Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0F039708.270ON61961930660.0
YDR118W (APC4)8.270ON6525529331e-117
Skud_4.3788.270ON6524559071e-113
Smik_4.3628.270ON6485009061e-113
ZYRO0C01474g8.270ON5994358871e-110
Suva_2.2778.270ON6494988801e-109
KAFR0B054608.270ON6104837153e-85
Kpol_392.18.270ON4244206794e-82
KNAG0H031908.270ON6224445608e-63
TPHA0J007908.270ON6854475577e-62
NDAI0J012708.270ON7354975483e-60
NCAS0B037908.270ON6124325311e-58
TBLA0C045708.270ON6084855256e-58
CAGL0B01859g8.270ON6224255133e-56
SAKL0H16852g8.270ON6444394863e-52
KLTH0G13508g8.270ON6454244433e-46
Kwal_56.237668.270ON7404144374e-45
AGR078C8.270ON7154381861e-13
Ecym_43008.270ON7153691548e-10
NDAI0G054301.267ON813108890.037
Kpol_325.26.337ON439101705.9
NOTE: 1 genes in the same pillar as TDEL0F03970 were not hit in these BLAST results
LIST: KLLA0F19316g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0F03970
         (619 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.2...  1185   0.0  
YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subuni...   363   e-117
Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W ...   353   e-113
Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W ...   353   e-113
ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {...   346   e-110
Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa...   343   e-109
KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa] ...   280   3e-85
Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON} compl...   266   4e-82
KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {O...   220   8e-63
TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8....   219   7e-62
NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8....   215   3e-60
NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {O...   209   1e-58
TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON} Anc_8...   206   6e-58
CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly...   202   3e-56
SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]...   191   3e-52
KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]...   175   3e-46
Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {...   172   4e-45
AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON} S...    76   1e-13
Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}...    64   8e-10
NDAI0G05430 Chr7 (1330372..1332813) [2442 bp, 813 aa] {ON} Anc_1...    39   0.037
Kpol_325.2 s325 complement(4458..5777) [1320 bp, 439 aa] {ON} co...    32   5.9  

>TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.270
           YDR118W
          Length = 619

 Score = 1185 bits (3066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 577/619 (93%), Positives = 577/619 (93%)

Query: 1   MVVTELDYRCYNPLYSLYAKKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKR 60
           MVVTELDYRCYNPLYSLYAKKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKR
Sbjct: 1   MVVTELDYRCYNPLYSLYAKKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKR 60

Query: 61  MTVFYKDGNARIYDAFQAGKLLALLRISKTRVDGAIWDRIELSRQEVTFKFDHFVLNSMP 120
           MTVFYKDGNARIYDAFQAGKLLALLRISKTRVDGAIWDRIELSRQEVTFKFDHFVLNSMP
Sbjct: 61  MTVFYKDGNARIYDAFQAGKLLALLRISKTRVDGAIWDRIELSRQEVTFKFDHFVLNSMP 120

Query: 121 KMIRFARDTRQIFILPYEPPNKTWRLATEEEDGVKREKEILDVHLVHQEDNGLVLMLDGD 180
           KMIRFARDTRQIFILPYEPPNKTWRLATEEEDGVKREKEILDVHLVHQEDNGLVLMLDGD
Sbjct: 121 KMIRFARDTRQIFILPYEPPNKTWRLATEEEDGVKREKEILDVHLVHQEDNGLVLMLDGD 180

Query: 181 FILRLAAGPSGPALKDIVVADRGLYHCFYEDATVESLSLDQLIQCDATIQLIQHFIAIKQ 240
           FILRLAAGPSGPALKDIVVADRGLYHCFYEDATVESLSLDQLIQCDATIQLIQHFIAIKQ
Sbjct: 181 FILRLAAGPSGPALKDIVVADRGLYHCFYEDATVESLSLDQLIQCDATIQLIQHFIAIKQ 240

Query: 241 LNHYLQDHLDLIKRDLVAPYTEFLTKICDAAFGYXXXXXXXXXXXXXXXXXXXXXNWFCY 300
           LNHYLQDHLDLIKRDLVAPYTEFLTKICDAAFGY                     NWFCY
Sbjct: 241 LNHYLQDHLDLIKRDLVAPYTEFLTKICDAAFGYEILHEELESLLLGGGLSVELENWFCY 300

Query: 301 TVGEKNFKKWKKMGLEMYQKTIQILTLSFIPACERVILLSERCRACLKALQLIESSTTTD 360
           TVGEKNFKKWKKMGLEMYQKTIQILTLSFIPACERVILLSERCRACLKALQLIESSTTTD
Sbjct: 301 TVGEKNFKKWKKMGLEMYQKTIQILTLSFIPACERVILLSERCRACLKALQLIESSTTTD 360

Query: 361 SSEFANLTSLSQTYLRSTVETIQGVSAQEVLFQTFLQWFDDRLHEALDEDYKQKLSIDSN 420
           SSEFANLTSLSQTYLRSTVETIQGVSAQEVLFQTFLQWFDDRLHEALDEDYKQKLSIDSN
Sbjct: 361 SSEFANLTSLSQTYLRSTVETIQGVSAQEVLFQTFLQWFDDRLHEALDEDYKQKLSIDSN 420

Query: 421 CKIGYQIATYLDLRINPDKQSEYDNKFLKLQTFQEILDTMSQNLQLIRDREIEPKVLQKI 480
           CKIGYQIATYLDLRINPDKQSEYDNKFLKLQTFQEILDTMSQNLQLIRDREIEPKVLQKI
Sbjct: 421 CKIGYQIATYLDLRINPDKQSEYDNKFLKLQTFQEILDTMSQNLQLIRDREIEPKVLQKI 480

Query: 481 TRVNRHNLPNSENQILLAVAXXXXXXXXXXXXXXXXXXXXXTFYTRTLDKSSLAQISSEV 540
           TRVNRHNLPNSENQILLAVA                     TFYTRTLDKSSLAQISSEV
Sbjct: 481 TRVNRHNLPNSENQILLAVAPIPSQSNIISFFSSSNAAQQPTFYTRTLDKSSLAQISSEV 540

Query: 541 PIELPFSQQDHHQIKAGIARLTSPLEKPQDHSNHPYNAEIVLWVSNNNAATCEEQFTVHC 600
           PIELPFSQQDHHQIKAGIARLTSPLEKPQDHSNHPYNAEIVLWVSNNNAATCEEQFTVHC
Sbjct: 541 PIELPFSQQDHHQIKAGIARLTSPLEKPQDHSNHPYNAEIVLWVSNNNAATCEEQFTVHC 600

Query: 601 QITPAGMPIPGEFNRKSEQ 619
           QITPAGMPIPGEFNRKSEQ
Sbjct: 601 QITPAGMPIPGEFNRKSEQ 619

>YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subunit
           of the Anaphase-Promoting Complex/Cyclosome (APC/C),
           which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors, including mitotic
           cyclins, during the metaphase/anaphase transition;
           component of the platform domain of the APC/C, based on
           structural analysis
          Length = 652

 Score =  363 bits (933), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 196/552 (35%), Positives = 310/552 (56%), Gaps = 22/552 (3%)

Query: 11  YNPLYSLYAKKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKRMTVFYKDGNA 70
           YNPL+ ++A +  KGL+I RV+D+A++A + +R++N++A + WD  TGK +++F+KDG  
Sbjct: 12  YNPLFPIFATRIAKGLAIYRVSDHARLAVIPIRNINLVANYDWDTTTGKFLSIFFKDGTI 71

Query: 71  RIYDAFQAGKLLALLRISKTRVDGAIWDRIELSRQEVTFKFDHFVLNSMPKMIRFARDTR 130
           RI+D F+ G+L++ LRI  T++   IWDRI L  +     F   +++ +PK+IRF +D++
Sbjct: 72  RIHDIFKDGRLVSFLRIPSTKISKGIWDRIPLRYEPNNRDFACNIIDDLPKLIRFVKDSK 131

Query: 131 QIFILPYEPPNKTWRLATEEEDGVKREKEILDVHLVHQEDNG-LVLMLDGDFILRLAAG- 188
           +I I+PY  PN  WR   +E+D    EK  LDVH+V  E N  + +  +GD+ + L+   
Sbjct: 132 RINIVPYTQPNSLWR-GPDEDDLDSNEK--LDVHVVFNEGNDKITVFFNGDYAVFLSVDN 188

Query: 189 -PSGPALKDIVVADRGLYHCFYEDATVESLSLDQLIQCDATIQLIQHFIAIKQLNHYLQD 247
             +  +LK I+    G Y CFYED TV++L+L  L+Q  +++ L+ + + IK+L  Y+  
Sbjct: 189 IENENSLKSIIKVQDGFYQCFYEDGTVQTLNLGPLLQSKSSVNLLNYIMVIKELIGYMLT 248

Query: 248 HLDLIKRDLVAPYTEFLTKICDAAFGYXXXXXXXXXXXXXXXXXXXXXNWFCYTVGEKNF 307
           HL+ I R+L  PY +F+ ++CD A+GY                     +W C +VGEKNF
Sbjct: 249 HLEFINRELATPYLDFVKRLCDEAYGYGKLKSELEALFLLGEISCDLEDWLCNSVGEKNF 308

Query: 308 KKWKKMGLEMYQKTIQILTLSFIPACERVILLSERCRACLKALQLIES-STTTDSSEFAN 366
           K+WK +G E YQKT+QILTL F+PACER+I+  E+ RA L+A  +    S T+D +    
Sbjct: 309 KRWKYLGCEAYQKTVQILTLIFVPACERIIIYVEKLRAILQAFSIQNKLSYTSDLTAVEV 368

Query: 367 LTSLSQTYLRSTVETIQGVSAQEVLFQTFLQWFDDRLHEALDEDYKQKLSIDSNCKIGYQ 426
           L   SQ  L  T+ +I G+   E LF+ F  WF+DRLHEALDEDYK K   + +   GY 
Sbjct: 369 LLKSSQKLLTMTLNSIIGLGRDETLFEKFFIWFNDRLHEALDEDYKLKFQFEDDLYFGYD 428

Query: 427 IATYLDLRINPDKQSEYDNKFLKLQTFQEILDTMSQNLQLIRDREIEPKVLQKI-----T 481
           + +Y D RI   K +E  +  + ++ +++++++MS   + I    +   + Q I     T
Sbjct: 429 LLSYFD-RILSKKGTE-PSSIIDVKLYRDLINSMSDMEKDIAQSNVNSHIQQHILVDLKT 486

Query: 482 RVNRHNLPNSENQILLAVAXXXXXXXXXXXXXXXXXXXXXTF--------YTRTLDKSSL 533
            V     P+S+  +L A+                       F        Y  TL   +L
Sbjct: 487 DVFAQKYPSSQINLLDAIKLPKHNYIVYLIQVTKHNSAQEPFSEENKKKLYIGTLKDENL 546

Query: 534 AQISSEVPIELP 545
             IS E  +++P
Sbjct: 547 GIISKESSVKIP 558

>Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W
           (REAL)
          Length = 652

 Score =  353 bits (907), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 170/455 (37%), Positives = 277/455 (60%), Gaps = 9/455 (1%)

Query: 11  YNPLYSLYAKKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKRMTVFYKDGNA 70
           YNP + ++A +  KGL+I RV+D+A+IA + VR++ ++A + WD  +GK +++F+KDG  
Sbjct: 12  YNPRFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGKFLSIFFKDGTV 71

Query: 71  RIYDAFQAGKLLALLRISKTRVDGAIWDRIELSRQEVTFKFDHFVLNSMPKMIRFARDTR 130
           RI+D F+ G+L++ LR+  T++   IWDRI L R+  +  F + V++ +PK+IRF +D++
Sbjct: 72  RIHDIFKDGRLVSFLRVPSTKISRGIWDRIPLKREYDSETFAYNVIDILPKLIRFVKDSK 131

Query: 131 QIFILPYEPPNKTWRLATEEEDGVKREKEILDVHLVHQEDNG-LVLMLDGDFILRLAAG- 188
           ++ I+PY PPN  WR   E++       EILDVH++  E N  + +  +GD+ + L    
Sbjct: 132 RVSIVPYTPPNGLWRGPDEDD---PESGEILDVHVIFNEGNDKITIFFNGDYTILLPMDD 188

Query: 189 -PSGPALKDIVVADRGLYHCFYEDATVESLSLDQLIQCDATIQLIQHFIAIKQLNHYLQD 247
             +   L+ +V    G YHCFY D +V +L+L  L++   ++ L+ + + IK+L  YL  
Sbjct: 189 IENERILESVVKVQDGFYHCFYNDGSVRTLNLQPLLRSKPSVDLLHYIMVIKELIGYLLA 248

Query: 248 HLDLIKRDLVAPYTEFLTKICDAAFGYXXXXXXXXXXXXXXXXXXXXXNWFCYTVGEKNF 307
           H++LI R+L+ PY +F+ +ICD A+GY                     +W C +VGEKN 
Sbjct: 249 HVELINRELITPYLDFVKRICDEAYGYNKLKSELECLFLLGEVSCDLEDWLCNSVGEKNL 308

Query: 308 KKWKKMGLEMYQKTIQILTLSFIPACERVILLSERCRACLKALQL-IESSTTTDSSEFAN 366
           KKWK +G E YQKT QILTL F+P CER+I+  E+ R  L+A  +  +S+ T+D +    
Sbjct: 309 KKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRGTLEAFSVQNKSNNTSDLTAVEL 368

Query: 367 LTSLSQTYLRSTVETIQGVSAQEVLFQTFLQWFDDRLHEALDEDYKQKLSIDSNCKIGYQ 426
           L   SQ  L +T+++I  +   E LF+ F  WF+DR+HE LDEDYK K   + +   GY 
Sbjct: 369 LLKNSQELLNNTLKSIIALGRNETLFEKFFIWFNDRIHEGLDEDYKLKFEFEDDPYFGYD 428

Query: 427 IATYLDLRINPDKQSEYDNKFLKLQTFQEILDTMS 461
           + TY D +I   + +E  +  + ++ ++E+++ MS
Sbjct: 429 LLTYFD-KILSYRSTE-SSSVINMKLYRELINNMS 461

>Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W
           (REAL)
          Length = 648

 Score =  353 bits (906), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 175/500 (35%), Positives = 293/500 (58%), Gaps = 19/500 (3%)

Query: 11  YNPLYSLYAKKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKRMTVFYKDGNA 70
           YNP + ++A +  KGL+I RV+D+A++A + +R++N++A + WD +TGK +++F+KDG  
Sbjct: 12  YNPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGKFLSIFFKDGTI 71

Query: 71  RIYDAFQAGKLLALLRISKTRVDGAIWDRIELSRQEVTFKFDHFVLNSMPKMIRFARDTR 130
           RI+D F+ G+L++ LRI  T++    WDRI L  +       + +++ +PK+IR+ +D++
Sbjct: 72  RIHDIFKDGRLVSFLRIPSTKISKGTWDRIPLESESGNGNLAYNIIDYLPKLIRYVKDSK 131

Query: 131 QIFILPYEPPNKTWRLATEEEDGVKREKEILDVHLVHQED-NGLVLMLDGDFILRLAAGP 189
           +I I+PY PPN  WR   E+E       E LD+H++  E  + + +  +GD+ + +  G 
Sbjct: 132 RINIVPYTPPNSLWRGPDEDE---PENNEKLDIHIIFNEGHDKITVFFNGDYAIFVPVGA 188

Query: 190 SGPA--LKDIVVADRGLYHCFYEDATVESLSLDQLIQCDATIQLIQHFIAIKQLNHYLQD 247
                 +K IV    G YHCFY+D TV +L+L  L++ + ++ ++++ +AIK+L  YL +
Sbjct: 189 DENERFVKSIVKIQDGFYHCFYDDGTVRTLNLGPLLRSEPSMNILKYIMAIKELIGYLLN 248

Query: 248 HLDLIKRDLVAPYTEFLTKICDAAFGYXXXXXXXXXXXXXXXXXXXXXNWFCYTVGEKNF 307
           H++ I R+LV PY EF+ ++CD A+GY                     +W C +VGEKNF
Sbjct: 249 HIEFINRELVTPYLEFVNRLCDEAYGYDKLISELECLFLLGEVSCDLEDWLCNSVGEKNF 308

Query: 308 KKWKKMGLEMYQKTIQILTLSFIPACERVILLSERCRACLKALQLIESSTTTDSSEFANL 367
           K+WK +G E YQKT QILTL F+PACER+I+  E+ R  L+A  +   +   DSS+   +
Sbjct: 309 KRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLRGILEAFSI--QNKFNDSSDLTAV 366

Query: 368 TSL---SQTYLRSTVETIQGVSAQEVLFQTFLQWFDDRLHEALDEDYKQKLSIDSNCKIG 424
            +L   SQ  L  T+++I  +   E LF+TF  W +DR+HE LDEDYK K+  + +   G
Sbjct: 367 DTLLKNSQELLTITLKSIVDLGKDETLFETFFIWLNDRIHEVLDEDYKLKVQFEDDPYFG 426

Query: 425 YQIATYLDLRINPDKQSEYDNKFLKLQTFQEILDTMSQNLQLIRDREIEPKVLQKI---- 480
           Y + TY     N   +    +  L ++ +++++++MS   + I +  +   + Q I    
Sbjct: 427 YDLLTYFH---NISNRGAETSPVLNMKLYRDLINSMSDMEKEIAESNVNSHIQQHILVES 483

Query: 481 -TRVNRHNLPNSENQILLAV 499
            T V     P+S+  +  AV
Sbjct: 484 RTDVYSKEYPSSQIYVFDAV 503

>ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {ON}
           weakly similar to uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 599

 Score =  346 bits (887), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 178/435 (40%), Positives = 268/435 (61%), Gaps = 21/435 (4%)

Query: 7   DYRCYNPLYSLYAKKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKRMTVFYK 66
           DY  YNP+Y LY K+F +G S+ R+AD+A+IAT+ VRD++ +A +QWDPITGK +++FYK
Sbjct: 4   DYVDYNPVYPLYVKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSIFYK 63

Query: 67  DGNARIYDAFQAGKLLALLRISKTRVDGAIWDRIELSRQEVTFK---FDHFVLNSMPKMI 123
           DG  RIYD F++G+L++LLR S       IWDRIEL   E   K    DH V   MPKM+
Sbjct: 64  DGTVRIYDGFRSGRLVSLLRASSNGAVSGIWDRIELLHSEENIKDWSIDHDVTEMMPKMV 123

Query: 124 RFARDTRQIFILPYEPPNKTWRLATEEEDGVKREKEILDVHLVHQEDNGLVLMLDGDFI- 182
           +FARD+RQ+ ++PY  P+  WR    ++        +LD H++   D+ L +M DG+F  
Sbjct: 124 KFARDSRQLCVVPYTLPSDVWRPQAADD-----TNALLDAHVIRCHDS-LSVMFDGEFTI 177

Query: 183 -LRLAAGPSGPALKDIVVADRGLYHCFYEDATVESLSLDQLIQCDATIQLIQHFIAIKQL 241
            ++LAA PS P +K   V+ +  Y  FY+D +VE   L  L++   +++L+++ I ++QL
Sbjct: 178 SIQLAAIPS-PLVK--FVSAQHQYLAFYQDGSVERFDLANLVKDPFSLRLLKNVITMRQL 234

Query: 242 NHYLQDHLDLIKRDLVAPYTEFLTKICDAAF-GYXXXXXXXXXXXXXXXXXXXXXNWFCY 300
           + YLQDH++LI+RDL+ PY EFL + C  AF GY                     +W   
Sbjct: 235 HRYLQDHIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLMLVGDVTPELEDWLVN 294

Query: 301 TVGEKNFKKWKKMGLEMYQKTIQILTLSFIPACERVILLSERCRACLKALQLIESSTTTD 360
           ++GEKN K+W+K+G + Y KT+Q+LTL+ +PACER+I L +RC        L+    T  
Sbjct: 295 SMGEKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTG-----NLLSRQLTLQ 349

Query: 361 SSEFANLTSLSQTYLRSTVETIQGVSAQEVLFQTFLQWFDDRLHEALDEDYKQKLSIDSN 420
                 +  L Q +L++ +E I  +S+Q+ L  +FL WFDDR+ E++DEDYK + ++  N
Sbjct: 350 LPLLPPIDCL-QFFLKNVLEAIASLSSQQRLLGSFLDWFDDRVRESIDEDYKLRFNLHDN 408

Query: 421 CKIGYQIATYLDLRI 435
             +G   A+YL LR+
Sbjct: 409 SSLGPDTASYLQLRL 423

>Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa]
           {ON} YDR118W (REAL)
          Length = 649

 Score =  343 bits (880), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 167/498 (33%), Positives = 292/498 (58%), Gaps = 14/498 (2%)

Query: 11  YNPLYSLYAKKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKRMTVFYKDGNA 70
           YNP + ++A +  KGL+I RV+D+A++A + VR++ ++A + WD  TGK +++F+KDG  
Sbjct: 8   YNPRFPIFAIRVVKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSIFFKDGTI 67

Query: 71  RIYDAFQAGKLLALLRISKTRVDGAIWDRIELSRQEVTFKFDHFVLNSMPKMIRFARDTR 130
           RI+D F+ G+L++ LRI +T++   IWDRI L  +     F + V++ +PK+IRF +D++
Sbjct: 68  RIHDIFKDGRLVSFLRIPRTKISRGIWDRIPLKYESSNRNFANNVIDVLPKLIRFVKDSK 127

Query: 131 QIFILPYEPPNKTWRLATEEEDGVKREKEILDVHLVHQEDNG-LVLMLDGDFILRLAAG- 188
           ++ I PY PPN  WR   +E+D    E   LD+H++  E N  + +  +GD+ + L    
Sbjct: 128 RVTIAPYTPPNSLWR-GPDEDDPENCEN--LDIHVIFNEGNDKITVFFNGDYAILLPVSD 184

Query: 189 -PSGPALKDIVVADRGLYHCFYEDATVESLSLDQLIQCDATIQLIQHFIAIKQLNHYLQD 247
             +   LK +V    G YHCFY D TV + +L++L+Q + ++ L+++ + IK+L  YL  
Sbjct: 185 IENEKILKSVVKVQNGFYHCFYNDGTVSTFNLERLLQSEPSVDLLRYMMVIKELIGYLLA 244

Query: 248 HLDLIKRDLVAPYTEFLTKICDAAFGYXXXXXXXXXXXXXXXXXXXXXNWFCYTVGEKNF 307
           H++ I R+L  PY +F+ +ICD A+GY                     +W C  VGEKNF
Sbjct: 245 HIEFINRELTTPYMDFVKRICDEAYGYSKLKSELKCLFLLGEVPSDLDDWLCNAVGEKNF 304

Query: 308 KKWKKMGLEMYQKTIQILTLSFIPACERVILLSERCRACLKALQL-IESSTTTDSSEFAN 366
           K+WK +G E YQKT+Q+ TL+F+P CER+I+  ++ +  L+A  +        D +    
Sbjct: 305 KRWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILEAFSIQXXXXXXXDLTAVEL 364

Query: 367 LTSLSQTYLRSTVETIQGVSAQEVLFQTFLQWFDDRLHEALDEDYKQKLSIDSNCKIGYQ 426
           L   SQ  L  T+++I  +   E LF+ FL WF+DR+HE LDEDYK K   + +   GY 
Sbjct: 365 LLKQSQELLNITLKSIIDLGKDETLFEKFLMWFNDRIHEVLDEDYKPKFEFEDDPYFGYD 424

Query: 427 IATYLDLRINPDKQSEYDNKFLKLQTFQEILDTMSQNLQLIRDREIEPKVLQKITRVNRH 486
           +  + + +   D+ +E  +  + ++ +++++++M+   + I    + P + +++   +R 
Sbjct: 425 LLNFFE-KFLSDRNTE-SSSVIDMKLYRDLINSMTAMEKDIAKNNVNPHIQRQVLVQSRA 482

Query: 487 NL-----PNSENQILLAV 499
           ++     P+S+  +L A+
Sbjct: 483 DVFSQRYPSSKINLLDAI 500

>KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa]
           {ON} Anc_8.270 YDR118W
          Length = 610

 Score =  280 bits (715), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 151/483 (31%), Positives = 253/483 (52%), Gaps = 14/483 (2%)

Query: 5   ELDYRCYNPLYSLYAKKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKRMTVF 64
           E  Y  YN    LY +K  KGL + R +DN  IA   ++   ++A   WD I+GK +++F
Sbjct: 8   ERSYCVYNKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKISGKYLSIF 67

Query: 65  YKDGNARIYDAFQAGKLLALLRISKTRVDGAIWDRIELSRQEVTFKFDHFVLNSMPKMIR 124
           ++DG+ RI D F+ GKL+A LR     VD   WDRIE        +F+  +++ MP +I+
Sbjct: 68  FRDGSIRIIDVFKDGKLVAFLRTQFKNVDCTYWDRIEEQTTNEMKQFNKNIVDLMPSLIQ 127

Query: 125 FARDTRQIFILPYEPPNKTWRLATEEEDGVKREKEILDVHLVHQ-EDNGLVLMLDGDFIL 183
           F     ++ ++PY P N  WR    E D   ++  ++D+H +HQ E +  +++L+GD+ L
Sbjct: 128 FVSSANKLSLIPYTPSNANWR----ELDAKWKKNRVIDMHCLHQSETDSFLMVLNGDYYL 183

Query: 184 RLAAGPSGPALK----DIVVADRGLYHCFYEDATVESLSLDQLIQCDATIQLIQHFIAIK 239
            L    +  + K     ++ +   LY C Y+D +   +     +   + I L++  +++K
Sbjct: 184 TLKTPETDLSEKVPACSLIKSANSLYQCIYKDGSARKIDTSSFLSSKSCIDLLECILSLK 243

Query: 240 QLNHYLQDHLDLIKRDLVAPYTEFLTKICDAAFGYXXXXXXXXXXXXXXXXXXXXXNWFC 299
            ++ Y ++HLDL++R ++ PY +FL KICD AFG                      +W  
Sbjct: 244 DMSKYTRNHLDLLERVIIKPYLDFLEKICDGAFGREKLINELKITFLLGTISDELQDWLH 303

Query: 300 YTVGEKNFKKWKKMGLEMYQKTIQILTLSFIPACERVILLSERCRACLKALQLIESSTTT 359
           Y+VG+KN  +W+ +  + YQ+T ++ T++ + ACER+ILLSERC   + A Q  ES    
Sbjct: 304 YSVGDKNVTQWRTLCHDAYQQTTELFTIALMCACERMILLSERCFGLIMAFQF-ESGADD 362

Query: 360 DSS--EFANLTSLSQTYLRSTVETIQGVSAQEVLFQTFLQWFDDRLHEALDEDYKQKLSI 417
           +S   E   L S  Q  L+S + T +  + +  + + FL W +DR+HE LD+DYK +LSI
Sbjct: 363 NSRLHELNELMSNLQDMLKSIIYTAEESANKFEMLKIFLSWLNDRVHEELDDDYKPQLSI 422

Query: 418 DSNCKIGYQIATYLDLRINPDKQSEYDNKFLKLQTFQEILDTMSQNLQLIRDREIEPKVL 477
             N    Y++    +  +   K+   D   L     +  L+ +  N+  +  + IEP + 
Sbjct: 423 TQNSNTCYKLGKSFEYLLQEGKKDSED--ILNFDIIKHTLEKIEANISRMNTKYIEPILE 480

Query: 478 QKI 480
            KI
Sbjct: 481 NKI 483

>Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON}
           complement(1..1272) [1272 nt, 424 aa]
          Length = 424

 Score =  266 bits (679), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 133/420 (31%), Positives = 235/420 (55%), Gaps = 15/420 (3%)

Query: 6   LDYRCYNPLYSLYAKKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKRMTVFY 65
           L Y  YNP + LY  + ++GL++ R+ D++++A + ++D + +A ++WD  +G+ ++VF 
Sbjct: 9   LYYSKYNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYSGRFISVFL 68

Query: 66  KDGNARIYDAFQAGKLLALLRISKTR-VDGAIWDRIELSRQEVTFKFDHFVLNSMPKMIR 124
            DG  RIYD F+ G+L++ +R S  + VD  +WDR E S       FD  ++  +P +I+
Sbjct: 69  TDGTIRIYDIFKNGRLVSYIRSSSQKNVDSCLWDRAEFSIPSKLQLFDSNIIECLPTLIK 128

Query: 125 FARDTRQIFILPYEPPNKTWRLATEEEDGVKRE---KEILDVHLVH--QEDNGLVLMLDG 179
           F +D+R I I+ Y PPN +WR   +E     +E   + +LDVH+ H   EDN   ++L+G
Sbjct: 129 FVKDSRNINIIDYYPPNHSWRHVDKESQDTDKEIDFRNLLDVHIQHNPNEDN-FTIILNG 187

Query: 180 DFILRLAAGP--SGPALKDIVVADRGLYHCFYEDATVESLSLDQLIQCDATIQLIQHFIA 237
            + +     P  S   +  ++    G Y  FY++     ++ + L+ C+ +  L+ + + 
Sbjct: 188 VYEINGIVMPDISKSEVYQLLKLHNGEYMSFYKNGHYRKINFNNLLSCNVSNGLLSNILE 247

Query: 238 IKQLNHYLQDHLDLIKRDLVAPYTEFLTKICDAAF--GYXXXXXXXXXXXXXXXXXXXXX 295
           I+ LN Y+ DHLDLIKR+L+ PY++F+ KIC  A+  G                      
Sbjct: 248 IRNLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLTGEINNEFK 307

Query: 296 NWFCYTVGEKNFKKWKKMGLEMYQKTIQILTLSFIPACERVILLSERCRACLKALQLIES 355
           +W    +G++N KKW+K+G++M++K ++ILTL+ IP+CER ++  ER    L        
Sbjct: 308 DWLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDGYLNGYM---- 363

Query: 356 STTTDSSEFANLTSLSQTYLRSTVETIQGVSAQEVLFQTFLQWFDDRLHEALDEDYKQKL 415
            T TD  +  +L       +R+++  I  ++ Q   F+ F +W +D+++E  DEDYK ++
Sbjct: 364 KTDTDFYDIISLREYFSKLIRNSITIINSLNNQLKYFEIFSEWINDKINEITDEDYKNRV 423

>KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {ON}
           Anc_8.270 YDR118W
          Length = 622

 Score =  220 bits (560), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 126/444 (28%), Positives = 229/444 (51%), Gaps = 16/444 (3%)

Query: 8   YRCYNPLYSLYAKKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKRMTVFYKD 67
           Y   N +  LY  +  K L + R  D++ IA+  +RD + +  +QWD I G+ ++V ++D
Sbjct: 12  YTEVNNVLPLYVTRGTKQLVVNRDTDDSTIASTFIRDPSQVVSYQWDTIGGEIISVMFQD 71

Query: 68  GNARIYDAFQAGKLLALLRISKTRVDGAIWDRIELSRQEVTFKFD-HFVLNSMPKMIRFA 126
           G+ RI D     KL+ALLR  +T +D  +WDRI L  +  + ++D   +  S+P++++F 
Sbjct: 72  GSIRINDVMYDAKLVALLRTQRTGLDCVLWDRIRLPSRAQSMEWDPDIITQSLPRLVKFM 131

Query: 127 RDTRQIFILPYEPPNKTWRLATEEEDGVKREKEILDVHLVHQE-DNGLVLMLDGDFILRL 185
                  + PY P N +WR       G      ILDVH +HQ+  + LV +L+G++ L+L
Sbjct: 132 GSDASPSMSPYLPTNHSWRFPNSGAAG-----GILDVHFLHQKLGDTLVALLNGEYQLQL 186

Query: 186 AAGP---SGPALKDIVV---ADRGLYHCFYEDATVESLSLDQLIQCDATIQLIQHFIAIK 239
             GP       L+ I+    + R +Y+C+Y+   V  + L   ++   TI+L++ F+  +
Sbjct: 187 -TGPHQEDQSELRKIIARTDSKRHVYNCYYKTGPVRQVDLTGFVEDKDTIKLLERFLLFQ 245

Query: 240 QLNHYLQDHLDLIKRDLVAPYTEFLTKICDAAFGYXXXXXXXXXXXXXXXXXXXXXNWFC 299
               Y   HL+ I+ + V PY EF+ ++C+ AFG                      +W  
Sbjct: 246 DYLGYFLAHLEPIQTECVEPYQEFIERLCEDAFGKEKLQESLTDHFLVGSMDEELRDWLV 305

Query: 300 YTVGEKNFKKWKKMGLEMYQKTIQILTLSFIPACERVILLSERCRACLKALQLIES--ST 357
           Y++GE+N ++WK +    Y++T Q++ +  +P  ER+I+L E+ +A +   QL E     
Sbjct: 306 YSLGERNLEEWKSLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALVLTAQLSEGMVGD 365

Query: 358 TTDSSEFANLTSLSQTYLRSTVETIQGVSAQEVLFQTFLQWFDDRLHEALDEDYKQKLSI 417
           + + SEF +L    Q  L+  ++T++ ++      + FL W ++ L   +++DY    ++
Sbjct: 366 SLEISEFTDLLENCQELLQLVLQTVKQLAKDIKDIKVFLLWLENVLKTTINKDYPPNFNV 425

Query: 418 DSNCKIGYQIATYLDLRINPDKQS 441
               K G+   + L L + P K++
Sbjct: 426 SECGKFGFLFTSGLALTLEPAKKT 449

>TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8.270
           YDR118W
          Length = 685

 Score =  219 bits (557), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 127/447 (28%), Positives = 245/447 (54%), Gaps = 17/447 (3%)

Query: 4   TELDYRCYNPLYSLYAKKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKRMTV 63
           ++L Y   NP+Y LY  K +KGL+IC ++D++ +AT+ ++D +++  F WD ITGK +  
Sbjct: 7   SQLYYYKLNPIYQLYTFKSDKGLAICTISDHSILATIFIKDFSLVVDFFWDSITGKFLLF 66

Query: 64  FYKDGNARIYDAFQAGKLLALLRISKTRVDGAIWDRIELSR---QEVTFKFDHFVLNSMP 120
            + DG+ R+YD F+ G+L++  R    ++    WDRI ++    Q++   FD+ + NSMP
Sbjct: 67  AFNDGSIRVYDIFKLGRLVSFFRSPLKQIKCVYWDRIIITETLDQQLKI-FDYDLTNSMP 125

Query: 121 KMIRFARDTRQIFILPYEPPNKTWR-------LATEEEDGVKREKEILDVHLVHQED--N 171
            +++F +D + + ++P     + WR       L  E         ++LD+HL++ E   +
Sbjct: 126 TLVKFVKDPQGLQLVPVLKNTQAWRQIDVDLNLKLENSKTEVSTDDVLDIHLLYTESGMD 185

Query: 172 GLVLMLDGDFILRLAAGPSGPALKDI--VVADRGLYHCFYEDATVESLSLDQLIQCDATI 229
              ++++G + L     P+    K I  V A +G Y  FYE+A+   + +      D  +
Sbjct: 186 NFAVLVNGVYDLSDIHVPNRSPNKVIKLVKASQGKYLGFYENASYRLIDVTPFSSNDIRV 245

Query: 230 QLIQHFIAIKQLNHYLQDHLDLIKRDLVAPYTEFLTKIC-DAAFGYXXXXXXXXXXXXXX 288
            L+ + I ++     L++ +++IK++L++P+  F+  +C DA  GY              
Sbjct: 246 NLLNNSIDLRNSVSLLKEQIEIIKKELISPFESFINLVCVDAYEGYDNLYRSMTNLLLTG 305

Query: 289 XXXXXXXNWFCYTVGEKNFKKWKKMGLEMYQKTIQILTLSFIPACERVILLSERCRACLK 348
                  +W   T+GE+N +KWK +G+E+  K +QIL+L FIP  E+ I+ +ER +  + 
Sbjct: 306 EISEEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEKFIITAERIQNYIT 365

Query: 349 ALQLIESSTTTDS-SEFANLTSLSQTYLRSTVETIQGVSAQEVLFQTFLQWFDDRLHEAL 407
           A++L ++S   ++ SE  +L       L+++++ I  ++  ++ F+ F+ W  + ++  +
Sbjct: 366 AMRLSDNSKILENDSEINDLILNLSNILKTSIKQIPILNNDKMAFEIFIDWIRNTIYLII 425

Query: 408 DEDYKQKLSIDSNCKIGYQIATYLDLR 434
           DE+YK KLS+ S+    + I  Y++L+
Sbjct: 426 DENYKSKLSLSSSNSYPFDIQKYINLQ 452

>NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8.270
           YDR118W
          Length = 735

 Score =  215 bits (548), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 140/497 (28%), Positives = 232/497 (46%), Gaps = 68/497 (13%)

Query: 12  NPLYSLYAKKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKRMTVFYKDGNAR 71
           NP + LY  K +  +   R  D  +I+ + +R++  +    WD  TGK +T+ + DG  R
Sbjct: 28  NPSFPLYLTKTSNSIIARRTLDGFQISNIIIRNMQNVIAIDWDSKTGKYLTINFDDGTFR 87

Query: 72  IYDAFQAGKLLALLRIS--------KTRVDGAIWDRIELSRQEVTFKFDHFVLNSMPKMI 123
           IYD FQ GKL+ L+R          KT+VD AIWDR+ +       +F+H +   MP +I
Sbjct: 88  IYDIFQDGKLITLVRPQRNLLDIHRKTKVDNAIWDRLIILNSIQELEFNHDITKLMPTLI 147

Query: 124 RFARDTRQIFILPYEPPNK--TWR-------------------LATEEEDGVKREKEILD 162
           +F +D+  I+I+PY    K   WR                   + T +E  V++    LD
Sbjct: 148 KFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAIDMTTNQE--VEKSMRYLD 205

Query: 163 VHLVHQED-NGLVLMLDGDFILRLAAGPSGPALKDIVV-----ADRGLYHCFYEDATVES 216
           +H++H  D +   + ++G + + L         ++ +V        G+YHCF+E+ ++ S
Sbjct: 206 LHIIHVIDPDCFTIAINGTYQINLVRKTINTTNRNKIVRILKSTVHGVYHCFHENGSIRS 265

Query: 217 LSLDQLIQCDATIQLIQHFIAIKQLNHYLQDHLDLIKRDLVAPYTEFLTKIC---DAAFG 273
           L           ++L++ F+ I ++  Y Q HLDLI + L+  +T+FL           G
Sbjct: 266 LYFSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLINKHLLKTFTDFLYPTIFEEKQNGG 325

Query: 274 YXXXXXXXXXXXXXXXXXXXXXNWFCYTVGEKNFKKWKKMGLEMYQKTIQILTLSFIPAC 333
                                  W   ++GEKN KKWK++  E+Y K+IQI +L+ IPAC
Sbjct: 326 GNSMLQQLKLSLLSGEMSEELIEWLTLSIGEKNLKKWKRLSEELYSKSIQIFSLALIPAC 385

Query: 334 ERVILLSERCRACLKALQ------------LIESSTTTD--------------SSEFANL 367
           E  +LLS++C A L A++            L  +ST T+              S  F  L
Sbjct: 386 ELTLLLSQKCLAILNAIEIEKKARIRAKSKLSTNSTHTNIELNSRQDKILTEFSPSFLEL 445

Query: 368 TSLSQTYLRSTVETIQGVSAQEVLFQTFLQWFDDRLHEALDEDYKQKLSIDSNCKIGYQI 427
             + Q +    ++ ++ +S  E     FL+W  + +  ALDED+  KL   SN  I   +
Sbjct: 446 IEILQKFGSRCLQNLRKISYIEKQSSLFLKWLQEMIFHALDEDHVPKLDTYSNPIICLDL 505

Query: 428 ATYLD--LRINPDKQSE 442
           + +L+  + ++ DK  E
Sbjct: 506 SNFLNKLIVLSTDKNKE 522

>NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {ON}
           Anc_8.270 YDR118W
          Length = 612

 Score =  209 bits (531), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 124/432 (28%), Positives = 208/432 (48%), Gaps = 18/432 (4%)

Query: 11  YNPLYSLYAKKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKRMTVFYKDGNA 70
           YNP Y     K + G ++ R  D+ +I  + +R+++ +    W+      +TV + DG+A
Sbjct: 11  YNPSYPAKLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNYLTVMFNDGSA 70

Query: 71  RIYDAFQAGKLLALLRIS---KTRVDGAIWDRIELSRQEVTFKFDHFVLNSMPKMIRFAR 127
           RI+D F+ GKL+ LLR+    +  +D  IW ++E+ ++    +FD  +   MP  I+F  
Sbjct: 71  RIHDIFREGKLMTLLRLQDGFQKCMDTGIWSKLEVRQKPNEGEFDRDISGLMPSPIKFVN 130

Query: 128 DTRQIFILPYEPPNKTWRLATEEEDGVKREKEILDVHLVHQED-NGLVLMLDGDFILRLA 186
           +  Q+ ++PY      WR      D      +I+D+H+ H  + +  +LM++G + L + 
Sbjct: 131 NAGQLEVVPYVVTQTQWR----NVDKPLEVNDIIDIHMAHNSNTDEYLLMINGVYKLTIQ 186

Query: 187 A-----GPSGPALKDIVVADRGLYHCFYEDATVESLSLDQLIQCDATIQLIQHFIAIKQL 241
                   S    K I +    ++HCFY+D    ++ L  L++    + L+     +KQL
Sbjct: 187 PNSTDENASNQLHKIIHLEKTAIFHCFYKDRKTSTIDLTTLMESTPHVSLLNVLTEMKQL 246

Query: 242 NHYLQDHLDLIKRDLVAPYTEFLTKICDAAFGYXXXXXXXXXXXXXXXXXXXXXNWFCYT 301
           + Y+ DHLD+I  DL  P  +FL                               +W C  
Sbjct: 247 HRYIVDHLDIIDNDLKKPLDDFLE--VTNILNIKDLSKSLKSFILYGLMAKSLNHWLCNV 304

Query: 302 VGEKNFKKWKKMGLEMYQKTIQILTLSFIPACERVILLSERCRACLKALQLIESSTTTDS 361
           VGEKN KKWK++    YQK IQI++L+ +PA E++ LLS RC A + A+ L  S    + 
Sbjct: 305 VGEKNLKKWKRLSETKYQKIIQIISLAVLPALEKLSLLSIRCEALVVAIALPASGHMQEL 364

Query: 362 SEFANLTSLSQTYLRSTVETIQGVSAQEVLFQTFLQWFDDRLHEALDEDYKQKLSIDSNC 421
             F +L   +       +   Q  S +E     F+ W  D + E +DEDY  KL+I   C
Sbjct: 365 EYFDSLKRTTAALCNQALNITQKTSEEEKKCSVFILWIQDLIFECVDEDYVPKLNI---C 421

Query: 422 KIGYQIATYLDL 433
           + G  + T +++
Sbjct: 422 EDGSVVPTLMEI 433

>TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON}
           Anc_8.270 YDR118W
          Length = 608

 Score =  206 bits (525), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 132/485 (27%), Positives = 223/485 (45%), Gaps = 21/485 (4%)

Query: 12  NPLYSLYAKKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKRMTVFYKDGNAR 71
           NP   L   K + GL + R AD + I    +R+ N +  +QW+   G  + +F++ G   
Sbjct: 13  NPTLPLTLCKSDSGLKVIRTADKSIIINYKIRNKNDIIYYQWENNIGNYVAIFFQRGTVM 72

Query: 72  IYDAFQAGKLLALLRISKTRVDGAIWDRIELSRQEVTFKFDHFVLNSMPKMIRFARDTRQ 131
           IYD  +  +LLA+L   K  VD  IWDR           FD  +   MP +I+  RD  +
Sbjct: 73  IYDGIKTSRLLAMLNGGKPNVDAGIWDRYYFPNDNEKDIFDSDITLYMPTLIQIIRDKEK 132

Query: 132 IFILPYEPPNKTWRLATEEEDGVKREKEILDVHLVHQE-DNGLVLMLDGDFILRLAAGPS 190
           I    Y PP+ TWR   EE      + E LD+HL+H   D+    +L+G+  L   +  +
Sbjct: 133 ICPGTYFPPHSTWRAKKEE----SLKNEFLDIHLLHHSVDDSFTFILNGELKLPFPSNST 188

Query: 191 GPALKDIVVADRGLYHCFYEDATVESLSLDQLIQCDATIQLIQHFIAIKQLNHYLQDHLD 250
                 I+  +   + CFY+D TV  +    L+Q      L+ HFI I  L  YL++H+ 
Sbjct: 189 SGRAIGIIKGENNCFICFYQDLTVRMIDCHDLLQLKGNEILVDHFIRINHLLKYLKEHIM 248

Query: 251 LIKRDLVAPYTEFLTKICDAAFGYXXXXXXXXXXXXXXXXXXXXXNWFCYTVGEKNFKKW 310
            IK ++  P+ EFLT +   A                         W   T+G KN  +W
Sbjct: 249 FIKDNMSTPFNEFLTSVKGEA-TQEMMMENLITMLVSGYISTELEEWIRNTIGIKNLTRW 307

Query: 311 KKMGLEMYQKTIQILTLSFIPACERVILLSERCRACLKAL----QLIESSTTTDSSEFAN 366
             +G   Y+K + I+TL  IPACER ++L  R +  ++ +    +        +SS   N
Sbjct: 308 ATLGGIFYEKGVDIITLMVIPACERFMILVARLQGLIEYVIVRNRCDNRGVNLNSSYIEN 367

Query: 367 LTSLSQTYLRSTVETIQGVSAQEVLFQTFLQWFDDRLHEAL-DEDYKQKLSID--SNCKI 423
           +   ++ +++  +  ++ +  Q+ LF+ FL WF + +   + DE     + +   +NC+ 
Sbjct: 368 VKHAAKRFMKEALRMLEQLQLQKQLFEKFLHWFSENVRGVVQDEAVSGNILVKNVNNCR- 426

Query: 424 GYQIATYLDLRINPDKQSEYDNKFLKLQTFQEILDTMSQNLQLIRDREIEPKVLQKITRV 483
              I  YL+  +         N+  +L  F++ L+ + +NL L+    +EP +   I+  
Sbjct: 427 --DIVEYLEWSMGGGP-----NRVTELTQFEKELEVVQENLNLLNQDFVEPALSVAISIG 479

Query: 484 NRHNL 488
           +R N+
Sbjct: 480 DRKNI 484

>CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly
           similar to uniprot|Q04601 Saccharomyces cerevisiae
           YDR118w APC4 subunit of the anaphase promoting complex
          Length = 622

 Score =  202 bits (513), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 128/425 (30%), Positives = 217/425 (51%), Gaps = 44/425 (10%)

Query: 11  YNPLYSLYA-KKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKRMTVFYKDGN 69
           YNP Y L+   + N  L I R +DN  I  + VR++ +L  + WDPI GK + +F KDG+
Sbjct: 13  YNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPIDGKYLALFLKDGS 72

Query: 70  ARIYDAFQAGKLLALLRI-------SKTRVDGAIWDRIELSR---QEVTFKFDHFVLNSM 119
            RIYD F  GKL++ LR+       +K  +D  +WDRI + +    E+    ++ +  SM
Sbjct: 73  VRIYDIFNGGKLISFLRVLPVVLGSNKPSLDCCLWDRIIIPKSGSSELRIP-NNDLTESM 131

Query: 120 PKMIRFARDTRQIFILPYEPPNKTWRLATEEEDGVKREKEILDVHLVHQEDNGLV-LMLD 178
           P +++F +D +QI I+P     K WR           EK+++DVHL +   +  V ++++
Sbjct: 132 PTLVKFVQDAKQIDIIPNRSITKLWRSIG------NNEKKVVDVHLGYSCSSAQVTILIN 185

Query: 179 GDFILRLAAGPSGPALKDIVVA------DRGLYHCFYEDATVESLSLDQLIQCDATIQLI 232
           G++++  +        K I ++         +Y   ++D +   + L  ++  D  + LI
Sbjct: 186 GEYLIEKSVSDINQIQKKIPISLNKKEFCEAIYEIHFDDYSRLQIDLTGILLNDDKLDLI 245

Query: 233 QHFIAIKQLNHY--LQDHLDLIKRDLVAPYTEFLTKICDAAFGYXXXXXXXXXXXXXXXX 290
           +    IK  NH+  ++DH +LI++ ++APY EFL  I     G                 
Sbjct: 246 ET--QIKMTNHFDLIKDHFNLIEKSVLAPYYEFLESI-----GGINDLDVLERLFLIGEL 298

Query: 291 XXXXXNWFCYTVGEKNFKKWKKMGLEMYQKTIQILTLSFIPACERVILLSERCRACLKAL 350
                NWF  T+ EKN KKW ++G E Y    Q+L + F+P CER+++L+ R    +K +
Sbjct: 299 DTKLGNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERLMVLTNRINGMIKGI 358

Query: 351 QLIESSTTT--DSSEFANLTSLSQTYLRSTVETIQGVSAQEVLF-QTFLQWFDDRLHEAL 407
            L ES  T+  D SE        Q++L   ++ +  ++  E  F Q FL W  D+++E++
Sbjct: 359 DLQESQETSLLDISEL-------QSFLNLVLKLLAELNEDETYFKQDFLPWLTDKVYESI 411

Query: 408 DEDYK 412
           + +YK
Sbjct: 412 NNEYK 416

>SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 644

 Score =  191 bits (486), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 130/439 (29%), Positives = 217/439 (49%), Gaps = 48/439 (10%)

Query: 11  YNPLYSLYAKKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKRMTVFYKDGNA 70
           +NP+ SL+     KG+++ R  D  +IATV+V+D   +  +QW+   G+   V + +G  
Sbjct: 20  WNPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQWEQSEGRIFAVCHSNGII 79

Query: 71  RIYDAFQAGKLLALLRISKTRVDGAIWDRIELSRQEVTFK------FDHFVLNSMPKMIR 124
           R+YD+  AGK +  + +  +  D     +   S+   TF       FDH + + MP++++
Sbjct: 80  RLYDSSLAGKSVGSVILGDSDCDVL---KFCWSQDSWTFGSKFSNVFDHEITSLMPRLVK 136

Query: 125 FARDTRQIFILPYEPPNKTWRLATEEEDGVKREKEILD-----VHLVHQEDNGLVLM-LD 178
           F +D+RQ+ +LP           T+  DGV R  + LD     + L +      +LM +D
Sbjct: 137 FVKDSRQLTMLP-----------TDVGDGVPRWSK-LDGNKSFIFLGYDSKRQKILMAID 184

Query: 179 GDFIL------------RLAAGPSGPA-LKDIVVADRGLYHCFYEDATVESLSLDQLIQC 225
           G F L            RL  G S P  ++DI+  D G Y    +D  ++ +  D  + C
Sbjct: 185 GAFKLSFSVAALVAAGERLDEGDSVPNNVRDILKYDNGEYLVITDDWYIQKIKFD-FLNC 243

Query: 226 DATIQLIQHFIAIKQLNHYLQDHLDLIKRDLVAPYTEFLTKICDAAFGYXXXXXXXXXXX 285
           + T ++I     I+ L+  L + + L+K +LV PYT+F+ ++  A  G            
Sbjct: 244 NLTREMISCCNRIRSLHKQLHESVSLVKTELVEPYTQFIERVLGAYEG--DLIGDLTELL 301

Query: 286 XXXXXXXXXXNWFCYTVGEKNFKKWKKMGLEMYQKTIQILTLSFIPACERVILLSERCRA 345
                     +W   T+G+KN ++WKK+   MY+  ++I+ L+ +P CER+IL  ER   
Sbjct: 302 FTGSVPPELEDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERLILCGERLHG 361

Query: 346 CLKALQLIESSTTTDSSEF---ANLTSLSQTYLRSTVETIQGVSAQEVLFQTFLQWFDDR 402
            +K L+LI      D+ E      L  LSQ  L + + +I+ ++    L + F+ WF D 
Sbjct: 362 IIKGLKLIGLKELEDNLEVLEAQKLVCLSQEALENIIVSIKQINVDSNLHEAFIDWFHDM 421

Query: 403 LHEALDEDYKQKLSIDSNC 421
           + EA+DEDYK+K S   NC
Sbjct: 422 VMEAVDEDYKRKTSY--NC 438

>KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C)
          Length = 645

 Score =  175 bits (443), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 124/424 (29%), Positives = 205/424 (48%), Gaps = 28/424 (6%)

Query: 11  YNPLYSLYAKKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKRMTVFYKDGNA 70
           +NP  SLY    +K +S+ R  D  +IA V +R    L   QW+   GK   +F+ +G  
Sbjct: 21  WNPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLRGDGQLIGAQWELAEGKLFALFFGNGAV 80

Query: 71  RIYDAFQAGKLLALLRI------SKTRVDGAIWDRIELSRQEVTFK-FDHFVLNSMPKMI 123
           RIYD    G L  ++ +      +   VD A+W   + ++    +K  +  +   +P M+
Sbjct: 81  RIYDCATGGSLREVVDLVDEGQSADVTVDTAVWSGAQWAQFRQEYKGLNIEITKQLPGMV 140

Query: 124 RFARDTRQIFILPYEPPNKTWRLATEEEDGVKREKEILDVHLVHQEDNGLVLM-LDGDFI 182
           R  RD +Q+ ++P E     W LA   +D          + L H E +G  LM +DG   
Sbjct: 141 RLVRDAKQLSVVPLETGKLRW-LADPGKDAA--------IFLGHDEKSGDYLMTVDGLLS 191

Query: 183 LRLAAGPSG--PALKDIVVADRGLYHCFYEDATVESLSLDQLIQCDATIQLIQHFIAIKQ 240
           +R+   PSG     K +   + G +     D TV+ + L + +      +LI++   I+ 
Sbjct: 192 VRV---PSGIKKMHKILRQGEDGTFVGVGADGTVQWVVL-RFLNSALMRELIRYSGQIRF 247

Query: 241 LNHYLQDHLDLIKRDLVAPYTEFLTKICDAAFGYXXXXXXXXXXXXXXXXXXXXXNWFCY 300
           L  YL +++++ K DL+ PY +FLT+I DA  G                      +W C 
Sbjct: 248 LCSYLTENINMCKTDLIEPYRQFLTRIADAYEG-GELASRFRDIILSGYIPEDLEDWLCN 306

Query: 301 TVGEKNFKKWKKMGLEMYQKTIQILTLSFIPACERVILLSERCRACLKALQLIE----SS 356
           ++G+KN+K+WK++   MY     +L L+ IPACER+IL +E+ +   K L+L E    S 
Sbjct: 307 SIGDKNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGIHKGLKLQEFGLASP 366

Query: 357 TTTDSSEFANLTSLSQTYLRSTVETIQGVSAQEVLFQTFLQWFDDRLHEALDEDYKQKLS 416
              +S+E   L +  Q  L +++E +  ++    L   F  WF D + E +DEDYK+  +
Sbjct: 367 QEFESAEVTELITGCQALLHASLELVVDLNRDTRLHAIFADWFYDVVMETVDEDYKRPQN 426

Query: 417 IDSN 420
            DS+
Sbjct: 427 RDSH 430

>Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {ON}
           YDR118W (APC4) - subunit of the anaphase promoting
           complex (APC) [contig 173] FULL
          Length = 740

 Score =  172 bits (437), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 116/414 (28%), Positives = 198/414 (47%), Gaps = 22/414 (5%)

Query: 11  YNPLYSLYAKKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKRMTVFYKDGNA 70
           +NP  SLY    +K +++ RV D  +IA V +RD + +   QW+    K   VF  +G  
Sbjct: 21  WNPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVGIQWEKNESKLFAVFQSNGVV 80

Query: 71  RIYDAFQAGKLLALLRI------SKTRVDGAIWDRIELSRQEVTFK-FDHFVLNSMPKMI 123
           RIYD    G L  ++ +      ++ +VD  +W  +E ++   +++  D  +   MP M+
Sbjct: 81  RIYDCSIGGSLREMVNLVEEGQAAEVKVDAVVWMTVEWAKFPESYRGLDFDITTLMPGMV 140

Query: 124 RFARDTRQIFILPYEPPNKTWRLATEEEDGVKREKEILDVHLVHQEDNGLVLMLDGDFIL 183
           R  RD++Q+ + P +    +W       DG   +  I   H    E    ++ +DG   L
Sbjct: 141 RLVRDSKQLSLAPLDLGKLSWL------DGKYGDAAIFLAH--DCESTEYMVAIDGQLSL 192

Query: 184 RLAAGPSGPALKDIVVADRGLYHCFYEDATVESLSLDQLIQCDATIQLIQHFIAIKQLNH 243
           R  +G      K +     G +    +D T++ ++L + ++C    +L++    I+ L  
Sbjct: 193 RFPSGIRN-VHKILPQGGSGSFLAVGKDGTLQWVTL-KFLECALMRELVKSSGQIRFLCR 250

Query: 244 YLQDHLDLIKRDLVAPYTEFLTKICDAAFGYXXXXXXXXXXXXXXXXXXXXXNWFCYTVG 303
           YL +++ L   +L+ PY  FLT++  A  G                       W C +VG
Sbjct: 251 YLAENVSLCHTELIEPYRVFLTRLMGAYEG-DDLATRLRDILLTGYIPDDLEEWLCNSVG 309

Query: 304 EKNFKKWKKMGLEMYQKTIQILTLSFIPACERVILLSERCRACLKALQL----IESSTTT 359
           +KN+K+WK++   MY     +LTL+ +PACER+IL +ER +   K+L+L     + +   
Sbjct: 310 DKNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGIHKSLKLQRFCKDYAGEL 369

Query: 360 DSSEFANLTSLSQTYLRSTVETIQGVSAQEVLFQTFLQWFDDRLHEALDEDYKQ 413
            + E   L S  QT L  T+  I  ++    L Q F +WF D + E +DEDYK+
Sbjct: 370 TTVELQTLISECQTLLEFTLNLITELNRDAALHQVFAEWFYDVVMETVDEDYKR 423

>AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR118W
           (APC4)
          Length = 715

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 90/438 (20%), Positives = 172/438 (39%), Gaps = 59/438 (13%)

Query: 11  YNPLYSLYAKKFNKGLSICRVADNAKIATVAVR--DLNVLAQFQWDPITGKRMTVFYKDG 68
           +N   SL+     + LSI R  D  ++  + +R      L + QW+P  G+   V  + G
Sbjct: 20  WNDRLSLWGVLEKEVLSIFRYIDGRRVGAIPLRLRQNEELLRCQWEPDDGELFAVALRSG 79

Query: 69  NARIY---------DAFQAGKLLALLRISKT---RVDGAIWDRIELS-RQEVTFKFDHFV 115
           + +IY         +  +  +L+  + + +    +++  +W+RI+   R+    +FD  +
Sbjct: 80  SVKIYRGRLDPEGTEGSEGAELVGTVVLGRGDAFQMEQFVWNRIKWRVREPFCGEFDSPL 139

Query: 116 LNSMPKMIRFARDTRQIFI---LPYEPPNKTWRLATEEEDGVKREKEILDVHLVHQEDNG 172
           +  +P++   +   +   +   L YE P     LA +E +            +    DN 
Sbjct: 140 VQWLPRLTEMSISAQGKLLCTPLGYEGPEWNAGLAADESN------------MFLTFDNN 187

Query: 173 ---LVLMLDGDFILRLAAGPSGPALKDIVVADRGLYHCFY--EDATVESLSLD------- 220
              +VL +DG F  R       P     ++     ++ F   ED  ++ + L+       
Sbjct: 188 TRKVVLSIDGTFNFRYGEKSKFPTKVTSILPGNENHYVFINDEDWQLQVIRLEFTEYHQV 247

Query: 221 -QLIQCDATIQLIQHFIAIKQLNHYLQDHLDLIKRDLVAPYTEFLTKICDAAFGYXXXXX 279
            +L++C + IQ          L  Y++D+  LI   L+ P+  F   +            
Sbjct: 248 HELMKCCSHIQF---------LLKYIRDNHRLIGTKLMEPHATFTGSLFPEEQFTKFMKG 298

Query: 280 XXXXXXXXXXXXXXXXNWFCYTVGEKNFKKWKKMGLEMYQKTIQILTLSFIPACERVILL 339
                           NWF   +G      WK+     +  +  +L    IPACER+I+ 
Sbjct: 299 LKDVFYLGYSDDKTVENWFTLKLGRHGTAIWKQRNHLFWSSSQGVLVTCMIPACERLIVS 358

Query: 340 SERCRACLKALQL----IESSTTTDSSEFANLTSLSQTYLRSTVETIQGVSAQEVLFQTF 395
           ++R    +K+L+L    ++      + E  +L  +S   L+  VE ++     E + +  
Sbjct: 359 AKRLLGLVKSLKLNVFGLDDDNELTAVEVQDLLQMSLGLLKGLVEQVEQFHVGENVSKDG 418

Query: 396 LQWFD---DRLHEALDED 410
           L W +   D L    DED
Sbjct: 419 LAWIEYMMDSLLHNEDED 436

>Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}
           similar to Ashbya gossypii AGR078C
          Length = 715

 Score = 63.9 bits (154), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 72/369 (19%), Positives = 133/369 (36%), Gaps = 44/369 (11%)

Query: 11  YNPLYSLYAKKFNKGLSICRVADNAKIATVAVR--DLNVLAQFQWDPITGKRMTVFYKDG 68
           +N   SL+       ++I R  D  K+ ++ +R      +   Q +P  G    V  + G
Sbjct: 20  WNDRLSLWGIHEKGNVNIFRYIDGRKMGSIPLRLKSNEEILTCQLEPNDGDLFAVVLRSG 79

Query: 69  NARIY------------DAFQAGKLLALLRISKTRVDGAIWDRIEL-SRQEVTFKFDHFV 115
           + ++Y            D       + L R     ++  +W+RI+  SR      FD  +
Sbjct: 80  SVKVYKGRQDVDSSDPTDGADMVGTIVLGRGEWFNMEQFVWNRIKWKSRGAFKGDFDTVL 139

Query: 116 LNSMPKMIRFARDTR-QIFILPYEPPNKTWRLATEEEDGVKREKEILDVHLVHQEDNGLV 174
              +PK+       + ++   P E     W  +  E +         ++ L +      V
Sbjct: 140 TQWLPKLTEMNVSPQGKLTCTPLEFEGPEWNASLSENES--------NMFLTYDNATRKV 191

Query: 175 LM-LDGDFILRLAAGPSGPALKDIVVADRGLYHCFYEDAT----------VESLSLDQLI 223
           ++ +DG F  R       P     +++     + F  D             ES  + +L+
Sbjct: 192 MVSIDGTFNFRYGEKNKFPTKVTNILSGNANNYVFLNDEDWQLQIIKLEFTESHQMHELM 251

Query: 224 QCDATIQLIQHFIAIKQLNHYLQDHLDLIKRDLVAPYTEFLTKICDAAFGYXXXXXXXXX 283
           +C + IQ          L  YL+D+  +I   L+ P+  F+  +                
Sbjct: 252 KCCSQIQF---------LMKYLRDNHKIIGVKLMEPHATFINSLFPDEQASRLLKGLKDV 302

Query: 284 XXXXXXXXXXXXNWFCYTVGEKNFKKWKKMGLEMYQKTIQILTLSFIPACERVILLSERC 343
                       NWF   +G      WK+     +  +  IL    IPACER+I+  +R 
Sbjct: 303 FYLGYSAEKNIENWFTLKLGRHGISIWKQRNHLFWSSSQGILVTCMIPACERLIVAVKRL 362

Query: 344 RACLKALQL 352
           +  +K+L+L
Sbjct: 363 QGLIKSLKL 371

>NDAI0G05430 Chr7 (1330372..1332813) [2442 bp, 813 aa] {ON}
           Anc_1.267 YJL099W
          Length = 813

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 54/108 (50%), Gaps = 9/108 (8%)

Query: 25  GLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKRMTVFYKDGNARIYDAFQAGKLLAL 84
           GL++ R+ + +K   VA    +++A+F  DP++ +++   Y D +  ++    A  LL L
Sbjct: 691 GLTLLRICNESK--AVACLQTSIMARF--DPVSCEKLFQLYLDDDCSVFSHLNADTLLEL 746

Query: 85  LRISKTRVDGAIWDRIELSRQEVTFKFDHF----VLNSMPKMIRFARD 128
           L   K   D   +D +++   +V +K  +     V+ S    +R+A D
Sbjct: 747 L-TRKIPFDSRFYDSMQILNYKVLYKLMNVMGTDVIRSKVMALRYAED 793

>Kpol_325.2 s325 complement(4458..5777) [1320 bp, 439 aa] {ON}
           complement(4458..5777) [1320 nt, 440 aa]
          Length = 439

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 44/101 (43%), Gaps = 11/101 (10%)

Query: 180 DFILRLAAGPSGPA-LKDIVVADRGLYHCFYEDATVESLSLDQLIQCDATIQ-------- 230
           D+IL   +G + PA +  +   D GL  C Y D  +  L  + +++C   I         
Sbjct: 165 DYILLETSGIADPAPIAKMFWQDEGLNSCIYIDGIITVLDSENVLKCLDDISPETHWHGE 224

Query: 231 --LIQHFIAIKQLNHYLQDHLDLIKRDLVAPYTEFLTKICD 269
             ++++ + +      + D + L K D +     F+TKI D
Sbjct: 225 KVIMENNLTVAHFQIAMADRILLNKFDKIENDPNFITKIED 265

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,288,947
Number of extensions: 2368857
Number of successful extensions: 7119
Number of sequences better than 10.0: 33
Number of HSP's gapped: 7220
Number of HSP's successfully gapped: 35
Length of query: 619
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 503
Effective length of database: 40,180,143
Effective search space: 20210611929
Effective search space used: 20210611929
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 69 (31.2 bits)