAGFGTINENYSNDPLLLKYSTYHVVQNV------LSADEENQQNSEISASLDVASG 856

Query: 850 TNMPFFHLDIPDFSKWDL 867
           TN PFFH+D+PDF+KWD+
Sbjct: 857 TNFPFFHIDMPDFTKWDI 874

>TBLA0F03050 Chr6 complement(738517..741210) [2694 bp, 897 aa] {ON}
           Anc_8.271 YLR092W
          Length = 897

 Score =  535 bits (1379), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 272/533 (51%), Positives = 371/533 (69%), Gaps = 25/533 (4%)

Query: 79  FEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYADLVAGITVGCV 138
           + E  V++ + +N  +    T  S  +Y+ SL PI KW  HYNL W  +D++AGITVGCV
Sbjct: 3   YREKQVTLIETFNHRVPRAFTWQSIKTYLLSLLPITKWIAHYNLQWFISDVIAGITVGCV 62

Query: 139 LVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAQVSA 198
           LVPQSMSYAQIA+L PQYGLYSS +G FIY++FATSKD+CIGPVA+MSLQTAK IA V  
Sbjct: 63  LVPQSMSYAQIATLDPQYGLYSSIMGCFIYTVFATSKDICIGPVAIMSLQTAKAIAHVHQ 122

Query: 199 KYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVAGFMTGSAFNILWG 258
           K+P+    + A +IA+ ++++CG + +G+G+LRLGF ++LI + AV GF +GSAFNILWG
Sbjct: 123 KHPD----IPAHIIASTIAVICGAITMGIGVLRLGFFIDLIPVTAVFGFTSGSAFNILWG 178

Query: 259 QVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYLWKWWCGTYGPKL 318
           Q+P LMGYS  VNTR  TYKVV+D+LK LP T ++AV GL+PL  L++WK     YG   
Sbjct: 179 QIPGLMGYSKDVNTRQDTYKVVVDTLKKLPKTNINAVMGLIPLFCLFVWK-----YGCDY 233

Query: 319 ADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNKDKEHRPIKVLGTVPS 378
           A R+    P  +RI+    FY  ++R  ++II+ +A ++        ++  +KVLG +P 
Sbjct: 234 ALRRGNLKPWPKRIV----FYLLSLRVTIVIIICSAAAY------GAKNPSLKVLGKIPK 283

Query: 379 GL---EDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAI 435
           G     D  +  IP  L++ +  +IPAS+IVL+LEH++I+KSF R+N+Y+V  DQEL AI
Sbjct: 284 GFAAASDNRLKSIPSDLVSDIWSEIPASVIVLVLEHVSIAKSFARVNNYRVSADQELTAI 343

Query: 436 GATNLIGTF-FNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFFFIPS 494
           G +N++G     AYP TGSFSR+ALKA+CEVRTP   +F+G CV+VAI  LT A  +IP 
Sbjct: 344 GVSNVMGACCLGAYPVTGSFSRTALKARCEVRTPLGSIFSGLCVVVAITSLTSALAWIPK 403

Query: 495 ATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIYFAMCWSCA 554
           ATLSAVIIHAVS L++SYK T   +KM PLDC  F+VT+ ITVFS IE G+YFA+CW+C 
Sbjct: 404 ATLSAVIIHAVSGLISSYKVTIRLYKMGPLDCLGFLVTIFITVFSEIEIGVYFAVCWACF 463

Query: 555 MLLLKHAFPAGQFLGRVEVAEVINP--TVVEDVEAISINDQIEGSVGKSKSLK 605
           +L+++ AFP G FLG V V E+     T++E ++  S ND+    + K +  K
Sbjct: 464 LLMIRIAFPYGAFLGYVRVREISRSSITMIEPMDYESGNDKENIKLNKKQLTK 516

 Score =  183 bits (464), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 122/184 (66%), Gaps = 20/184 (10%)

Query: 625 WVAEQYAYNRELNPDVKILPPPPGVVVYRMSDSFTYINCSRHYDTIFDHIKKHTRRGQLL 684
           W+   + + RELNP VKI PPPPGVVVYR SDS TYINCSR+YD I D+IK +T+ G++ 
Sbjct: 688 WIPYSHRFTRELNPHVKIHPPPPGVVVYRFSDSLTYINCSRNYDNIIDYIKDNTKPGEID 747

Query: 685 HLRKKSD----RPWNDPGEWEISPSIKKFFKLGKKNQNDIESQDEDVAIDNTR-DERPLL 739
            L   SD    +PWN+PG WE  P +K +           E  D ++A      D+RP L
Sbjct: 748 VL---SDALYVKPWNNPGPWE-KPKLKFW-----------EHADPEIARKKRMADKRPTL 792

Query: 740 KIICLDFSQVVQVDSTAIQSLVDLRKAVHKYADRQVEFHFTGIISSWVKRSLLSMGFGTV 799
           +I+CLDFSQV Q+DSTA+Q+L+DLR  V+ Y    VE+HF GIIS WV+R+L+ +GFG +
Sbjct: 793 RILCLDFSQVAQIDSTALQALIDLRHEVNAYTCSLVEWHFCGIISPWVRRNLIEIGFGKI 852

Query: 800 NASY 803
           N  +
Sbjct: 853 NKEF 856

>NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {ON}
           Anc_8.99
          Length = 706

 Score =  132 bits (331), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 125/483 (25%), Positives = 208/483 (43%), Gaps = 46/483 (9%)

Query: 95  REKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYADLVAGITVGCVLVPQSMSYA-QIASLP 153
           R  LT ++   Y+   FP   W P+Y LT    DL AG++V    +P ++SYA  +A + 
Sbjct: 44  RSILTTSNIWDYLAYYFPCFSWMPNYTLTKFLGDLTAGLSVASFQIPLALSYATSLAHVE 103

Query: 154 PQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAQVSAKYPENDPIVTAPVIA 213
           P  GLYS  I  FIY++F +   + +GP + +SL    V+ Q       +D  ++   I+
Sbjct: 104 PLSGLYSLAITPFIYAIFGSVPQMIVGPESAISL----VVGQAVEPMVNHDERISTISIS 159

Query: 214 TALSLLCGIVAIGVGLLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYSSKVNTR 273
             ++ + G   + +G+ RLGFL  ++S   + GF+    F ++   + + +     + T 
Sbjct: 160 IVVTFISGSFLLFLGIFRLGFLGNILSRALLRGFICSVGFVMIINSLISELKLDKVLATS 219

Query: 274 ASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYLWKWWCGTYGPKLADRQL-------AHS 326
              Y        H P  K+           L+L K+    Y    A   L          
Sbjct: 220 PEHY--------HTPFEKI-----------LFLIKYGQHNYHAPTAILSLYSFIILMLMK 260

Query: 327 PKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNKDKEHR-PIKVLGTVPSGLEDVGV 385
             K+R++KRF +        ++I+     S+      D +H+  I ++G       D   
Sbjct: 261 VMKKRLMKRFKWVIFVPEILIVIVGTIMFSFHF----DIKHKFDISIIGDFKVNGFDSLH 316

Query: 386 AKIPEGLLAKMAPDIPASIIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGATNLIG 442
             + +     + P + A I+  +L   E    SK+ G   D  V  ++EL+A+G+ N++G
Sbjct: 317 NPLDKTNRLLLKPLLDAGIVCAVLGFFESTTASKALGTTYDLTVSSNRELVALGSMNIVG 376

Query: 443 TFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFFFIPSATLSAVII 502
           + F A PA G + RS + A    +T  SGV  G   L  I          P+  LS V  
Sbjct: 377 SLFGALPAFGGYGRSKINALSGGQTVMSGVCLGSVTLFTIKFFLPVVHNTPTCVLSVVTS 436

Query: 503 HAVSDLLASYKTTWNFW----KMNPLDCCAFIVTVLITVFSSIENGIYFAMCWSCAMLLL 558
                LL    T   F+      N L      +T + T+F S+E GI    C+S  + ++
Sbjct: 437 VVGLTLLEEAPTDLKFYFQSHGYNELIVLG--LTFITTIFYSVEVGICVGCCYSI-ISII 493

Query: 559 KHA 561
           KH+
Sbjct: 494 KHS 496

>KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.99
           YPR003C
          Length = 716

 Score =  127 bits (320), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 123/476 (25%), Positives = 209/476 (43%), Gaps = 41/476 (8%)

Query: 111 FPIVKWFPHYNLTWGYADLVAGITVGCVLVPQSMSYA-QIASLPPQYGLYSSFIGAFIYS 169
            P + W P+YN      D +AG+++    +P  +S+A  +A + P  GLYS  +  FIY+
Sbjct: 72  LPCLIWIPNYNWKKFGCDFIAGLSLASFQIPLGLSFATSLAHVEPLCGLYSLAVTPFIYA 131

Query: 170 LFATSKDVCIGPVAVMSLQTAKVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGL 229
           LF +   + +GP + +SL    V+ Q       +D  +    IAT +S + G+  +  G+
Sbjct: 132 LFGSVPHMIVGPESAISL----VVGQAVETLTSHDLSLETVDIATMISFMSGLTLLFGGI 187

Query: 230 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPD 289
            RLGFL  ++S   + GF++   F ++   +   +  +  + T    Y        H P 
Sbjct: 188 FRLGFLGNILSKALLRGFISSIGFVMIVNSLITELKLNKLMLTIPEHY--------HTPF 239

Query: 290 TKLDAVFGLVPLCLLYLWKWWCGTYGPKLADRQLAHSPK-------KQRILKRFYFYSNA 342
            K+           L+L ++    Y    +   LA           K+++++R  +    
Sbjct: 240 EKI-----------LFLVRYGPSNYHLPTSFLSLAVFTTLMTIRIFKKKMMRRIKWIVFI 288

Query: 343 MRNAVIIIVFTAISWRITKNKDKEHRPIKVLGTVPS-GLEDVG--VAKIPEGLLAKMAPD 399
                ++I    +S+     K  +   I V+G   + G +D    ++K   GL+  +   
Sbjct: 289 PEILSVVIFSIVLSYMCDLKKKYD---ISVIGDFNTDGFDDFRNPLSKCNRGLIPALRDV 345

Query: 400 IPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGATNLIGTFFNAYPATGSFSRSAL 459
              S ++  LE I  SKS G   +     ++EL+A+G  N IG+ F   PA G + RS +
Sbjct: 346 SLVSALLGFLESITASKSLGGYGNTVASSNRELVALGLMNTIGSAFGIIPAFGGYGRSKI 405

Query: 460 KAKCEVRTPFSGVFTGCCVLVAIYCLTDAFFFIPSATLSAVIIHAVSDLL--ASYKTTWN 517
            A    +T  +GVF G   L  I  L     +IP+  LS +       LL  A +   ++
Sbjct: 406 NAFSGAQTVMAGVFMGSVTLFTIKFLLPVIHYIPTCVLSVITTFVGVSLLEEAPHDIKFH 465

Query: 518 FWKMNPLDCCAFIVTVLITVFSSIENGIYFAMCWSCAMLLLKHAFPAG-QFLGRVE 572
                  +   F++T L T F SIE GI  A C    + ++KH+  +  Q L RVE
Sbjct: 466 IRCKGYDELIMFVLTFLCTCFYSIEFGI-LAGCTYSLISIVKHSAQSRIQILARVE 520

>SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {ON}
           similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 744

 Score =  125 bits (315), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 124/481 (25%), Positives = 207/481 (43%), Gaps = 53/481 (11%)

Query: 111 FPIVKWFPHYNLTWGYADLVAGITVGCVLVPQSMSYA-QIASLPPQYGLYSSFIGAFIYS 169
            P   W P Y+L   + D +AG+++    +P +MSYA  IA + P  GLY+     F Y+
Sbjct: 97  LPCFSWLPSYDLRKFFGDFIAGVSLASFQIPLAMSYATSIAHVEPLCGLYALAFTPFFYA 156

Query: 170 LFATSKDVCIGPVAVMSLQTAKVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGL 229
           +F +   + +GP + +SL    V+ Q       +DP +++  +   ++ + G+V    G+
Sbjct: 157 IFGSVPQMIVGPESAISL----VVGQAIEPMIRHDPSLSSLDLCVIITFISGVVLFTFGV 212

Query: 230 LRLGFLVELISLNAVAGFMTG----SAFNILWGQVPALMGYSSKVNTRASTYKVVIDSLK 285
            R GFL  ++S   + GF++        N L  ++     +    +   S ++ V+  +K
Sbjct: 213 FRFGFLDNVLSRAFLRGFISAVGVIMVINSLIVELKLKKVFDDAPSHYHSPFEKVLFLIK 272

Query: 286 HLPDTKLDAVFGLVPLCLLYLWKWWCGTYGPKLADRQLAHSPKKQRILKRFYFYSNAMRN 345
           + P         L   C L L              R L   P+                 
Sbjct: 273 YAPANYHLPTSLLSLCCFLILMSLRLIKKKLLKRFRSLVFFPE----------------- 315

Query: 346 AVIIIVFTAISWRITKNKDKEHR-PIKVLGTVPSGLEDVGVAKIPEGLLAKMAP---DI- 400
            ++++V T I +  + N D +HR  I+V+G + + + D    K+   L     P   D+ 
Sbjct: 316 -ILLVVVTVIFF--SYNFDLKHRYNIEVVGDIEASVFD----KLRNPLSKNKRPFYGDLF 368

Query: 401 PASIIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGATNLIGTFFNAYPATGSFSRS 457
            A  +V +L   E    SKS G   D  V  ++EL+A+G+ NLIG+ F A P+ G + RS
Sbjct: 369 SAGFMVAMLGFFESTTASKSLGTAYDLAVSSNRELVALGSLNLIGSLFGALPSFGGYGRS 428

Query: 458 ALKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFFFIPSATLSAVIIHAVSDLLASYKTTWN 517
            + A    +T  SG   G   +  I  L     +IP   LS +       LL        
Sbjct: 429 KINAYSGAQTVVSGACMGTITMFTIKFLLKFIRYIPVCVLSVITTVVGLSLLEEAPADLR 488

Query: 518 FWKMNPLDC------CAFIVTVLITVFSSIENGIYFAMCWSCAMLLLKHAFPAG-QFLGR 570
           F     + C       +FI+TVL T F S+E GI    C    + ++KH+  +  Q LG+
Sbjct: 489 FH----IRCRGYNELISFIITVLTTFFYSVEAGITVG-CGYSIIRVIKHSTKSRIQILGK 543

Query: 571 V 571
           +
Sbjct: 544 L 544

>YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON}
           Putative sulfate permease; physically interacts with
           Hsp82p; green fluorescent protein (GFP)-fusion protein
           localizes to the ER; YPR003C is not an essential gene
          Length = 754

 Score =  124 bits (311), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 125/484 (25%), Positives = 212/484 (43%), Gaps = 59/484 (12%)

Query: 111 FPIVKWFPHYNLTWGYADLVAGITVGCVLVPQSMSYA-QIASLPPQYGLYSSFIGAFIYS 169
            P   W P Y     + D++AGI+V    +P ++SY   IA +PP  GLYS  I  F+Y 
Sbjct: 105 LPCFSWLPEYTFNKLWGDVIAGISVASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 164

Query: 170 LFATSKDVCIGPVAVMSLQTAKVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGL 229
           +  +   + +GP + +SL   + +  ++  + EN  ++    I+T ++ + G + +  G+
Sbjct: 165 ILGSVPQMIVGPESAISLVVGQAVESITL-HKENVSLID---ISTVITFVSGTILLFSGI 220

Query: 230 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPA-------LMGYSSKVNTRASTYKVVID 282
            R GFL  ++S   + GF++     ++   + +       L+      +T       +ID
Sbjct: 221 SRFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKFLVSLPQHYHTPFEKILFLID 280

Query: 283 ---SLKHLPDTKLDAVFGLVPLCLLYLWKWWCGTYGPKLADRQLAHSPKKQRILKRFYFY 339
              +  H+P     A+F    L +L+L          +L  R+L    K         F+
Sbjct: 281 YAPAQYHIP----TAIFSGCCLIVLFL---------TRLLKRKLMKYHKSA------IFF 321

Query: 340 SNAMRNAVIIIVFTAISWRITKNKDKEHR-PIKVLGTVPSGLEDVGVAKIPEGL-LAKMA 397
            + +   +++IV   IS +     + +HR  I ++G     +++    K P      K+ 
Sbjct: 322 PDIL---LVVIVTILISMKF----NLKHRYGISIIGDF--SMDNFDELKNPLTRPRRKLI 372

Query: 398 PDI-PASIIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGATNLIGTFFNAYPATGS 453
           PD+  AS+IV +L   E    SKS G   +  V  ++EL+A+G  N++ + F A PA G 
Sbjct: 373 PDLFSASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPAFGG 432

Query: 454 FSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFFFIPSATLSAVIIHAVSDLLASYK 513
           + RS + A    ++  SGVF G   L+ +  L     +IP+  LS +       LL    
Sbjct: 433 YGRSKINALSGAQSVMSGVFMGVITLITMNLLLQFVHYIPNCVLSVITTIIGISLLEEVP 492

Query: 514 TTWNFWKMNPLDCCA------FIVTVLITVFSSIENGIYFAMCWSCAMLLLKHAFPAGQF 567
               F     L C        F VT   T+F SIE GI     +S   ++   A    Q 
Sbjct: 493 GDIKFH----LRCGGFSELFVFAVTFCTTIFYSIEAGICIGCVYSIINIIKHSAKSRIQI 548

Query: 568 LGRV 571
           L RV
Sbjct: 549 LARV 552

>Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGR213C
          Length = 689

 Score =  123 bits (308), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 133/537 (24%), Positives = 237/537 (44%), Gaps = 56/537 (10%)

Query: 82  STVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYADLVAGITVGCVLVP 141
           ST S++ Y    + + L LN+  SY+    PI+KWFP Y+      DL+AGI++    +P
Sbjct: 20  STPSLRSYRAIKVDQPLKLNTK-SYISYYLPILKWFPEYDRKKLGKDLLAGISLTAFQIP 78

Query: 142 QSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAQVSAKYP 201
            ++S + +A + P  GL+S  I   IY++F +   + +GP  V+SL   +     S K  
Sbjct: 79  FAISLSTMAHVSPYAGLFSLVIPPLIYAVFGSVPTMVVGPQTVVSLVVGQSCEAWSHK-- 136

Query: 202 ENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVAGFMTGSAFNILWGQ-V 260
             D +VT  VIA       G + + +GL R+GF+   IS   + GF+   A  +L  + +
Sbjct: 137 SVDSLVTVAVIACT----SGFILLSMGLFRMGFIDNAISKAFLRGFIFALAIMMLITELL 192

Query: 261 PALM---GYSSKV---NTRASTYKVVIDSLKHLPD------TKLDAV-FGLVPLCLLYLW 307
           P L     Y  +V   N   +T+      LK+ P+       KL  + F ++ +C  Y+ 
Sbjct: 193 PELQLEDLYRDEVAQGNAGTTTWDKFNFILKYGPEHADSFSMKLSFIAFSILMVC-KYVK 251

Query: 308 KWWCGTYGPKLADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNKDKEH 367
           K++    G KL                RF+          +++V     +    N     
Sbjct: 252 KYFTEKRGSKLC---------------RFF--------PDLLLVVAGFIYLSYYNDWSST 288

Query: 368 RPIKVLGTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLL---EHIAISKSFGRINDY 424
              +++G +P         K+P     +       S +V +L   +     K+ G   D 
Sbjct: 289 MGTRIIGNLPPNKNHF---KVPITSFKEFKELFDISFLVAILGLFDSATAFKAIGEKFDI 345

Query: 425 KVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYC 484
            +  ++EL+++G  N++ + F+A PA G + RS L   C  +TP +G+      +  +  
Sbjct: 346 DISSNRELVSLGLINVVSSVFSALPAFGGYGRSKLNILCSAQTPMAGIVVSVAAIFCMNY 405

Query: 485 LTDAFFFIPSATLSAVIIHAVSDLLASYKTTWNF-WKMNPL-DCCAFIVTVLITVFSSIE 542
           +  AF ++P   L+ +I +   +LL    +   F W +    +   F+  V+ T+  S +
Sbjct: 406 MMGAFHYLPLCVLAVIISYIAYNLLEEIPSDLFFYWSVGGYQELLTFVAVVVTTLVWSPQ 465

Query: 543 NGIYFAMCWSCAMLLLKHAFPAG-QFLGRVEVAEVINPTVVEDVEAISINDQIEGSV 598
            G+   +  +  + LLKH   +  Q LGR  V +       E  E I + ++IE ++
Sbjct: 466 FGVSIGVGLTM-IRLLKHTTQSRVQILGRDPVTKKFQNIYAEQSEQIPL-EEIEKTM 520

>CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]
           {ON} some similarities with uniprot|P53394 Saccharomyces
           cerevisiae YPR003c
          Length = 725

 Score =  122 bits (307), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 114/508 (22%), Positives = 219/508 (43%), Gaps = 59/508 (11%)

Query: 111 FPIVKWFPHYNLTWGYADLVAGITVGCVLVPQSMSYA-QIASLPPQYGLYSSFIGAFIYS 169
            P + W PHY+    + DLVAGI++    +P ++SYA  IA + P  GLYS  I   IY+
Sbjct: 74  LPCMSWIPHYSWEIFFGDLVAGISLASFQIPLALSYATSIAHVEPLCGLYSLAITPLIYA 133

Query: 170 LFATSKDVCIGPVAVMSLQTAKVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGL 229
           +F +   + +GP + +SL    V+ Q + K+  +D  ++   I   ++ + G+V   +G 
Sbjct: 134 IFGSVPQMIVGPESAISL----VVGQATEKFSAHDSEISTVTITMMITFISGVVLFFLGS 189

Query: 230 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPD 289
           +RLGFL  ++S   + GF++     ++   +   +  + K+   A  Y        H P 
Sbjct: 190 VRLGFLGNILSKALLRGFISSVGLVMIINSLIIELKLNHKLADVAGHY--------HTPV 241

Query: 290 TKLDAVFGLVPLCLLYLWKWWCGTYGPKLADRQL-------AHSPKKQRILKRFYFYSNA 342
            K           +++L+++    Y    A   L       +    K++++ R+ F    
Sbjct: 242 GK-----------IMFLFRYASEYYHKPTAILSLICFLVLISTRIAKKKLMNRYRFLIFV 290

Query: 343 MRNAVIIIVFTAISWRITKNKDKEHR-PIKVLGTVPS-GLEDVG--VAKIPEGLLAKMAP 398
                 I++  +++  ++   D +H   I  +G   + G   +G  ++     L + +  
Sbjct: 291 PE----ILLVVSVTILLSLKYDFKHSYGISTIGEFNADGFGSIGNPLSNENRALYSSLWN 346

Query: 399 DIPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGATNLIGTFFNAYPATGSFSRSA 458
           +  A  ++   E    SKS G   +     ++ELIA+G  N++G+ F A P+ G + RS 
Sbjct: 347 EGLAVAMLGFFESTTASKSLGSDYNLTYSSNRELIALGFMNIVGSLFGALPSFGGYGRSK 406

Query: 459 LKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFFFIPSATLSAVIIHAVSDLLASYKTTWNF 518
           +      +T  SG   G   L+    L     + P+  LS +       LL    +   F
Sbjct: 407 VNVFSGGKTVMSGAMVGLITLLTAKLLLPMIHYTPTCVLSVITTVIGISLLEEVPSDIKF 466

Query: 519 WKMNPLDCCA------FIVTVLITVFSSIENGIYFAMCWSCAMLLLKHAFPAGQFLGRVE 572
                + C        F +T + T+  S+E G+     +S  +++   A    Q L ++E
Sbjct: 467 H----IHCSGYSELTVFTLTFIATLSQSVELGVTVGCIYSLILIVKHSALSRIQILAKLE 522

Query: 573 VAEVINPTVVEDVEAISINDQIEGSVGK 600
            ++          E ++++D I+   G+
Sbjct: 523 GSD----------EFVNVDDYIKNYNGR 540

>TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa]
           {ON} Anc_8.99 YPR003C
          Length = 776

 Score =  121 bits (304), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 114/461 (24%), Positives = 201/461 (43%), Gaps = 34/461 (7%)

Query: 111 FPIVKWFPHYNLTWGYADLVAGITVGCVLVPQSMSYA-QIASLPPQYGLYSSFIGAFIYS 169
            P + W P+Y  T    DL+AGIT+    +P ++SYA  IA + P  GLY+  +  F Y+
Sbjct: 110 LPCLYWLPNYTRTILVGDLMAGITIASFQIPLALSYATSIAHVDPLSGLYALAVSPFFYA 169

Query: 170 LFATSKDVCIGPVAVMSLQTAKVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGL 229
           +F ++  + +GP   +SL   + +       P+ DPI    +I  A++L+ G + +  G+
Sbjct: 170 IFGSTPQMIVGPEGAISLVIGQCVQSCKKHNPDLDPI----LIVIAVTLISGTILLISGI 225

Query: 230 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPD 289
            RLG+L  +++   + GF+         G V  +M   S +N       ++ D+ +H   
Sbjct: 226 FRLGYLGNILNKALLHGFI---------GSVGFVMIIDSLIN-ELKLGDILADTPEHYNT 275

Query: 290 TKLDAVFGLVPLCLLYLWKWWCGTYG--PKLADRQLAHSPKKQRILKRFYFYSNAMRNAV 347
             L  VF         LWK+    +     L            R  K+   + +     +
Sbjct: 276 PFLKIVF---------LWKYAFQNFHVPTTLISFISIIILLIVRAFKKVLMHRHRWLIFI 326

Query: 348 --IIIVFTAISWRITKNKDKEHRPIKVLGTVPSGLEDV---GVAKIPEGLLAKMAPDIPA 402
             I+IV T +     K    +   I +LG   S    +    ++    GL+  +      
Sbjct: 327 PEILIVLTTVLILSYKLDFADTYDIDILGDFKSNENSIFHNPLSNKNRGLIHVVFNIGII 386

Query: 403 SIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAK 462
           + I    E    SK+ G  ++  V  ++EL+A+G +N++ +   A P+ G + RS + A 
Sbjct: 387 TAIFGFFESTTASKALGASSERSVSSNRELVALGLSNIVISTLGALPSFGGYGRSKINAL 446

Query: 463 CEVRTPFSGVFTGCCVLVAIYCLTDAFFFIPSATLSAVIIHAVSDLLASYKTTWNF-WKM 521
              +T  SGVF G   ++AI  L     +IP   LS +       LL       +F W+ 
Sbjct: 447 SGGKTLLSGVFMGLTTILAILFLMPVIHYIPVCILSVITTVIGFTLLEEIPKEVSFHWRC 506

Query: 522 NPLDCCAFIV-TVLITVFSSIENGIYFAMCWSCAMLLLKHA 561
              +    IV T + ++F S+E  +Y    +S  + ++KH+
Sbjct: 507 RGYNELFLIVLTFMTSIFYSVETSMYIGCVYSI-LNIIKHS 546

>ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 735

 Score =  120 bits (302), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 127/485 (26%), Positives = 210/485 (43%), Gaps = 59/485 (12%)

Query: 111 FPIVKWFPHYNLTWGYADLVAGITVGCVLVPQSMSYA-QIASLPPQYGLYSSFIGAFIYS 169
            P   W P+YN++    DL+AG+++    +P ++S+A  +A + P  GLYS     FIY+
Sbjct: 90  LPFFSWLPNYNISKCIGDLIAGVSLASFQIPLALSFATSVAHVEPLCGLYSLAFTPFIYA 149

Query: 170 LFATSKDVCIGPVAVMSLQTAKVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGL 229
           +  +   + +GP + +SL    V+ Q   K   ++P +    ++  ++ + G      GL
Sbjct: 150 ILGSVPQMIVGPESAISL----VVGQAVEKMISHNPDLHTLQLSAVITFISGGFLFFFGL 205

Query: 230 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYSSKVNTRASTYKVVIDS-LKHLP 288
            RLGFL  ++S   + GF++              +G    +N+  S +K  +D  LK LP
Sbjct: 206 CRLGFLGNVLSRALLRGFISS-------------VGLVMIINSMISEFK--LDKILKDLP 250

Query: 289 ---DTKLDAVFGLVPLCLLYLWKWWCGTY-GPKLADRQ-------LAHSPKKQRILK-RF 336
               T  + +        L+L  +    Y GP  A          +    KK+ + + R+
Sbjct: 251 VHYHTPFEKI--------LFLVTYAPNNYHGPTTALSLSCFFILIMTKIIKKKLMPRCRW 302

Query: 337 YFYSNAMRNAVIIIVFTAISWRITKNKDKEHRPIKVLGTVPSGLEDVGVAKIPEGLLAKM 396
             +   +   +I  +F +I +R      K +  I  +G         G+ K+   L A+ 
Sbjct: 303 IVFVPDILLLIIGTIFLSIKYRF-----KHNYSISTVG----DFNTKGLDKLLNPLSAEN 353

Query: 397 APDIP----ASIIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGATNLIGTFFNAYP 449
              IP    A  I  +L   E    SKS G   D  +  ++EL+A+G+ NL  +   + P
Sbjct: 354 RGLIPQLLSAGFITAMLGFFESTTASKSLGSSYDLAISSNRELVALGSMNLFSSILGSLP 413

Query: 450 ATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFFFIPSATLSAVIIHAVSDLL 509
           A G + RS + A    +T  SG F G  VL+ I  L     +IP   LS V       LL
Sbjct: 414 AFGGYGRSKINAFSGAQTVMSGAFMGLLVLLTIKFLLPMIHYIPICVLSVVTTMVGISLL 473

Query: 510 --ASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIYFAMCWSCAMLLLKHAFPAGQF 567
             A     ++F      +   F +TVL T+F S+E GI     +S   ++   A    Q 
Sbjct: 474 EEAPADLMFHFRCFGYDELLVFTLTVLTTMFYSVEVGICIGCGYSVISIIKHSAKSRIQI 533

Query: 568 LGRVE 572
           L RV+
Sbjct: 534 LARVQ 538

>Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {ON}
           YPR003C (REAL)
          Length = 742

 Score =  120 bits (302), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 115/482 (23%), Positives = 210/482 (43%), Gaps = 55/482 (11%)

Query: 111 FPIVKWFPHYNLTWGYADLVAGITVGCVLVPQSMSYA-QIASLPPQYGLYSSFIGAFIYS 169
            P   W P Y     + D++AGI++    +P ++SY   IA +PP  GLYS  I  F+Y 
Sbjct: 95  LPCFSWLPEYTFNKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 154

Query: 170 LFATSKDVCIGPVAVMSLQTAKVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGL 229
           +  +   + +GP + +SL   + +  ++  + +N  ++   ++ T +S   G + +  G+
Sbjct: 155 ILGSVPQMIVGPESAISLVVGQAVESITL-HKDNVSLIDISIVITFVS---GAILLFSGI 210

Query: 230 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPD 289
            R GFL  ++S   + GF++     ++   + + +     + +    Y    + +  L D
Sbjct: 211 SRFGFLGNVLSKALLRGFISSVGLVMIINSLVSELKLDKFLVSLPQHYHTPFEKVLFLID 270

Query: 290 ------TKLDAVFGLVPLCLLYLWKWWCGTYGPKLADRQLAHSPKKQRILKRF---YFYS 340
                  K  A+F      +L + +                    K++++KR     F+ 
Sbjct: 271 YAPAQYHKPTAIFSGCCFIILIVMRLL------------------KKKLMKRHKSAVFFP 312

Query: 341 NAMRNAVIIIVFTAISWRITKNKDKEHRPIKVLGTVPSGLEDVGVAKIP-EGLLAKMAPD 399
           + +   +++IV   IS +++    K+   I ++G     +++    K P      K+ PD
Sbjct: 313 DIL---LVVIVTILISMKLSL---KQRYGISIVGDF--SMDNFDKLKNPLTHSRRKLMPD 364

Query: 400 I-PASIIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGATNLIGTFFNAYPATGSFS 455
           +  AS+IV +L   E    SKS G   +  V  ++EL+A+G  N+  + F A P+ G + 
Sbjct: 365 LFSASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGCINMFISLFGALPSFGGYG 424

Query: 456 RSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFFFIPSATLSAVIIHAVSDLLASYKTT 515
           RS + A    ++  SGVF G   L+ +  L     +IP+  LS +       LL      
Sbjct: 425 RSKINALSGAQSVMSGVFVGIITLITMKLLLQFVHYIPNCVLSVITTVIGISLLEEVPGD 484

Query: 516 WNFWKMNPLDCCA------FIVTVLITVFSSIENGIYFAMCWSCAMLLLKHAFPAGQFLG 569
             F     L C        F VT  +T+F SIE+GI     +S   ++   A    Q L 
Sbjct: 485 IKFH----LQCGGYSELFVFAVTFGVTIFYSIESGICIGCVYSILNIIKHSAKSRIQILA 540

Query: 570 RV 571
           R+
Sbjct: 541 RI 542

>NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {ON}
           Anc_8.99
          Length = 724

 Score =  120 bits (301), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 117/477 (24%), Positives = 203/477 (42%), Gaps = 45/477 (9%)

Query: 111 FPIVKWFPHYNLTWGYADLVAGITVGCVLVPQSMSYA-QIASLPPQYGLYSSFIGAFIYS 169
            P   W P Y L     D++AGIT+    +P ++SYA  +A + P  GLYS  I  F+Y 
Sbjct: 81  LPCFSWLPDYTLKKFGGDMIAGITLASFQIPLALSYATSLAHVEPLCGLYSLAITPFVYC 140

Query: 170 LFATSKDVCIGPVAVMSLQTAKVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGL 229
           +F +   + +GP + +SL    V+ Q   K   ++  V    I+  ++ L G + +  G+
Sbjct: 141 VFGSVPQMIVGPESAISL----VVGQAVEKLVTHNEKVGTINISVVVTFLSGAILLIFGI 196

Query: 230 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHL-- 287
            RLGFL  ++S   + GF++     ++   +   +  +  + T    Y    + ++ L  
Sbjct: 197 TRLGFLGNILSRALLRGFISSVGLVMVINSLITELKLTKLLATVPEHYHTPFEKVQFLFK 256

Query: 288 --PDT--KLDAVFGLVPLCLLYLWKWWCGTYGPKLADRQLAHSPKKQRILKRFYFYSNAM 343
             P+   K  A+  L    +L   ++                   K++++KR  + S   
Sbjct: 257 YGPENLHKPTAILSLCSFIILMTLRFL------------------KKKLMKR--YKSVIF 296

Query: 344 RNAVIIIVFTAISWRITKNKDKEHRPIKVLGTVP-SGLEDVG--VAKIPEGLLAKMAPDI 400
              +++IV +++   +  N  K+   I +LG    SG + +   + K    L  ++    
Sbjct: 297 FPEILLIVISSLIISVNFNLKKDFD-ISMLGDFSTSGFDKLNNPLGKDNRSLCHELLSVG 355

Query: 401 PASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALK 460
               I+   E    SKS G I D  +  ++EL+A+G+ NL+G+ F A P+ G + RS + 
Sbjct: 356 LMCAILGFFESTTASKSLGTIYDLTISSNRELVALGSMNLVGSLFGALPSFGGYGRSKIN 415

Query: 461 AKCEVRTPFSGVFTGCCVLVAIYCLTDAFFFIPSATLSAVIIHAVSDLLASYKTTWNFWK 520
           A    +T  SG   G   L  I  L     + P   LS +       LL    +   F  
Sbjct: 416 ALSGAQTVMSGACMGLITLFTIKFLLPVIHYTPLCILSVITTVVGLSLLEEAPSDIRFH- 474

Query: 521 MNPLDCCAF---IVTVLI---TVFSSIENGIYFAMCWSCAMLLLKHAFPAGQFLGRV 571
              + C  +   I+  LI   T+  S+E GI     +S   ++   A    Q L RV
Sbjct: 475 ---IRCHGYNELIIFTLIFVTTIIHSVEAGISVGCIYSIGSIIKHSAQSRIQILTRV 528

>Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {ON}
           YPR003C (REAL)
          Length = 744

 Score =  117 bits (294), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 118/484 (24%), Positives = 206/484 (42%), Gaps = 59/484 (12%)

Query: 111 FPIVKWFPHYNLTWGYADLVAGITVGCVLVPQSMSYA-QIASLPPQYGLYSSFIGAFIYS 169
            P   W P Y  +  + D++AGI++    +P ++SY   IA +PP  GLYS  I  F+Y 
Sbjct: 95  LPCFAWLPEYTFSKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 154

Query: 170 LFATSKDVCIGPVAVMSLQTAKVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGL 229
           +F +   + +GP + +SL   + +  ++  + +N  ++   ++ T +S   G + +  G+
Sbjct: 155 VFGSVPQMIVGPESAISLVVGQAVESITL-HKDNVSLIDISIVITFVS---GAILLFSGI 210

Query: 230 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPA-------LMGYSSKVNTRASTYKVVID 282
            R GFL  ++S   + GF++     ++   + +       L+      +T       +ID
Sbjct: 211 SRFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKFLVSLPQHYHTPFEKILFLID 270

Query: 283 ---SLKHLPDTKLDAVFGLVPLCLLYLWKWWCGTYGPKLADRQLAHSPKKQRILKRFYFY 339
              +  H+P     A+F     CL+ L+             +     P            
Sbjct: 271 YAPAQYHMP----TAIFS--GCCLIILFLMRLLKRKLLKYHKGAIFFPD----------- 313

Query: 340 SNAMRNAVIIIVFTAISWRITKNKDKEHR-PIKVLGTVPSGLEDVGVAKIP-EGLLAKMA 397
                    I++   ++  I+   D +HR  I ++G     +++    K P      K+ 
Sbjct: 314 ---------ILLVVIVTILISMKFDLKHRYGITIVGDF--SMDNFDKLKNPLTRSRRKLI 362

Query: 398 PDI-PASIIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGATNLIGTFFNAYPATGS 453
           PD+  AS+IV +L   E    SKS G   +  V  ++EL+A+G  N++ + F A P+ G 
Sbjct: 363 PDLFSASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPSFGG 422

Query: 454 FSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFFFIPSATLSAVIIHAVSDLLASYK 513
           + RS + A    ++  SGVF G   L+ +  L     +IP+  LS +       LL    
Sbjct: 423 YGRSKINALSGAQSVISGVFVGVITLITMNLLLQFVHYIPNCVLSVITTVIGISLLEEVP 482

Query: 514 TTWNFWKMNPLDCCA------FIVTVLITVFSSIENGIYFAMCWSCAMLLLKHAFPAGQF 567
           +   F     L C        F VT  +T+F SIE GI     +S   ++   A    Q 
Sbjct: 483 SDIKFH----LRCGGYSELFVFAVTFGVTIFYSIEAGICIGCVYSILNIIKHSAKSRIQI 538

Query: 568 LGRV 571
           L RV
Sbjct: 539 LARV 542

>TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {ON}
           Anc_8.99 YPR003C
          Length = 787

 Score =  117 bits (292), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 113/482 (23%), Positives = 206/482 (42%), Gaps = 44/482 (9%)

Query: 111 FPIVKWFPHYNLTWGYADLVAGITVGCVLVPQSMSYA-QIASLPPQYGLYSSFIGAFIYS 169
            P ++W P YN +  ++D ++GI++    +P ++SYA  IA + P  GLYS  I   IY 
Sbjct: 114 LPCLRWLPIYNCSDFFSDCISGISLASFQIPLALSYATSIAHVKPLCGLYSLAITPVIYG 173

Query: 170 LFATSKDVCIGPVAVMSLQTAKVIAQVSAKY---PENDPIVTAPVIATALSLLCGIVAIG 226
           +  +   + +GP   +SL   + + ++   Y    + D  ++   I+  ++ L G+V   
Sbjct: 174 ILGSVPPMIVGPEGAISLVVGQAVDKLHGSYNLSSQEDDHISRMNISVTITFLSGLVLFI 233

Query: 227 VGLLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYSSKV--NTRA--STYKVVID 282
            GLLRLGFL  ++S   +  F++     ++   +   M  +  +  N R   + ++ ++ 
Sbjct: 234 CGLLRLGFLGSVLSKPLLRSFISSVGGVMVIDALITEMKLNCILIDNDRHYHTAFEKIMF 293

Query: 283 SLKHLPDT--KLDAVFGLVPLCLLYLWKWWCGTYGPKLADRQLAHSPKKQRILKRFYFYS 340
            +K+ P+   K   V  +V   +LY  ++                  KK+ I+K    + 
Sbjct: 294 IIKYAPNNFHKPTTVLSVVCFSILYFVRYC-----------------KKKYIIK----HK 332

Query: 341 NAMRNAVIIIVFTAISWRITKNKDKEHRPIKVLGTVPSGLEDVGVAKIPEGLLAKMAPDI 400
           + +    I+IV  +          K++  I ++G V S   ++    +   L +      
Sbjct: 333 SLIFLPEILIVVISTGILSASYNFKDNYGISIIGDVNSNNSNLIAGNLQNPLSSSNKELF 392

Query: 401 P-------ASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGATNLIGTFFNAYPATGS 453
           P       A   +   E    SKS G   +  +  ++EL+A+G  NL  +     P+ G 
Sbjct: 393 PILMNTGFAIAALGFFESTTASKSLGTKFELSISSNRELVALGVMNLTASLLGGLPSFGG 452

Query: 454 FSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFFFIPSATLSAVI----IHAVSDLL 509
           + RS + A    +T  SGV  G   ++ I  L +   FIP+  LS +     +  + +  
Sbjct: 453 YGRSKINAFSGAKTVMSGVVMGGITVLTIKFLLNYIHFIPTCVLSVITTIVGLSLIEEAP 512

Query: 510 ASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIYFAMCWSCAMLLLKHAFPAGQFLG 569
              K  W     N L    F +T   T+F S+E GI     +S   ++   A    Q LG
Sbjct: 513 GEVKFHWRCKGYNEL--IIFFMTACGTIFFSVEVGIIIGCSYSIISIIKFSAKSRIQILG 570

Query: 570 RV 571
           R+
Sbjct: 571 RI 572

>Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {ON}
           YPR003C - Hypothetical ORF [contig 31] FULL
          Length = 726

 Score =  116 bits (290), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 124/488 (25%), Positives = 208/488 (42%), Gaps = 36/488 (7%)

Query: 95  REKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYADLVAGITVGCVLVPQSMSYA-QIASLP 153
           R+++ L       Y L P   W P Y+ T    DL+AG ++    +P +MSY+  +A +P
Sbjct: 70  RDEIQLTMWHRLTYYL-PCFSWLPTYDATKFIGDLIAGASLASFQIPLAMSYSTSVAHVP 128

Query: 154 PQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAQVSAKYPENDPIVTAPVIA 213
           P  GL +      +Y++F +   + +GP + +SL    V+ Q   K  ++D  +    + 
Sbjct: 129 PICGLNALAFTPLVYAVFGSVPHMIVGPESAISL----VVGQAIEKLTKHDASLNVTNLC 184

Query: 214 TALSLLCGIVAIGVGLLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYSSKVNTR 273
             L+ + G +    GL+R GFL  ++S   + GF++              +G    +N+ 
Sbjct: 185 VVLTFISGSILFSFGLMRFGFLDSVLSRALLRGFISA-------------VGLIMVINSL 231

Query: 274 ASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYLWKWWCGTYGPKLADRQLAHSPKKQRIL 333
            S  K+  D+ K+ P     A F  V    ++L  +    Y    A   L        + 
Sbjct: 232 ISELKLK-DTFKNAPG-HYHAPFQKV----VFLVHYAPANYHLPTALVSLVCFAALGALK 285

Query: 334 KRFYFYSNAMRNAVI---IIVFTAISWRITKNKDKEHR-PIKVLGTVPSGLEDVGVAKIP 389
                     +  +    I+V  A +  ++   D + R  I ++G + +G  +     I 
Sbjct: 286 VIKKKLVKRFKKVIFFPDILVVVAFATLVSYCYDFKVRYNIDIVGDIETGSSNTIKNPIS 345

Query: 390 EGLLAKMAPDIPASIIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGATNLIGTFFN 446
           +  L        A  +V LL   E    SKS G   D  +  ++EL+A+G+ NL+G+ F 
Sbjct: 346 KDNLKLFNDLFHAGFLVALLGFFESTTASKSLGTNYDLAISSNRELVALGSLNLVGSLFG 405

Query: 447 AYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFFFIPSATLSAVIIHAVS 506
           A P+ G + RS + A     T  SGVF G   L+    L +A   IP   LS +      
Sbjct: 406 ALPSFGGYGRSKINAYSGAATVMSGVFMGLITLITSKFLLNAIRHIPICVLSVITTMVGI 465

Query: 507 DLL--ASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIYFAMCWSCAMLLLKHAFPA 564
            L   A     ++F      +   F +TVL T F S+E GI    C    +  +K++  +
Sbjct: 466 SLFEEAPADLKFHFRCRGYNELLTFAITVLTTFFYSVEAGITLG-CGYSIIRAIKNSTQS 524

Query: 565 G-QFLGRV 571
           G Q LGR+
Sbjct: 525 GIQILGRI 532

>Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON}
           (26194..28428) [2235 nt, 745 aa]
          Length = 744

 Score =  115 bits (287), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 129/510 (25%), Positives = 220/510 (43%), Gaps = 53/510 (10%)

Query: 111 FPIVKWFPHYNLTWGYADLVAGITVGCVLVPQSMSYA-QIASLPPQYGLYSSFIGAFIYS 169
            P   W P Y      +D +AGI++    +P ++SYA  IA + P  GLYS  I  FIY+
Sbjct: 89  LPCFSWIPQYTWFKLISDFLAGISLASFQIPLALSYATSIAHVEPLCGLYSLAITPFIYA 148

Query: 170 LFATSKDVCIGPVAVMSLQTAKVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGL 229
           +F +   + +GP + +SL    V+ Q       +D  +    I+  L+ + G   + +G+
Sbjct: 149 VFGSVPQMIVGPESAISL----VVGQSVELLKSHDSALEIINISVVLTFISGAALLILGI 204

Query: 230 LRLGFLVELISLNAVAGFMTGSAFNILWGQV-------PALMGYSSKVNTRASTYKVVID 282
           LRLGFL  ++S + + GF++     ++   +         L G     +T     + +I 
Sbjct: 205 LRLGFLGNVLSRSLLRGFISSIGLVMIIDSLITELKLNKLLAGLKVHCHTSFEKVQFLIK 264

Query: 283 ---SLKHLPDTKLDAVFGLVPLCLLYLWKWWCGTYGPKLADRQLAHSPKKQRILKRFYFY 339
              +  H P   L A+  +    +  L K W   +      R LA  P+           
Sbjct: 265 YAPTNYHKPTALLSAIAFVTLFSIRLLKKRWMAKH------RWLAFIPE----------- 307

Query: 340 SNAMRNAVIIIVFTAISWRITKNKDKEHRPIKVLGTVPSGLEDVGVAKIPEGLLAKMAPD 399
              +   VII ++ + +W       K+   I ++G   +   D     I +     M   
Sbjct: 308 ---ILMVVIISIYLSATWEF-----KKQYGILIVGDFNTHAIDKLKNPISKENRKIMPQL 359

Query: 400 IPASIIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGATNLIGTFFNAYPATGSFSR 456
           +   +++ LL   E +  SKS G   D  +  ++EL+A+G+ N+I + F A P+ G + R
Sbjct: 360 LNTGVLISLLGFFESMTASKSLGTTYDLAISSNRELVALGSMNVIASLFGALPSFGGYGR 419

Query: 457 SALKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFFFIPSATLSAVIIHAVSDLL--ASYKT 514
           S + A    +T  SGVF G   L+ I  L     +IP   LS +       LL  A  + 
Sbjct: 420 SKINAFSGSKTVMSGVFMGSVTLITIRYLLPLIHYIPLCILSVITSIVGISLLEEAPSEL 479

Query: 515 TWNFWKMNPLDCCAFIVTVLITVFSSIENGIYFAMCWSCAMLLLKHAFPAGQFLGRVE-- 572
            ++F      +   F +TVL T+  S+E GI     +S   ++   A    Q LGRV+  
Sbjct: 480 KFHFRCKGYDELFVFAITVLATLLYSVEMGICIGCGYSIISIVKHSAKSRIQILGRVQGT 539

Query: 573 -----VAEVINPTVVEDVEAIS-INDQIEG 596
                + E ++   + D+E    + ++IEG
Sbjct: 540 REFANIDEYLDSDPIGDIETNKFVLEEIEG 569

>KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 706

 Score =  113 bits (282), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 145/546 (26%), Positives = 236/546 (43%), Gaps = 76/546 (13%)

Query: 78  GFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYADLVAGITVGC 137
           G + STVS  +       E++TL     Y     P   W P Y++     D +AG+++  
Sbjct: 50  GLKFSTVSFPE------NERVTLKDTIPY---YLPCFSWIPTYSVKKCMGDFIAGLSLAS 100

Query: 138 VLVPQSMSYA-QIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAQV 196
             +P +MSYA  +A +PP  GLYS      +Y++  +   + +GP + +SL    ++ Q 
Sbjct: 101 FQIPLAMSYATSVAHVPPLCGLYSLVFSPAVYTVLGSVPQMIVGPESAISL----ILGQA 156

Query: 197 SAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVAGFMTGSAFNIL 256
                  DP + A  I   ++ + G+V +  GLLRLGFL  ++S   + GF++G    ++
Sbjct: 157 IEARLSEDPKLKAINICLVITFISGLVLLTGGLLRLGFLENVLSRALLRGFISGVGVIMV 216

Query: 257 WGQVPALMGYSSKVNTRA----STYKVVIDSLKHLPDT--KLDAVFGLVPLCLLYLWKWW 310
              +   +  +    TR     S ++ V+  +K+ P+   K  A+  LV   +L   + +
Sbjct: 217 ITSLVVELKLNHVTPTRQEHYHSPFEKVLFIMKYGPENYHKPTAILSLVAFVILMSLRIF 276

Query: 311 CGTYGPKLADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRIT-KNKDKEHRP 369
              YG K   + L   P                     I+V  A+S  ++ K   K    
Sbjct: 277 KKRYGKKF--KWLVLLPD--------------------ILVVVALSIFVSYKMHLKSRYG 314

Query: 370 IKVLGTVP--------SGLEDVGVAKIPE----GLLAKMAPDIPASIIVLLLEHIAISKS 417
           I+++  +P        +   +V VA   +    G +  M         +   E    SKS
Sbjct: 315 IEIINDIPKDSMKHLKNPFSNVNVATFKDLFSTGFMVAM---------LGFFESATASKS 365

Query: 418 FGRINDYKVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCC 477
            G   +  +  ++ELIA+G+ N++G+ F   PA G + RS + A    +T  SG F G  
Sbjct: 366 LGTSYNLAISSNRELIALGSMNVVGSMFAILPAFGGYGRSKINAYSGAQTTMSGFFMGLV 425

Query: 478 VLVAIYCLTDAFFFIPSATLSAVIIHAVSDLLASYKTTWNF-WKMNPL-DCCAFIVTVLI 535
            L  I  L     +IP   LS +       LL        F W+     +   F VT+L 
Sbjct: 426 TLFTIQFLLPIIRYIPVCILSVITTVVGLTLLEEAPHDLKFHWRCKGYSELTVFTVTLLA 485

Query: 536 TVFSSIENGIYFAMCWSCAMLLLKHAFPAG-QFLGRVEVAEV-INPTVVEDVEAIS---- 589
           T+F S+E GIY   C    + ++KH+  +  Q LGRV   E  IN    +D +A +    
Sbjct: 486 TLFYSLEAGIYIG-CACSIINVIKHSAKSRIQILGRVPGTETFIN---ADDYQANAAGYF 541

Query: 590 INDQIE 595
           IN QIE
Sbjct: 542 INPQIE 547

>Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {ON}
           YPR003C (REAL)
          Length = 745

 Score =  113 bits (282), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 114/479 (23%), Positives = 200/479 (41%), Gaps = 49/479 (10%)

Query: 111 FPIVKWFPHYNLTWGYADLVAGITVGCVLVPQSMSYA-QIASLPPQYGLYSSFIGAFIYS 169
            P   W P Y     + D++AGI++    +P ++SY   IA +PP  GLYS  I  F+Y 
Sbjct: 95  LPCFSWLPEYTFNKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 154

Query: 170 LFATSKDVCIGPVAVMSLQTAKVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGL 229
           +  +   + +GP + +SL   + +  ++  + +N  ++   V+ T +S   G + +  G+
Sbjct: 155 ILGSVPQMIVGPESAISLVVGQAVESITL-HKDNVSLIDISVVITFVS---GAILLFSGI 210

Query: 230 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPD 289
            R GFL  ++S   + GF++     ++   + + +     + +    Y    + +  L D
Sbjct: 211 SRFGFLGNVLSKALLRGFISSVGLVMIINALISELKLDKFLLSLPQHYHTPFEKVLFLID 270

Query: 290 ------TKLDAVFGLVPLCLLYLWKWWCGTYGPKLADRQLAHSPKKQRILKRFYFYSNAM 343
                  K  A+F     CL+ L+             +     P    +           
Sbjct: 271 YAPAQYHKPTAIFS--GCCLIVLFSMRLLKKKLVKHHKSAIFFPDILLV----------- 317

Query: 344 RNAVIIIVFTAISWRITKNKDKEHRPIKVLGTVPSGLEDVGVAKIP-EGLLAKMAPDI-P 401
              VI+ +F ++ + +     K    I ++G     +++    K P      K+ PD+  
Sbjct: 318 ---VIVAIFISMKFSL-----KHRYGITIIGDF--SMDNFDKLKNPFTHSRRKLIPDLFS 367

Query: 402 ASIIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGATNLIGTFFNAYPATGSFSRSA 458
           AS+IV +L   E    SKS G   +  V  ++EL+A+G  N++ + F A P+ G + RS 
Sbjct: 368 ASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPSFGGYGRSK 427

Query: 459 LKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFFFIPSATLSAVIIHAVSDLLASYKTTWNF 518
           + A    ++  SGVF G   L+ +  L     +IP+  LS +       LL        F
Sbjct: 428 INALSGAQSVMSGVFVGIITLITMNLLLQFVHYIPNCVLSVITTVIGISLLEEVPGDIKF 487

Query: 519 WKMNPLDCCA------FIVTVLITVFSSIENGIYFAMCWSCAMLLLKHAFPAGQFLGRV 571
                L C        F VT  +T+  SIE GI     +S   ++   A    Q L RV
Sbjct: 488 H----LRCGGYSELFVFAVTFGVTILCSIEAGICIGCVYSILNIIKHSAKSRIQILARV 542

>AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR003C
          Length = 689

 Score =  113 bits (282), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 123/541 (22%), Positives = 238/541 (43%), Gaps = 62/541 (11%)

Query: 81  ESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYA--DLVAGITVGCV 138
            ST+S++ Y    + + L  +   SYV    PI++W P Y  +WG    D++AG+T+   
Sbjct: 19  SSTMSLRSYRAIKVDKPLR-HDTKSYVSYYLPILRWLPEY--SWGKMAKDMLAGLTLTSF 75

Query: 139 LVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAQVSA 198
            +P ++S   +A + P  GLY+  I   IY++F +   + +GP  V SL    V+ Q   
Sbjct: 76  QIPLAISLTTMAHVSPYAGLYALVIPPLIYAVFGSVPTMVVGPQTVASL----VVGQSCD 131

Query: 199 KYPEN--DPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVAGFMTGSAFNIL 256
            +     +P++T  VI      + G++   +G+ RLGF+   IS   + GF +  A  +L
Sbjct: 132 AWAHKSLEPLMTVAVIGC----ISGVLVFAMGIFRLGFIDNAISKAFLKGFTSALAVVML 187

Query: 257 WGQVPALMGYSSKVNTRASTYKV-------VIDSLKHLPD------TKLDAVFGLVPLCL 303
             ++   +    +        KV       ++ +L++  +       KL      + L  
Sbjct: 188 ITELLPQLQIDDRYKQALKEGKVGSAAWDKLVFALENAREYSNPFSVKLSVAAFSILLLS 247

Query: 304 LYLWKWWCGTYGPKLADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNK 363
            YL K+    YG                   +  F+ +     ++++V  +I      + 
Sbjct: 248 KYLKKYLTAKYG-----------------WTKLTFFPD-----LLLVVLGSILLSFYYDW 285

Query: 364 DKEHRPIKVLGTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRIN- 422
           D ++  + ++G +P   + +   K+P     +      AS +V +L     + +F  I+ 
Sbjct: 286 DNKYN-LPIVGDLPPNKDHI---KVPIQSFQEFKDLFDASFLVAILGLFESATAFKSISA 341

Query: 423 --DYKVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLV 480
             D  V  ++EL+++G  N++G+ F++ PA G + RS L   C  +TP +G+F     + 
Sbjct: 342 TFDIDVSSNRELVSLGLINIVGSVFSSLPAFGGYGRSKLNIFCGAQTPMAGIFVSLSAIF 401

Query: 481 AIYCLTDAFFFIPSATLSAVIIHAVSDLLASYK-TTWNFWKMNPL-DCCAFIVTVLITVF 538
            +  L   F ++P   L+ +I     +LL       + +W ++   +   F   VL T+ 
Sbjct: 402 CMRFLMGVFHYLPLCILAVIISFIAYNLLEEVPGDMFFYWSVSGYQELITFSAVVLSTLI 461

Query: 539 SSIENGIYFAMCWSCAMLLLKHAFPAG-QFLGRVEVAEVINPTVVEDVEAISINDQIEGS 597
            S + G+   +  +  + LLKH   +  Q LG+  + +       E  E I + ++IE +
Sbjct: 462 WSPQFGLVMGLGLTM-IRLLKHTTQSRIQILGKDPITKKFRNIYSEHNEEIPL-EEIEKT 519

Query: 598 V 598
           +
Sbjct: 520 M 520

>KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]
           {ON} similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 710

 Score =  112 bits (281), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 113/471 (23%), Positives = 193/471 (40%), Gaps = 33/471 (7%)

Query: 111 FPIVKWFPHYNLTWGYADLVAGITVGCVLVPQSMSYA-QIASLPPQYGLYSSFIGAFIYS 169
            P   W P Y+ +    D +AG ++    +P +MSY+  +A +PP  GL +     F+Y+
Sbjct: 70  LPCFSWLPTYDTSKLLRDFIAGASLASFQIPLAMSYSTSVAHVPPICGLNALAFTPFVYA 129

Query: 170 LFATSKDVCIGPVAVMSLQTAKVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGL 229
           +F +   + +GP + +SL    V+ Q   K  ++D  +    +   L+ + G +    G+
Sbjct: 130 VFGSVPHMIVGPESAISL----VVGQAIEKQMKHDKSLDVVNLCLILTFISGAILFCFGI 185

Query: 230 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPD 289
           +R G+L  ++S   + GF++     ++   +   +      N     Y        H P 
Sbjct: 186 MRFGYLDSVLSRALLRGFISAVGLVMVLNSLITELKLKKVFNDAPGHY--------HAPF 237

Query: 290 TKLDAVFGLVPLCLLYLWKWWCGTYGPKLADRQLAHSPKKQ--RILKRFY--FYSNAMRN 345
            KL           ++L+ +  G Y    A   L+        R++K+     Y   +  
Sbjct: 238 QKL-----------IFLFHYAPGNYHVPTALLSLSSFSILMSLRLVKKRLSRVYKKVIFV 286

Query: 346 AVIIIVFTAISWRITKNKDKEHRPIKVLGTVPSGLEDVGVAKIPEGLLAKMAPDIPASII 405
             I+IV   ++        K    I ++G +  G        + +  L+  +    A  +
Sbjct: 287 PEILIVVALVTLGSYHFSFKLRYNIDIVGDIEVGDTSKFRNPLSKKNLSLFSELFHAGFM 346

Query: 406 VLLL---EHIAISKSFGRINDYKVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAK 462
           V LL   E    SKS G   +  V  ++EL+A+G+ NL+G+ F A P+ G + RS + A 
Sbjct: 347 VALLGFFESTTASKSLGSSYELSVSSNRELVALGSLNLVGSIFGALPSFGGYGRSKINAY 406

Query: 463 CEVRTPFSGVFTGCCVLVAIYCLTDAFFFIPSATLSAVIIHAVSDLL--ASYKTTWNFWK 520
               T  SGVF G    V    L +A   IP   LS +       L   A     ++F  
Sbjct: 407 SGAATVMSGVFMGLITCVTSMFLLNAIHHIPVCVLSVITTMVGITLFEEAPADLRYHFRC 466

Query: 521 MNPLDCCAFIVTVLITVFSSIENGIYFAMCWSCAMLLLKHAFPAGQFLGRV 571
               +   F +TVL T F S+E GI     +S   ++        Q L RV
Sbjct: 467 RGYNELLIFALTVLTTFFYSVEAGITLGCGYSVIRVIKNSTKSKIQILRRV 517

>SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} similar
           to uniprot|Q74ZI9 Ashbya gossypii AGR213C AGR213Cp and
           weakly similar to YPR003C uniprot|P53394 Saccharomyces
           cerevisiae YPR003C Hypothetical ORF
          Length = 620

 Score =  103 bits (257), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 106/444 (23%), Positives = 188/444 (42%), Gaps = 44/444 (9%)

Query: 142 QSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAQVSAKYP 201
            S+S + +A LPP  GLYS  I   IY +  T     +GP  V+SL   +     S +  
Sbjct: 1   MSISLSTLAHLPPSTGLYSLVIPPLIYCILGTVPTTVVGPQTVVSLVVGQSCEWWSHRSL 60

Query: 202 ENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVAGFMTGSAFNIL----W 257
           E  P+ T  VI      + G +   +G+ R+GF+   +S   + GF++  A  +L     
Sbjct: 61  E--PLSTVAVIGC----VSGGILFAMGVFRMGFIDNALSKAFLRGFVSSLALVMLITELL 114

Query: 258 GQVPALMGYSSKV------NTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYLWKWWC 311
            ++     Y+  V       T    ++ +++      DT              + W    
Sbjct: 115 PELKLEELYAHYVAQGYIGTTTWEKFRFILEKAPENSDT--------------FTWNLSL 160

Query: 312 GTYGPKLADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNKDKEHRPIK 371
            T+   +  R L     ++   K+  F+       ++I+V  +I+   T+ K  E + IK
Sbjct: 161 FTFILLMTIRYLKRHLAEKCGWKKCIFFPE-----ILIVVVGSITLSNTQ-KWSELKGIK 214

Query: 372 VLGTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLL---EHIAISKSFGRINDYKVVP 428
           ++G +P   + +   K+P    ++       S ++ +L   E   + KS    ++     
Sbjct: 215 IIGDIPPNSDHI---KVPVQTFSEFKELFGTSALIAMLGLFESTIVFKSVCSNSNVDASS 271

Query: 429 DQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDA 488
           ++EL+++G  NL+ + F+A PA G + RS +   C  +T FSGVF     ++ +  L +A
Sbjct: 272 NRELVSLGVVNLVSSIFSALPAFGGYGRSKMNISCGAQTQFSGVFVSLLAIICMNFLMNA 331

Query: 489 FFFIPSATLSAVIIHAVSDLLASYKTTWNF-WKMNPL-DCCAFIVTVLITVFSSIENGIY 546
           F  +P   L+ +I      LL        F W +    +   FI+ V+ T+  S + G+ 
Sbjct: 332 FHHLPICILAVIISTVAFSLLEEAPADLMFYWSVGGYQELFIFIIIVVTTLVWSPQFGVT 391

Query: 547 FAMCWSCAMLLLKHAFPAGQFLGR 570
             MC +   LL        Q LGR
Sbjct: 392 MGMCLTMIRLLKHSTRSRVQILGR 415

>TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {ON}
           Anc_8.99 YPR003C
          Length = 727

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 72/140 (51%), Gaps = 5/140 (3%)

Query: 111 FPIVKWFPHYNLTWGYADLVAGITVGCVLVPQSMSYA-QIASLPPQYGLYSSFIGAFIYS 169
            P   W P Y  +    DLVAGIT+    +P ++SYA  +A + P  GLYS     FIY+
Sbjct: 82  LPCFSWIPEYTWSKFMGDLVAGITLASFQIPLALSYATSLAHVEPLCGLYSLAFTPFIYA 141

Query: 170 LFATSKDVCIGPVAVMSLQTAKVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGL 229
           +F +   + +GP + +SL    V+ Q   K   ++  ++   I+  ++ + G+     G+
Sbjct: 142 IFGSVPQMIVGPESAISL----VVGQAVEKLRAHNHEISTMSISVLVTFISGMFLFVFGI 197

Query: 230 LRLGFLVELISLNAVAGFMT 249
            R GFL  ++S   + GF++
Sbjct: 198 CRFGFLGNVLSRALLRGFIS 217

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 85/184 (46%), Gaps = 6/184 (3%)

Query: 395 KMAPDI-PASIIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGATNLIGTFFNAYPA 450
           ++AP++  A  IV +L   E    +KS G   ++ +  ++EL+A+G+ NL  +   A PA
Sbjct: 347 ELAPNLMNAGFIVAILGFFESTTAAKSLGSAYEFAISSNRELVALGSMNLCASVLGALPA 406

Query: 451 TGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFFFIPSATLSAVIIHAVSDLL- 509
            G + RS + +    +T  SGV  G  VL+ +        +IP   LS +       LL 
Sbjct: 407 FGGYGRSKINSFSGAQTVMSGVCMGVIVLLTVKFFLSQIRYIPVCILSVITTIVGISLLE 466

Query: 510 -ASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIYFAMCWSCAMLLLKHAFPAGQFL 568
            A     ++F      +   F VTVL T F S+E G+     +S   ++   A    Q L
Sbjct: 467 EAPADLRFHFNSRGYDELLVFAVTVLTTFFYSLEMGVCIGCGYSVISIIKHSAKSRIQIL 526

Query: 569 GRVE 572
            RVE
Sbjct: 527 ARVE 530

>KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3.485
           YGR125W
          Length = 1020

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 117/545 (21%), Positives = 220/545 (40%), Gaps = 71/545 (13%)

Query: 74  GNIPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYADLVAGI 133
            +I   +++ + +++  +  I EKL+     ++ Y+    +++FP   L     +++  +
Sbjct: 176 SSIESTKDNNMPIEEQQDNTINEKLS-----TFFYN---TLQYFPASVLGL-LLNILDAL 226

Query: 134 TVGCVLVPQSMS-YAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMS---LQT 189
           + G ++ P S   ++ +          S+ I  FIYS   +S   CIG   +       T
Sbjct: 227 SYGMIIFPISEPIFSHLGPTGMSMFYISTIICQFIYSSGWSSFPSCIGSEMIEITPFFHT 286

Query: 190 AKVIAQVSAKYPEN-DPIVTAPVIATALS-LLCGIVAIGVGLLRLGFLVELISLNAVAGF 247
                  S    EN D I+T  +    +S +  G+  + +G LRLG +V     + + G 
Sbjct: 287 MAFAIMRSLPGEENQDAIITTTIFCYVISSMFTGLTFLTLGKLRLGKIVGFFPRHILIGC 346

Query: 248 MTGSAFNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHL-PDTKLDAVFGLVPLCLLYL 306
           + G  + +L   +        +V TR + ++  +  +K L  DT +             L
Sbjct: 347 IGGVGYFLLITGI--------EVTTRIAKFEYSLPLIKELFTDTSM-------------L 385

Query: 307 WKWWCGTYGPKLADRQLAHSPK---KQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNK 363
           WKW      P L    L  + K   +  +L  FY  +  + + ++     AI  R++  +
Sbjct: 386 WKWLT----PTLLTVVLILTQKCFKRSLVLPSFYIATLILFHFIV-----AIIPRLSLTQ 436

Query: 364 DKEHRPIKVLGTVPSG-----LEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHI-----A 413
            +E   I    T P+       +     K+   L+ K  P + A     +L H+     A
Sbjct: 437 LREAGWI-FSNTAPNSAWYDHYKLFDFHKVHWLLVFKQIPTMLALTFFGIL-HVPINVPA 494

Query: 414 ISKSFGRINDYKVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVF 473
           ++ S  +++ Y V  D+ELIA G +NL+   F +      ++ S L  +    +PF+G  
Sbjct: 495 LAMSV-QMDKYDV--DKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYL 551

Query: 474 TGCCVLVAIYCLTDAFFFIPSATLSAVIIHAVSDLLA-SYKTTWNFWKMNPLDCCAFIVT 532
                +V +        FIP   + ++I     +LL  +   TW+  K+   +    +V 
Sbjct: 552 LIFLTIVVMLIGPVIISFIPICIVGSLIFLLGYELLVEALLDTWD--KLTTFEYVTVVVI 609

Query: 533 VLITVFSSIENGIYFAMCWSCAMLLL---KHAFPAGQFLGRVEVAEVINPTVVEDVEAIS 589
           VL         GI   +  +C   L+   K     G+F G+V     +N  +++      
Sbjct: 610 VLTMGIVDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKV-AKSTVNRDLIQSKFLNG 668

Query: 590 INDQI 594
           I DQI
Sbjct: 669 IGDQI 673

>NCAS0B05940 Chr2 complement(1126985..1127452) [468 bp, 155 aa] {ON}
           
          Length = 155

 Score = 34.3 bits (77), Expect = 0.63,   Method: Composition-based stats.
 Identities = 30/117 (25%), Positives = 50/117 (42%), Gaps = 8/117 (6%)

Query: 608 KGAISASSGSNYKFHSKWVAEQY-AYNRELNPDVKILPP---PPGVVVYRMSDSFTYINC 663
           K   ++ SGS  +  ++    Q+ A N+ L P+  +LPP   P    + R S    Y+  
Sbjct: 28  KQQTTSRSGSGSQLQTQSTPHQHHARNKNLKPEGNVLPPNRIPSPYNMDRASVQQQYMEM 87

Query: 664 SRHYDTIFDHIKKHTRRGQLLHLRKKSDRPWNDPGEWEISPSIKKFFKLGKKNQNDI 720
            ++     +H        +L H    + +   DP    ISP   + F LG  NQ+D+
Sbjct: 88  MKNIMQSNNHSHDSPVPQELPH--SATQQSNTDPSTTNISPD--ELFTLGMMNQHDL 140

>Smik_7.110 Chr7 (195430..197145) [1716 bp, 571 aa] {ON} YGL160W
           (REAL)
          Length = 571

 Score = 33.1 bits (74), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 43/97 (44%), Gaps = 16/97 (16%)

Query: 2   GTREAESVPADSAFKLDDLEAEYDLYKANEQLEDNEVTVNGSEDDYGNK----------K 51
           G    E+    +   +DD  +EY++   N + ED  ++ N S++ Y NK          +
Sbjct: 446 GEYSEETRLNGTTTSIDDENSEYEMGSFNNEDEDLSISKNNSKNAYRNKSRETSDDPTGE 505

Query: 52  GIDLVKETEVRYYGSPGPEAIGGNIPGFEESTVSVKD 88
             DL++    RY+       +   + GF++ +  VK+
Sbjct: 506 NGDLIEVKSKRYF------TLFNELKGFQQESAEVKE 536

>Smik_16.235 Chr16 (431691..432815) [1125 bp, 374 aa] {ON} YPL001W
           (REAL)
          Length = 374

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 26/116 (22%), Positives = 50/116 (43%), Gaps = 8/116 (6%)

Query: 712 LGKKNQNDIESQDEDVAIDNTRDERPLLKIICLDFSQVVQVDSTAIQSLVDLRKAVHKYA 771
           L  KN  +I  +D + A D+ RD   L ++  + F  ++Q +S      ++  +   K  
Sbjct: 244 LLNKNITEITVEDPNEAFDDLRDRNDLQRLRKMGFDTILQKNSQLSDKALESSRKSFKLE 303

Query: 772 DRQVEFHFTGIISS--------WVKRSLLSMGFGTVNASYSDESIIAGHSSYHIAK 819
           +RQ       ++ S         VK+ L    +  +N +  DE+  A  +S+ + K
Sbjct: 304 ERQFNRLLEMLLLSNNSPLFELRVKKRLFIKNYDALNQTDPDEAKEALQNSFELVK 359

>Suva_12.37 Chr12 complement(49774..54825) [5052 bp, 1683 aa] {ON}
           YJL039C (REAL)
          Length = 1683

 Score = 33.1 bits (74), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 38/60 (63%), Gaps = 4/60 (6%)

Query: 581 VVEDVEAISIN-DQIEGSVGKSKSLKADKGAISASSGSNYKFHSKWVAEQYAYNRELNPD 639
           ++ D++ +++N D+++ +  +S+    +KG ++ S GS +K + +++ E  + + ELN D
Sbjct: 28  ILPDLQNLNLNTDKLKNNTSRSQ---LEKGEVTLSDGSTFKLNQEFIFEAISLSDELNLD 84

>Skud_10.175 Chr10 (326685..331736) [5052 bp, 1683 aa] {ON} YJL039C
           (REAL)
          Length = 1683

 Score = 33.1 bits (74), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 38/60 (63%), Gaps = 4/60 (6%)

Query: 581 VVEDVEAISIN-DQIEGSVGKSKSLKADKGAISASSGSNYKFHSKWVAEQYAYNRELNPD 639
           ++ D++ +++N D+++ +  +S+    +KG ++ S GS +K + +++ E  + + ELN D
Sbjct: 28  ILPDLQNLNLNTDKLKNNTSRSQ---LEKGEVTLSDGSTFKLNQEFIFEAISLSDELNLD 84

>YJL039C Chr10 complement(368748..373799) [5052 bp, 1683 aa] {ON}
           NUP192Essential subunit of the inner ring of the nuclear
           pore complex (NPC); contributes to nucleocytoplasmic
           transport; homologous to human NUP205
          Length = 1683

 Score = 33.1 bits (74), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 37/60 (61%), Gaps = 4/60 (6%)

Query: 581 VVEDVEAISIN-DQIEGSVGKSKSLKADKGAISASSGSNYKFHSKWVAEQYAYNRELNPD 639
           V+ D++ +++N D+++ +  +S+    +KG I  S GS +K + +++ E  + + ELN D
Sbjct: 28  VLPDLQNLNLNTDKLKNNASRSQ---LEKGEIELSDGSTFKVNQEFIFEAISLSDELNLD 84

>TDEL0E03650 Chr5 (684366..689384) [5019 bp, 1672 aa] {ON} Anc_5.261
           YJL039C
          Length = 1672

 Score = 32.3 bits (72), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 37/69 (53%), Gaps = 4/69 (5%)

Query: 572 EVAEVINPTVVEDVEAISINDQIEGSVGKSKS-LKADKGAISASSGSNYKFHSKWVAEQY 630
           E+   +   V+ D++++++ND   G    S S  + +KG I+ S G+ YK +  ++    
Sbjct: 21  EIDRKLFDEVLLDLQSLNLND---GKFKNSDSRARLEKGEITLSDGNTYKINQDFMIAAI 77

Query: 631 AYNRELNPD 639
           A + ELN D
Sbjct: 78  AVSDELNLD 86

>KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa]
           {ON} similar to uniprot|P53273 Saccharomyces cerevisiae
           YGR125W Hypothetical ORF
          Length = 1060

 Score = 32.0 bits (71), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 28/132 (21%), Positives = 52/132 (39%), Gaps = 3/132 (2%)

Query: 429 DQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDA 488
           D+ELIA G +NLI  F  +      ++ S L  +    +P +G+       + +      
Sbjct: 561 DKELIAHGYSNLISGFLGSIQNYLVYTNSVLFIRAGADSPIAGIMLTIGTFIVMVIGPVI 620

Query: 489 FFFIPSATLSAVIIHAVSDLLA-SYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIYF 547
             FIP   + ++I     +L+  +   TW   K+ P +     + V+         GI  
Sbjct: 621 ISFIPICIVGSLIFLLGYELIQEAVIDTWG--KLQPFEYLTIWIIVITMGVVDFVIGIIV 678

Query: 548 AMCWSCAMLLLK 559
            +  +C   L+ 
Sbjct: 679 GILLACFSFLVN 690

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 91,038,486
Number of extensions: 4004066
Number of successful extensions: 11836
Number of sequences better than 10.0: 64
Number of HSP's gapped: 11901
Number of HSP's successfully gapped: 81
Length of query: 867
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 749
Effective length of database: 39,950,811
Effective search space: 29923157439
Effective search space used: 29923157439
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 70 (31.6 bits)