Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0F039608.269ON55854827320.0
Suva_2.2768.269ON56555817370.0
YDR117C (TMA64)8.269ON56555816950.0
Skud_4.3778.269ON56255516900.0
ZYRO0C01496g8.269ON56755816800.0
NCAS0B038008.269ON56555716630.0
Smik_4.3618.269ON56555816430.0
TPHA0J007808.269ON58356116330.0
Kpol_392.28.269ON56655816050.0
SAKL0H16874g8.269ON56355615950.0
KLTH0G13530g8.269ON57456315900.0
Kwal_56.237718.269ON56255515690.0
NDAI0J013108.269ON57956815300.0
CAGL0B01837g8.269ON56955915040.0
KAFR0B054708.269ON56255614590.0
KNAG0H032008.269ON56155812031e-159
KLLA0F19294g8.269ON57056811921e-157
Ecym_43018.269ON56456311881e-157
TBLA0I032008.269ON56355811641e-153
AGR079W8.269ON54254910801e-141
NCAS0I027301.203ON39562732.3
TBLA0A092105.685ON25269679.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0F03960
         (558 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {O...  1056   0.0  
Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON...   673   0.0  
YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}  ...   657   0.0  
Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON...   655   0.0  
ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} simila...   651   0.0  
NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.2...   645   0.0  
Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON...   637   0.0  
TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {...   633   0.0  
Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)...   622   0.0  
SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} simi...   619   0.0  
KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} simi...   617   0.0  
Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117...   608   0.0  
NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8....   593   0.0  
CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {...   583   0.0  
KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON} Anc_8...   566   0.0  
KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.2...   468   e-159
KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]...   463   e-157
Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar t...   462   e-157
TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {O...   452   e-153
AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic ho...   420   e-141
NCAS0I02730 Chr9 (505260..506447) [1188 bp, 395 aa] {ON} Anc_1.2...    33   2.3  
TBLA0A09210 Chr1 complement(2282468..2283226) [759 bp, 252 aa] {...    30   9.7  

>TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {ON}
           Anc_8.269 YDR117C
          Length = 558

 Score = 1056 bits (2732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/548 (94%), Positives = 516/548 (94%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60
           MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60

Query: 61  NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE 120
           NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE
Sbjct: 61  NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE 120

Query: 121 RCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKID 180
           RCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKID
Sbjct: 121 RCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKID 180

Query: 181 IXXXXXXXXXXXXXXXXXXXXXXXXSPKRETFHTEISIEDVAQVLDELSVEDVDHFFTRA 240
           I                        SPKRETFHTEISIEDVAQVLDELSVEDVDHFFTRA
Sbjct: 181 IEPAVLSSEPVEEEEEEEGKEKLTESPKRETFHTEISIEDVAQVLDELSVEDVDHFFTRA 240

Query: 241 LYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTAKFLKHFEKVGFL 300
           LYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTAKFLKHFEKVGFL
Sbjct: 241 LYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTAKFLKHFEKVGFL 300

Query: 301 QLKGKGDDLVIVGVNKNKDELKNFVPYKTSGQTASKKNSNKDSSPGMMYSEKLYKPINLG 360
           QLKGKGDDLVIVGVNKNKDELKNFVPYKTSGQTASKKNSNKDSSPGMMYSEKLYKPINLG
Sbjct: 301 QLKGKGDDLVIVGVNKNKDELKNFVPYKTSGQTASKKNSNKDSSPGMMYSEKLYKPINLG 360

Query: 361 KDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVXXXXXXXXMFYRKKKTQE 420
           KDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMV        MFYRKKKTQE
Sbjct: 361 KDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVLLDDLLFDMFYRKKKTQE 420

Query: 421 TPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLPRVKIVTEMKIGRKVVTR 480
           TPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLPRVKIVTEMKIGRKVVTR
Sbjct: 421 TPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLPRVKIVTEMKIGRKVVTR 480

Query: 481 VSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGAHGPLIIDYLNKQGIP 540
           VSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGAHGPLIIDYLNKQGIP
Sbjct: 481 VSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGAHGPLIIDYLNKQGIP 540

Query: 541 TKWIDFES 548
           TKWIDFES
Sbjct: 541 TKWIDFES 548

>Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  673 bits (1737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/558 (58%), Positives = 415/558 (74%), Gaps = 11/558 (1%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60
           MFKKEPHIKALSNLKNSERKKLLQ+CK+QT   +Y F TS +KQTN+ GQ S GTVYTD+
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60

Query: 61  NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE 120
           NN PI FKEKH E LFPTVYSCW    LLPIVLTH FVIEE LFNGANLM++G++PPFD 
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKID 180
           RC    +CG+ASR  PK++LA+G+V+++LPSYS VIG+ G+AVK++H+F DGL +AFK+ 
Sbjct: 121 RCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKVK 180

Query: 181 IXXXXXXXXXXXXXXXXXXXXXXXXSPK-----RETFH-TEISIEDVAQVLDELSVEDVD 234
           +                          K     RE      I+IE++A+VLD LSV DVD
Sbjct: 181 LEPPAAFDVASEDEDIDNTQIEIQEGTKTTEKTRENVQEANINIEEIAEVLDHLSVSDVD 240

Query: 235 HFFTRALYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTAKFLKHF 294
           +F TRALYYT T D  L +PI+ASNFISNHI+ NLPP+D ++VN+K+TSWKK+AKFLKHF
Sbjct: 241 YFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSAKFLKHF 300

Query: 295 EKVGFLQLKGKGDDLVIVGVNKNKDELKNFVPYKTSGQTASK---KNSN-KDSSPGMMYS 350
           EK GFL+LKGKGDDL IVG N +KDELKNFVPYK     ++K   +N+N K+ + GMMYS
Sbjct: 301 EKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSKEKTSGMMYS 360

Query: 351 EKLYKPINLGKDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVXXXXXXXX 410
             LYKP NL KD ++ ++LP +  YT  +++ ++ QYI+ K LVD+K+K  V        
Sbjct: 361 LTLYKPFNLAKDLVKEANLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVVMDDLLYN 420

Query: 411 MFYRKKKTQETPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLPRVKIVTE 470
           M  +KKK  +  R + RAQI+DP +ANNFTEFYQ++K++DT L + P++G  PR+KI+TE
Sbjct: 421 MVNKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTPMKGSPPRIKIITE 480

Query: 471 MKIGRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGAHGPLI 530
           MKIGRKV+T+VS+FE  ++DPE LAA+LRK+CSGSTTIGE+ T  K AEVQVQG HG LI
Sbjct: 481 MKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTF-KSAEVQVQGPHGQLI 539

Query: 531 IDYLNKQGIPTKWIDFES 548
           ID+LNK G+P KWIDFE+
Sbjct: 540 IDHLNKSGVPNKWIDFEN 557

>YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}
           TMA64Protein of unknown function that associates with
           ribosomes; has a putative RNA binding domain; in mammals
           the corresponding protein, eIF2D, has been shown to
           possess translation initiation factor activity
          Length = 565

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/558 (56%), Positives = 403/558 (72%), Gaps = 11/558 (1%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60
           MFKKEPHIKALSNLKNSERKKLLQ+ ++QT   +Y+F TS +KQTN+ GQ S GTVYTD+
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60

Query: 61  NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE 120
           NN PI FKEKH E LFPTVYSCW  P LLPIVLTH FVIEE LFNGANLM++G++PPFD 
Sbjct: 61  NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKID 180
           RC    +CGIAS+  P+ +LAIG+V+L+LPS+  VIG+ G+AVK++H+F DGL + FK+ 
Sbjct: 121 RCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKMK 180

Query: 181 ------IXXXXXXXXXXXXXXXXXXXXXXXXSPKRETFHTEISIEDVAQVLDELSVEDVD 234
                 +                          + +     + +E++A+VLD  +V DVD
Sbjct: 181 LEPPFVLSTQSKDNNISSKQIESSEQIKAVEKEQEDVKEASVDVEEIAEVLDHFTVSDVD 240

Query: 235 HFFTRALYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTAKFLKHF 294
           +F TRALYYT T D GL +PI+ASNFISNHI+ NLPP+D ++VN+KKTSWKK+AKFLKHF
Sbjct: 241 YFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSAKFLKHF 300

Query: 295 EKVGFLQLKGKGDDLVIVGVNKNKDELKNFVPYK----TSGQTASKKNSNKDSSPGMMYS 350
           EK GFL+LKGKGDDL IVG N +KDELKNFVPYK     S   + +  ++K+ + GMMYS
Sbjct: 301 EKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSKSATESRESTTSKEKTSGMMYS 360

Query: 351 EKLYKPINLGKDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVXXXXXXXX 410
             LYKP NL KD ++  +L     YT  +++ +V+QYI+ K L D+K+K  V        
Sbjct: 361 LTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVIMDDLLFD 420

Query: 411 MFYRKKKTQETPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLPRVKIVTE 470
           M  +KKK     R ++R +I+ P + NNFTEFYQ+FK +DT LFK P++G LP +KI+TE
Sbjct: 421 MVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKGSLPHIKIITE 480

Query: 471 MKIGRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGAHGPLI 530
           MKIGRKV+TRVS+FE F++DPE LAA+LRK+CSGSTTI E+ T  K AEVQVQG HG  I
Sbjct: 481 MKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTF-KCAEVQVQGPHGQSI 539

Query: 531 IDYLNKQGIPTKWIDFES 548
           ID+LNK GIP+KWIDFE+
Sbjct: 540 IDHLNKLGIPSKWIDFEN 557

>Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON}
           YDR117C (REAL)
          Length = 562

 Score =  655 bits (1690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/555 (57%), Positives = 405/555 (72%), Gaps = 8/555 (1%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60
           MFKKEPHIKALSNLKNSERKKLLQ+CK+QT   +Y F TS +KQTN+  Q S G VYTD+
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60

Query: 61  NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE 120
           NN PI FKEKH E LFPTVYSCW  P LLPI+LTH FVIEE LFNGANLM++G++PPFD 
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKID 180
           R     +CG+ASR  PKV+LAIG+V+++LPSY  V+G+ G+AVKV+H+F DGL +A K+ 
Sbjct: 121 RSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKVK 180

Query: 181 I---XXXXXXXXXXXXXXXXXXXXXXXXSPKRETFHTEISIEDVAQVLDELSVEDVDHFF 237
           +                           + +      ++ +E++A+VLD  SV DVD+F 
Sbjct: 181 LDPPIAKSGDEDINSKQVQPPEEAKIVENAQENMQKAQVHVEELAEVLDHFSVSDVDYFI 240

Query: 238 TRALYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTAKFLKHFEKV 297
           TRALYYT T D  L +PI+ SNFISNHI+ NLPP+D ++VN+KKTSW+K+AKFLKHFEK 
Sbjct: 241 TRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSAKFLKHFEKE 300

Query: 298 GFLQLKGKGDDLVIVGVNKNKDELKNFVPYK----TSGQTASKKNSNKDSSPGMMYSEKL 353
           GFL+LKGKGDDL IVG   +KDELKNFVPYK    TS Q + +  ++K+ +PGMMYS  L
Sbjct: 301 GFLKLKGKGDDLTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSKEKTPGMMYSMTL 360

Query: 354 YKPINLGKDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVXXXXXXXXMFY 413
           YKP ++ KDF++ ++L  +  YT  +++ +++QYI+   L D+K+K  V        M  
Sbjct: 361 YKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKVVMDDLLFNMVN 420

Query: 414 RKKKTQETPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLPRVKIVTEMKI 473
           +KKK     R + RAQI+DP +ANNFTEFYQ+FK++D+ LFK PI+G  PR+KI TEMKI
Sbjct: 421 KKKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAPIKGSPPRIKITTEMKI 480

Query: 474 GRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGAHGPLIIDY 533
           GRKV+TRVS+FE F++DPE LA +LRK+CSGSTTIGE+ T  K AEVQVQG HG LIID+
Sbjct: 481 GRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTF-KSAEVQVQGPHGQLIIDH 539

Query: 534 LNKQGIPTKWIDFES 548
           LN  G+P KWIDFE+
Sbjct: 540 LNNLGVPNKWIDFEN 554

>ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 567

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/558 (58%), Positives = 407/558 (72%), Gaps = 12/558 (2%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60
           MFKK+PH+KALSNLKNSE KKLL +C+ QTG  +Y+F T ++KQTN++ Q   GTVYTD 
Sbjct: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60

Query: 61  NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE 120
           +N PIWFKEKHG LL+PTV++CW+ P LLP+VLTH FV+EERLFNGANLMLAGT+ PFD 
Sbjct: 61  DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS 120

Query: 121 RCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKID 180
           R  P  VCGIAS+  P V++A+GVVQL+LPSY SV+G+ G+AV+++HY  DGL + FK++
Sbjct: 121 RLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKVN 180

Query: 181 ----IXXXXXXXXXXXXXXXXXXXXXXXXSPKRETFHTEISIEDVAQVLDELSVEDVDHF 236
               +                        S +  +    + I+D+A+VLDE  +EDVD F
Sbjct: 181 AEPPVSLEDSDEEEEEEEEVLEESAQQPSSQEIPSQEKAVDIDDIAEVLDEFRLEDVDQF 240

Query: 237 FTRALYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTAKFLKHFEK 296
            TRALYYT THDT L +PI+ASNFISNHI  NLP VD  +VN+KK+SWKKTAKFLK+FEK
Sbjct: 241 LTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTAKFLKNFEK 300

Query: 297 VGFLQLKGKGDDLVIVGVNKNKDELKNFVPYK-----TSGQTASKKNSNKDSSPGMMYSE 351
            GFL+LKGKGDDL I+G+NK K EL+NF PY+       G  +S  N+ KD SP  +  E
Sbjct: 301 EGFLKLKGKGDDLTIIGINKQKPELQNFQPYQISGGSGGGGNSSSNNNKKDGSP-QLRCE 359

Query: 352 KLYKPINLGKDFIQCSDLPPKN-LYTVTELKDSVNQYITAKKLVDSKNKKMVXXXXXXXX 410
            LYKPINL KDFIQ +DL P++ LYT  ELK+++N YI +  L DSKNKKMV        
Sbjct: 360 TLYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMVILDDLLYH 419

Query: 411 MFYRKKKTQETPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLPRVKIVTE 470
           +  +K+K    PR VSRA I++P +AN+FT  +Q++K  D PLFKNP RG LP ++IVTE
Sbjct: 420 LVNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKG-DIPLFKNPSRGNLPNIEIVTE 478

Query: 471 MKIGRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGAHGPLI 530
           MKIGRKV+TRVS FE F +D ++LAA LR+LCSGSTTIGET+TSPK  EV VQG HGPLI
Sbjct: 479 MKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTVQGPHGPLI 538

Query: 531 IDYLNKQGIPTKWIDFES 548
           ID+LN  GIPTKWI F++
Sbjct: 539 IDHLNSLGIPTKWIKFDN 556

>NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.269
           YDR117C
          Length = 565

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/557 (56%), Positives = 404/557 (72%), Gaps = 10/557 (1%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60
           MF+KEPHIKALSNLKNS+RKKL Q+   QTG   Y    SIVKQTN++   + GT+YTD+
Sbjct: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYT-CPSIVKQTNFQTPTTIGTIYTDE 59

Query: 61  NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE 120
            N+PIWFKEKH   L+ TVY+CW   +LLPI L+HDFVI+E+LFNGANLM++GT+PPFDE
Sbjct: 60  KNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDE 119

Query: 121 RCVPAKVCGIASRTDP-KVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKI 179
           +     +CG+AS  DP +V+ AIG+V ++LP +  V+G+ G+AV+++H+F D L ++FKI
Sbjct: 120 KLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKI 179

Query: 180 DIX------XXXXXXXXXXXXXXXXXXXXXXXSPKRETFHTEISIEDVAQVLDELSVEDV 233
           D+                                  +   T  ++ED+A+VLD LSV+DV
Sbjct: 180 DLKPPVVDVQKGSVNDEEEEEEEKEQEKANEEDETTKEMSTATNVEDLAEVLDHLSVQDV 239

Query: 234 DHFFTRALYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTAKFLKH 293
           D+F TRALYYT T DT L++PI+ASNFIS HI  NLP VD ++VN+KK+SWKKTAKFLKH
Sbjct: 240 DYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKKTAKFLKH 299

Query: 294 FEKVGFLQLKGKGDDLVIVGVNKNKDELKNFVPYKTSGQTASKKNSNK--DSSPGMMYSE 351
           FEK GFL+LKGKGDDL +VG+NK KDELKNFVPYK        K + K  DS  GMMYS 
Sbjct: 300 FEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKLGSSNGENKGAKKEGDSQSGMMYSI 359

Query: 352 KLYKPINLGKDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVXXXXXXXXM 411
             YKPINL KD I+ S +P KNLY  TE++D VN YIT K LVD+KNKKMV        M
Sbjct: 360 TFYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMVLLDDLLFGM 419

Query: 412 FYRKKKTQETPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLPRVKIVTEM 471
             +K+      R +SRAQI++P + NNFTE +Q++  + TPLFK+P+RG  PR+KI+TEM
Sbjct: 420 VNKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLFKSPMRGSPPRIKILTEM 479

Query: 472 KIGRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGAHGPLII 531
           KIGRKV+T+VS+FE F ++PE LAA+LRK+CSGSTTIGET+TSPK AEVQVQG HG +II
Sbjct: 480 KIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAEVQVQGPHGQIII 539

Query: 532 DYLNKQGIPTKWIDFES 548
           D+LNK G+PTKWID+E+
Sbjct: 540 DHLNKLGVPTKWIDYEN 556

>Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/558 (57%), Positives = 414/558 (74%), Gaps = 11/558 (1%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60
           MFKKEPHIKALSNLKNSERKKLLQ+C +QT   +Y F TSI+KQTN+ GQ S GTVYTD+
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60

Query: 61  NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE 120
           NN+PI FKEKH E L+PTVYSCW  P+LLPIVLTH FVIEE LFNGANLM++G++PPFD 
Sbjct: 61  NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS 120

Query: 121 RCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKID 180
           RC    +CG+A +  PKV+LAIGVV+L+LPSY  VIG+ G+AVKV+H+F DGL +AFK+ 
Sbjct: 121 RCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKVK 180

Query: 181 -----IXXXXXXXXXXXXXXXXXXXXXXXXSPKRETF-HTEISIEDVAQVLDELSVEDVD 234
                +                           +E+   T   +E+VA+VLD L+V DVD
Sbjct: 181 LEPPVVLNTESEDENINSKQTETPEQVKSADKSQESIKKTAPDLEEVAEVLDHLTVSDVD 240

Query: 235 HFFTRALYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTAKFLKHF 294
           +F TRALYY+ T D GL +PI+AS FISNHI+ NLPP+D ++VN+KK+SWKK+AKFLKHF
Sbjct: 241 YFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWKKSAKFLKHF 300

Query: 295 EKVGFLQLKGKGDDLVIVGVNKNKDELKNFVPYKTSGQTASKKN----SNKDSSPGMMYS 350
           EK G L+LKGKGDDL IVG N +KDELKNFVPYK    + SK +    ++KD + GMM+S
Sbjct: 301 EKEGILKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENATSKDRTSGMMHS 360

Query: 351 EKLYKPINLGKDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVXXXXXXXX 410
             LYKP +L KD ++ + L     YT  +++++V++YI+ K L D K+K+ V        
Sbjct: 361 LTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLADKKDKRKVVMDDLLFN 420

Query: 411 MFYRKKKTQETPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLPRVKIVTE 470
           M  +KKKT +T R ++R++I+ P ++NNFTEFYQ+F+++DT LF+ P++G  PR+KIVTE
Sbjct: 421 MVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMKGCPPRIKIVTE 480

Query: 471 MKIGRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGAHGPLI 530
           MKIGRKV+T+VS+FE F +DPE LAA+LRK+CSGSTTIGE+ T  K AEVQVQG HG  I
Sbjct: 481 MKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTF-KSAEVQVQGPHGQFI 539

Query: 531 IDYLNKQGIPTKWIDFES 548
           IDYLNK GIP+KWIDFE+
Sbjct: 540 IDYLNKSGIPSKWIDFEN 557

>TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {ON}
           Anc_8.269 YDR117C
          Length = 583

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/561 (55%), Positives = 404/561 (72%), Gaps = 14/561 (2%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60
           MFKK P++KA SNLKNSERKKLLQSCKEQ  +SDYNF +SI+KQ NYKGQ S GTVYTD+
Sbjct: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60

Query: 61  NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE 120
            NVPIWFKEKH ++LFP+VY+CW  P LLPI++T+ +VIEE++ NGANLM++GTL PFDE
Sbjct: 61  QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE 120

Query: 121 RCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKID 180
           R +   +CGIAS   P V++AIG+VQL+L SY+ V+G+ G+AV V+HY  DGL  +FK++
Sbjct: 121 RLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKMN 180

Query: 181 IXXXXXXXXXXXXXXXXXXXXXXXXSPKRETFHTEISIE-----DVAQVLDELSVEDVDH 235
           +                        + +    + +++ +     D+A+VL+ L V+ +D 
Sbjct: 181 LEPPETGAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDARPNDDLAEVLETLPVDIIDD 240

Query: 236 FFTRALYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTAKFLKHFE 295
           F T++LYY+ T+D  L  PI+ASNFISN+I+ NLPPVD   VN+KK+SWKKTAKFL+HFE
Sbjct: 241 FITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWKKTAKFLRHFE 300

Query: 296 KVGFLQLKGKGDDLVIVGVNKNKDELKNFVPYKT--SGQTASKKNSNKDSSPG--MMYSE 351
           K GF++LKGK DDLVI G NK K ELK+FVPY+T     T SKK+   D+S    MM S 
Sbjct: 301 KEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTGNGNSTKSKKDKTNDTSDNGDMMQSV 360

Query: 352 KLYKPINLGKDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVXXXXXXXXM 411
             YKPI+LGKD I+ S  P K+LYT  EL+D + +YI  K LVDSKNKKM+        +
Sbjct: 361 SYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKMILMDDLMYSL 420

Query: 412 FYRKKKTQETPRCVSRAQIMDPFIANNFTEFYQLFKDED----TPLFKNPIRGPLPRVKI 467
            Y+KK + E PR +SRA +++P   NNF E +Q++K  D     PLFK PIRG +P+V+I
Sbjct: 421 VYKKKNSAE-PRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKKPIRGSIPKVEI 479

Query: 468 VTEMKIGRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGAHG 527
           VTEMKIGRKV+TRVS+FE F +D E LAA+LRKLC+G+TTIGET+TSPK AEVQVQG H 
Sbjct: 480 VTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSPKTAEVQVQGPHS 539

Query: 528 PLIIDYLNKQGIPTKWIDFES 548
            +II +LN   IPTKWIDF++
Sbjct: 540 QVIIKHLNSLSIPTKWIDFKN 560

>Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)
           [1701 nt, 567 aa]
          Length = 566

 Score =  622 bits (1605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/558 (58%), Positives = 403/558 (72%), Gaps = 11/558 (1%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60
           MFKK PHIK+LSNLKNSERKKLLQSCK QTG++DYNF TS++KQTN+  Q S G +YTD+
Sbjct: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60

Query: 61  NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE 120
              P+WFKEKH ELLFPTVY+CW  P LLPIVLTHD VI E +FNGANLM++GTLPPFD 
Sbjct: 61  EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS 120

Query: 121 RCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKI- 179
           R VPA +CGIA+R +P  I+A+GVVQL++PSYSSVIG+ G+AV V+HY+ DG+  AFK+ 
Sbjct: 121 RLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKMK 180

Query: 180 -DIXXXXXXXXXXXXXXXXXXXXXXXXSPKRETFHT--EISIEDVAQVLDE---LSVEDV 233
            DI                          ++    +  EIS  DV+++  E   L+VED+
Sbjct: 181 RDIPTIVGGKDKSVDATENDQSPVIITEEEKTEDDSIPEISSNDVSELAQEESALTVEDI 240

Query: 234 DHFFTRALYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTAKFLKH 293
           DHF TR+LYYT T+D  L  PI +S+FISNHI+ NLPPVD + VN+KKTSWKK++KFLKH
Sbjct: 241 DHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKSSKFLKH 300

Query: 294 FEKVGFLQLKGKGDDLVIVGVNKNKDELKNFVPYK---TSGQTASKKNSNKDSSPGMMYS 350
           FEK GF++LKGKG+DL IVG NK K+ELK F PY+   +S  +  K NSN+  S  MMYS
Sbjct: 301 FEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRISNSSSNSGKKINSNRQESENMMYS 360

Query: 351 EKLYKPINLGKDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVXXXXXXXX 410
              Y P    K F+  ++LP KN YT  ELK++V +YI  K+LVD KN KM         
Sbjct: 361 LVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANLDDRLYD 420

Query: 411 MFYRKKKTQETPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLPRVKIVTE 470
           M Y KK T   PR ++RA +++ F  NNFTE YQLFK++DTPL KNP+RG  PR+KIVTE
Sbjct: 421 MCYTKKSTNP-PRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPVRGSPPRIKIVTE 479

Query: 471 MKIGRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGAHGPLI 530
           MKIGRK+VTRVS+FE+F +D + LA +LR+LCSGSTTIGET TSPK  EVQVQG H  +I
Sbjct: 480 MKIGRKIVTRVSNFESFGIDADALAGDLRRLCSGSTTIGETTTSPKTTEVQVQGPHSKII 539

Query: 531 IDYLNKQGIPTKWIDFES 548
           ID+LN   IPTKWIDFE+
Sbjct: 540 IDHLNSLSIPTKWIDFEN 557

>SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 563

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/556 (55%), Positives = 391/556 (70%), Gaps = 14/556 (2%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60
           MFKK+PHIKALSNLKNSERKKLL S +EQ   SDY F T +VKQT +KGQ S GTVYTD+
Sbjct: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60

Query: 61  NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE 120
            NVPIWFKEKHG L+FPTV++CW+ P++LP+V TH  V+EE+L  GA+LML G +PPF  
Sbjct: 61  QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS 120

Query: 121 RCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKID 180
           +C    + G+AS   P+VI AIG+VQL+LPSY+ VIG+ G+AV ++H F DGLC+AFK+ 
Sbjct: 121 KCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKMK 180

Query: 181 IXXXXXXXXXXXXXXXXXXXXXXXXSPKRETFHTE----ISIEDVAQVLDELSVEDVDHF 236
           +                           +    T     ++ ED ++ L+ELS ED+DHF
Sbjct: 181 LEPPEAIEDTSSKTEEQEEEHVDSADEAKAIATTTQARMVNTEDASEQLNELSAEDIDHF 240

Query: 237 FTRALYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTAKFLKHFEK 296
            TR+LYYT T D  L +P+NASNF+SNHIL NLPPVD +Q+NMKK+SWKK+AKFLKHFEK
Sbjct: 241 LTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSAKFLKHFEK 300

Query: 297 VGFLQLKGKGDDLVIVGVNKNKDELKNFVPYKTSG-----QTASKKNSNKDSSPGMMYSE 351
             FL+LKGKGDDLV+VG+NK+KDELK FVPY+        QT +K   N +    MM + 
Sbjct: 301 ANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGSHGEPTQTKAKAQENSN----MMQAV 356

Query: 352 KLYKPINLGKDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVXXXXXXXXM 411
            LYKPI+  K+F +  DLPP  ++T  ELK +++ YI  K LV+  +KKMV        M
Sbjct: 357 SLYKPISSAKEFSKAVDLPPNKIFTAQELKAALDSYILKKNLVNKDDKKMVLLDDTLFPM 416

Query: 412 FYRKKKTQETPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLPRVKIVTEM 471
             R  K +   R +SRAQIM PF+ANNFTE +Q+ K  D PLFK  ++G +P ++IVTEM
Sbjct: 417 INRSTKKENALRTISRAQIMPPFLANNFTEHFQILKG-DVPLFKTALKGAIPEIQIVTEM 475

Query: 472 KIGRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGAHGPLII 531
           KIGRKVVT+VS+FE F+LD E LAA LRK CSGSTTIGET++SPK  EV VQG HG ++I
Sbjct: 476 KIGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVTVQGPHGAIVI 535

Query: 532 DYLNKQGIPTKWIDFE 547
             LN+ GIPTKWI+F+
Sbjct: 536 GMLNEYGIPTKWINFQ 551

>KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 574

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/563 (52%), Positives = 390/563 (69%), Gaps = 17/563 (3%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60
           MFKKEP IKALSNLKNSERK +   CKEQTG+S+Y F + ++KQT +K   + GTV+TDQ
Sbjct: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQTTFKTPFTTGTVFTDQ 60

Query: 61  NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE 120
            NVPIWFKEK  +LL+PTV++CW+   LLPIVL H++V+EE+L  GANLML GT+PPFDE
Sbjct: 61  KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120

Query: 121 RCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKID 180
           RCV  ++  +AS   P V+ AIG+VQ+NLP YS VIG+ G+AV+++H F D LC+ FK+ 
Sbjct: 121 RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKVK 180

Query: 181 IXXXXXXXXXXXXXXXXXX----------XXXXXXSPK--RETFHTEISIEDVAQVLDEL 228
           +                                  +PK  ++     +++ED+++ L EL
Sbjct: 181 LQPPEGSAAILDSESEEEADIEDDTGVPSAPESLAAPKSLQDVQEPLVNVEDISEQLTEL 240

Query: 229 SVEDVDHFFTRALYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTA 288
            VEDVDHFFTR+LYY+  HD  L  PI+ASNF+SNHIL NLPP+D +QVNMKKTSWKKTA
Sbjct: 241 RVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTSWKKTA 300

Query: 289 KFLKHFEKVGFLQLKGKGDDLVIVGVNKNKDELKNFVPYKTSGQTASKKN-----SNKDS 343
           KFLK+FEK GFL+LKGKGDDL I+GV++ K ELKNF PY+  G  +S +      +N+  
Sbjct: 301 KFLKYFEKEGFLKLKGKGDDLTIIGVDRTKSELKNFAPYRIGGGASSSEKGASSVANEKE 360

Query: 344 SPGMMYSEKLYKPINLGKDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVX 403
              +M +  LY+PI+  K F+  +DLPP  ++T  ++K +V++YI+AK LV   NK  V 
Sbjct: 361 QASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLVSPDNKSAVR 420

Query: 404 XXXXXXXMFYRKKKTQETPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLP 463
                  +  R  K +   R ++RAQIM P +  NF+E + + K + TPLFK+P++G +P
Sbjct: 421 LDDLLYDLVNRSSKKENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPLFKHPVKGSIP 480

Query: 464 RVKIVTEMKIGRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQ 523
           +V+IVTEMKIGRKVVT+VS+FE F++D ++LA  LRK CSGSTTIGE  TSPK  EV VQ
Sbjct: 481 QVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKTLEVTVQ 540

Query: 524 GAHGPLIIDYLNKQGIPTKWIDF 546
           G HGP +I+ LN+ GIPTKWI+F
Sbjct: 541 GPHGPAVIELLNESGIPTKWINF 563

>Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117C -
           Hypothetical ORF [contig 173] FULL
          Length = 562

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/555 (54%), Positives = 388/555 (69%), Gaps = 13/555 (2%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60
           MFKKEP IKALSNLKNSERKKL   C+EQ   SDY+F + ++KQT +K   + GTVYTD 
Sbjct: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQTTFKTPFTTGTVYTDD 60

Query: 61  NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE 120
            N+PIWFKEK  +LL+PTV+SCW+  +L+PIVL H++V+EE+L  GANLML GT+PPFDE
Sbjct: 61  KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120

Query: 121 RCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKI- 179
           RCV  K+ G+AS   P V+ AIG+VQLNLP YS VIG+ G+AV+++H F D LC+AFK+ 
Sbjct: 121 RCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKVK 180

Query: 180 --------DIXXXXXXXXXXXXXXXXXXXXXXXXSPKRETFHTEISIEDVAQVLDELSVE 231
                    I                        +P +E     ++I+D A+ L +LSVE
Sbjct: 181 LQPPEGADGIAESDSEENSDAEVSGAIKIEPKPSAPLQEPI---VNIDDAAEQLSQLSVE 237

Query: 232 DVDHFFTRALYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTAKFL 291
           DVDHFFTRALYYT T D+ L +P +ASNF+SNHIL NLPP+D +QVNMKKTSWKKTAKFL
Sbjct: 238 DVDHFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTAKFL 297

Query: 292 KHFEKVGFLQLKGKGDDLVIVGVNKNKDELKNFVPYKTSGQTASKKNSNKDSSPGMMYSE 351
           KHFEK GFL+LKGKGDDL IVG++K KDELK+FVPY+T G +     S  + +  MM + 
Sbjct: 298 KHFEKEGFLKLKGKGDDLTIVGLDKTKDELKHFVPYRTGGNSGGSTGSESEQN-SMMKAL 356

Query: 352 KLYKPINLGKDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVXXXXXXXXM 411
            +YKP++  K F+  +DL P ++++  ELK +V+ YI +K LV   NK  V        +
Sbjct: 357 VIYKPMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLDDLLFSL 416

Query: 412 FYRKKKTQETPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLPRVKIVTEM 471
             R  K +   R + RAQIM P +  NF E + + K + TPLFK+P++G +P+++IVTEM
Sbjct: 417 VNRSTKKENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIPQIQIVTEM 476

Query: 472 KIGRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGAHGPLII 531
           KIGRKVVT+VS+FE F++D ++LA  LRK CSGSTTIGET TSPK  EV VQG HGP +I
Sbjct: 477 KIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGETTTSPKTTEVTVQGPHGPAVI 536

Query: 532 DYLNKQGIPTKWIDF 546
           + LN+  IPTKWI+F
Sbjct: 537 ELLNQLAIPTKWINF 551

>NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8.269
           YDR117C
          Length = 579

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/568 (52%), Positives = 395/568 (69%), Gaps = 22/568 (3%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTS-IVKQTNYKGQH--SDGTVY 57
           MFKKEPHIKALSNLKNS+RKKLLQ+ K QT    YNF+ S I+KQTN++  +  S GT++
Sbjct: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60

Query: 58  TDQNNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPP 117
           T+ +N+PIWFK KH +LL+PTV++CW   ++LP +L+HDFVI+E+LFNGANLM++GT+PP
Sbjct: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120

Query: 118 FDERCVPAKVCGIASRTDPK-VILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQA 176
           FD R +P  +CGIAS  DPK ++ AIGVV++N+PS+  V+G+ G+AV+V+H+F D L + 
Sbjct: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180

Query: 177 FKIDIXXXXXXXXXXXXXXXXXXXXXXXXSPKRETFHTEISIEDVAQVLDELSVEDVDHF 236
           FK +                            R+      S E   +VLD    EDVD+F
Sbjct: 181 FKCNDLKPDEFVKEQLNTEHPQDNDVADEDTTRKKEENRESNEPDFEVLDHFKTEDVDYF 240

Query: 237 FTRALYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTAKFLKHFEK 296
            TR+LYYT T DT + +PI+ASNFIS HI  NLP +  ++VN+KKTSWKKTAKFLKHFEK
Sbjct: 241 ITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTSWKKTAKFLKHFEK 300

Query: 297 VGFLQLKGKGDDLVIVGVNKNKDELKNFVPYKTSGQT------ASKKNSNKDSSPGMMYS 350
            GFL+LKGKGDDL +VG+NK KDELKNFVPYK    T      +S   ++K  + GMMYS
Sbjct: 301 EGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNTNDKSDTKGMMYS 360

Query: 351 EKLYKPINLGKDFIQC-SDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVXXXXXXX 409
           E  YKPIN  KD ++    +P K LYT  E++D V  YI +K L+D KNKKM+       
Sbjct: 361 ETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMKNKKMILLDDLLF 420

Query: 410 XMFY-RKKKTQETPRCVSRAQIMDPFIANNFTEFYQLFKDED---------TPLFKNPIR 459
            M + R+ +    PR + R  I++P +ANNFTE YQ+++  +          PLFK+P R
Sbjct: 421 NMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGELMEDVEPLFKSPQR 480

Query: 460 GPLPRVKIVTEMKIGRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAE 519
           G LP++ I+TEMKIGRKV+T+VS+FE F +  + LAA+LRKLCSGSTTIGET+TSPK  E
Sbjct: 481 GHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGSTTIGETMTSPKTPE 540

Query: 520 VQVQGAHGPLIIDYLNKQ-GIPTKWIDF 546
           VQVQG HG +IID+LNK+ G+PTKWI++
Sbjct: 541 VQVQGPHGQIIIDHLNKKFGVPTKWINY 568

>CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117c
          Length = 569

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/559 (52%), Positives = 388/559 (69%), Gaps = 12/559 (2%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60
           MFKKEPHIKALSNLKNSERKKL + C+ QT   +Y+F ++ +KQTN+KG  + GT+YTD+
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60

Query: 61  NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE 120
            N PIWFKEKH E L+PTV +CW  PNL+P+VLTH  V+E+ +FNGANLM++GT+PPFDE
Sbjct: 61  GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE 120

Query: 121 RCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKI- 179
           R     VCGIA +  P +I+A+G+VQ+NLPS++ VIG+ G+AV+++H+  D L + FK+ 
Sbjct: 121 RLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKVK 180

Query: 180 -----DIXXXXXXXXXXXXXXXXXXXXXXXXSPKRETFHTEISIEDVAQVLDELSVEDVD 234
                ++                            +T   + +++D+A+VLDEL +ED+D
Sbjct: 181 EEPPAELLQTQSSSSEELELEADIHEDETKVESNSDTEKEKSNLDDMAEVLDELRLEDID 240

Query: 235 HFFTRALYYTFTHDTGLNIPINASNFISNHILPNLPP-VDQSQVNMKKTSWKKTAKFLKH 293
           +F TRALYYT + DT L  P +ASNF+SNHI  NLP   + ++VN+KK+SWKKTAKFLKH
Sbjct: 241 YFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKKTAKFLKH 300

Query: 294 FEKVGFLQLKGKGDDLVIVGVNKNKDELKNFVPYKTSGQTASKKNSNKDSSPGMMYSEKL 353
           FEK GFL+LKG GDDL IV VNK+KDE+K F+PY   G   S   S   ++   +    L
Sbjct: 301 FEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQGSNTGSEGGNAKTTIKIVTL 360

Query: 354 YKPINLGKDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVXXXXXXXXMFY 413
           YKPINL KDFI  + +P K LY   E+K+ +N+YIT K LVD K+KK V        M Y
Sbjct: 361 YKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITMKDLVDKKDKKCVLVDDMLMTMIY 420

Query: 414 RKKKTQET-PRCVSRAQIMDPFIANNFTEFYQLFK---DEDTPLFKNPIRGPLPRVKIVT 469
           +KK+ Q T  R + RA I+ P + NNF + Y LF+   +E TPL K P++G  P++ IVT
Sbjct: 421 KKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKTPLKGEPPKINIVT 480

Query: 470 EMKIGRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSP-KVAEVQVQGAHGP 528
           EMKIGRKV+T+VS+FE F++DPE+ AA++RK CSGSTTIGET +S  K AEVQVQG HG 
Sbjct: 481 EMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCSGSTTIGETTSSAKKTAEVQVQGPHGQ 540

Query: 529 LIIDYLNKQGIPTKWIDFE 547
           LI+ YLN  GIP KWIDFE
Sbjct: 541 LIMSYLNDLGIPNKWIDFE 559

>KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON}
           Anc_8.269 YDR117C
          Length = 562

 Score =  566 bits (1459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/556 (51%), Positives = 377/556 (67%), Gaps = 11/556 (1%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGA-SDYNFSTSIVKQTNYKGQHSDGTVYTD 59
           MFKKEP IKALS LKNS+RKKL+QS K Q  +  D + +   + QTN+    + GT+YTD
Sbjct: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60

Query: 60  QNNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFD 119
            N++PI FK KH + L+PT +  W+   LL  V TH  V+E  +FNGA+LM+AGT+PPFD
Sbjct: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120

Query: 120 ERCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKI 179
                  +C +A++  P V +A+G+V+LNLP Y  V+G+ G+AV+++H+F D L   FK 
Sbjct: 121 STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA 180

Query: 180 DIXXXXXXXXXXXXXXXXXXXXXXXXSPKRETFHTEISI----EDVAQVLDELSVEDVDH 235
            +                          + ++     S     +D+A+VLDEL+VEDVD+
Sbjct: 181 KLEIPASVKSILQEETTADVAKESDAEQESQSVTEPPSGSEGPDDIAEVLDELTVEDVDY 240

Query: 236 FFTRALYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTAKFLKHFE 295
           F  RALY+T   D  L +P+ AS F+SNHI+ NLP VD  +VN+K+TSWKKTAKFLK+FE
Sbjct: 241 FIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSWKKTAKFLKYFE 300

Query: 296 KVGFLQLKGKGDDLVIVGVNKNKDELKNFVPYKTSGQTASKKNSNKDSSPGM---MYSEK 352
           K GFL+LKGKGDDL+IVG+NK+KDELKNFVPYK  G TA K  S  DS+      + S  
Sbjct: 301 KEGFLKLKGKGDDLIIVGMNKDKDELKNFVPYKI-GNTAKKAASKSDSTQTQGVSVSSVN 359

Query: 353 LYKPINLGKDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVXXXXXXXXMF 412
           LYKPINLG+ FI+ S++    +YT  E+++ +N YI  K LVD K+KKMV        M 
Sbjct: 360 LYKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKKMVMLDDLLFAMV 419

Query: 413 YRKKKTQETPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLPRVKIVTEMK 472
            RK +    PR + RA I++P IANNF E++QL+K ++TPLFKNPI+G  P++ IVTEMK
Sbjct: 420 NRKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNPIKGQTPKIDIVTEMK 479

Query: 473 IGRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGAHGPLIID 532
           IGRKVVTRVS+FE F++ PE+LAA+LRKLCSGSTTI E  T  KV+EVQVQG HG LIID
Sbjct: 480 IGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISE--TPKKVSEVQVQGPHGQLIID 537

Query: 533 YLNKQGIPTKWIDFES 548
           + NK GIP+K+I FE+
Sbjct: 538 HFNKSGIPSKFIQFEN 553

>KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.269
           YDR117C
          Length = 561

 Score =  468 bits (1203), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 248/558 (44%), Positives = 360/558 (64%), Gaps = 16/558 (2%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60
           MFKK PHIK LSNLKNSE++KL Q  ++Q G  ++ FS + VKQTN++   S GT+Y + 
Sbjct: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60

Query: 61  NN--VPIWFKEKHGE-LLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPP 117
               VP++FKEKHG   L+P+VY+CW+ P LLPI+LTH  VIE+ LFNGANLM++GT+PP
Sbjct: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120

Query: 118 FD-ERCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKV--MHYFTDGLC 174
           FD       + CGIA+   P VI+A+G ++++L  +++        V V   H+F DGL 
Sbjct: 121 FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTGVVGHSGVVVEVAHHFADGLA 180

Query: 175 QAFKIDIXXXXXXXXXXXXXXXXXXXXXXXXSPKRETFHTEISIEDVAQVLDELSVEDVD 234
            AF++ +                        +         ++++D+A+VL+ LSVEDVD
Sbjct: 181 DAFRLKLDIPDKLESATTQEVAEEPPVEAKPT---SPVTNPVAVDDLAEVLETLSVEDVD 237

Query: 235 HFFTRALYYTFTHDTGLNIPINASNFISNHILPNLPP-VDQSQVNMKKTSWKKTAKFLKH 293
           +F TRALYYT T +  L +PINASNF+S H++  LP  +D ++VN+KK+SWKKTAK+LKH
Sbjct: 238 YFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWKKTAKYLKH 297

Query: 294 FEKVGFLQLKGKGDDLVIVGVNKNKDE--LKNFVPYKTSGQTASKKNSNKDSSPGMMYSE 351
           FEK G L+LKGKGDDLV+VG   +K    LK+FVPY      A     ++ ++  +M++ 
Sbjct: 298 FEKEGLLKLKGKGDDLVVVGSTDSKTHAGLKDFVPYLVGNSIAESGPKSQTTNGPVMFAV 357

Query: 352 KLYKPINLGKDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVXXXXXXXXM 411
             ++P +  +  +       +  ++  E+++ +N+YITA KL    N KMV        M
Sbjct: 358 TSFQPDSTAQTALPLGG---QRYFSGPEIREVLNEYITANKLAQPNNPKMVLLNDTLFGM 414

Query: 412 FYR-KKKTQETPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLPRVKIVTE 470
             +  ++ Q T R ++R +I++  +  +F   YQLFKD+DTPL K+P +G  P+V I+TE
Sbjct: 415 VTKGNEEKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPLTKHPQKGEPPKVHIITE 474

Query: 471 MKIGRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGAHGPLI 530
           MKIGRKVVTRV +F+   +   + AA+LRKLCS STTIG+TV++P V+E+QVQGAHGPLI
Sbjct: 475 MKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTPVVSEIQVQGAHGPLI 534

Query: 531 IDYLNKQGIPTKWIDFES 548
           ID+L + G+P+ W+ FE+
Sbjct: 535 IDHLRELGVPSSWVVFEN 552

>KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]
           {ON} similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117C RBF64 Hypothetical ORF
          Length = 570

 Score =  463 bits (1192), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 253/568 (44%), Positives = 352/568 (61%), Gaps = 28/568 (4%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60
           MF KEPHIK LSNLKNS+RKKL  + K Q    +YN  T+++KQT+++  +  G++YTD+
Sbjct: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQIN-EEYNLPTAVIKQTSFQVANVAGSIYTDE 59

Query: 61  NNVPIWFKEKHGELLFPTVYSCWTAP-NLLPIVLTHDFVIEERLFNGANLMLAGTLPPFD 119
           +N PIWFK K  + L+PT++S W     LLPI+LTHDFVIE+ +  GA LML GT+PPF 
Sbjct: 60  SNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFP 119

Query: 120 ERCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKI 179
                  + GIAS  DP ++ AIG+ +++L   S VIG  GIAV+V+HY  DGL +AFK+
Sbjct: 120 SNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKL 179

Query: 180 DIXXXXXXXXXXXXXXXXXXXXXXXXSPK--RETFHTEIS-----IEDVAQVLDELSVED 232
           ++                          +   E+ H E S     + ++A  L+E+S+ED
Sbjct: 180 ELEPPAVVYNSEPIETTAIETQTSKYGEQLDEESNHLERSSSQSPVNEIADELEEMSIED 239

Query: 233 VDHFFTRALYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTAKFLK 292
           VDH   RA+ Y+   D  + +PI AS FISNH++ NLP VD + VN+KK+SWKK  K LK
Sbjct: 240 VDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSSWKKATKLLK 299

Query: 293 HFEKVGFLQLKGKGDDLVIVGVNKNKDELKNFVPYKT--------SGQTASKKNSNKDSS 344
           + E  GFL+LKGK D   ++ +NKN  +L N   YKT        SG T ++ N NK ++
Sbjct: 300 YLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQSNKNKITA 359

Query: 345 PGMMYS-EKLYKPINLGKDFIQ--CSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKM 401
               YS E LYKP++  + FI    +D+ P++ YT  ELK  ++ Y+    L+D +NK +
Sbjct: 360 ----YSGENLYKPMSACQRFITGITADV-PQSYYTQQELKKLLDLYVANNNLIDPENKSL 414

Query: 402 VXXXXXXXXMFYRKKKTQETPRCVSRAQIMDP-FIANNFTEFYQLFKDEDTPLFKNPIRG 460
           V        M  R  +     + ++R  I+ P F++ NF  ++Q++K    PL K P +G
Sbjct: 415 VKYDDTLYQMSNRAPQNGGIQK-IARGLIVSPTFLSKNFNTYHQIYKPNGEPLLKVPEKG 473

Query: 461 PLPRVKIVTEMKIGRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEV 520
           P+P ++IVTE KIGRKV+TRV++FE FK+D E+LAA LRK CSGSTTIGE+  S K AEV
Sbjct: 474 PIPTLEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGES-KSTKTAEV 532

Query: 521 QVQGAHGPLIIDYLNKQGIPTKWIDFES 548
           QVQG HG ++I  LN  GIPTKWI FE+
Sbjct: 533 QVQGPHGSIVISILNDYGIPTKWISFEN 560

>Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar to
           Ashbya gossypii AGR079W
          Length = 564

 Score =  462 bits (1188), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 238/563 (42%), Positives = 353/563 (62%), Gaps = 21/563 (3%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60
           MFKK+P IK+ SNLKNSERKKLL + + Q    ++ FST+IVKQ  +K   + GT++TD+
Sbjct: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60

Query: 61  NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE 120
           +N PI+FKEKH E L PT+ +CW  P LL +VLTH  V++ +L NGA+LML GT+PPF +
Sbjct: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGLLHVVLTHKHVLDNKLKNGADLMLPGTIPPFSD 120

Query: 121 RCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKID 180
            C   K+ G+AS   P V+ AIGV QLNL     V+G+ G+AVKV+H   DGL + FK+ 
Sbjct: 121 NCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKMS 180

Query: 181 IXXXXXXXXXXXXXXXXXXXXXXXXS---------PKRETFHTEI----SIEDVAQVLDE 227
           +                        +         P  +T    +    S+ +VA+ L+E
Sbjct: 181 VEPPSQLLVSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEPNSLSEVAEQLEE 240

Query: 228 LSVEDVDHFFTRALYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKT 287
           LS+E VDHF T+A+YYT   D  L +PI ASNFI+NH++ NLP + ++QV++K++SW + 
Sbjct: 241 LSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRSSWARA 300

Query: 288 AKFLKHFEKVGFLQLKGKGDDLVIVGVNKNKDELKNFVPYKT--SGQTASKKNSNKDSSP 345
           +KFLK+FE  GFL+LKGK ++L +V VNK+K E+K+F PY+T     + S KN++K    
Sbjct: 301 SKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYRTIQKSVSTSSKNNDKHDVE 360

Query: 346 GMMYSEKLYKPINLGKDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVXXX 405
            ++Y    Y+P+N  K  +      P  +    ++K  +N+Y+T KKLV++ +++++   
Sbjct: 361 VVVY----YQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNATDERIILLD 416

Query: 406 XXXXXMFYRKKKTQETPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLPRV 465
                + Y+K  +  T R V RA++ D  ++ +FTE + +FKD   PL   P++     V
Sbjct: 417 DTLFSLAYKKSASDST-RKVLRAKMFDLILSTSFTEVFFIFKD-GKPLSSKPLKSKNRNV 474

Query: 466 KIVTEMKIGRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGA 525
            ++TEMKI RK+VTR+S+FE + +DPE+L+  LRK CSGS+T+ E  T     EVQVQG 
Sbjct: 475 SVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQSTTEVQVQGP 534

Query: 526 HGPLIIDYLNKQGIPTKWIDFES 548
           HG   I+ LN+ GIP+K+IDF++
Sbjct: 535 HGNTAINILNEHGIPSKYIDFDN 557

>TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {ON}
           Anc_8.269 YDR117C
          Length = 563

 Score =  452 bits (1164), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 230/558 (41%), Positives = 335/558 (60%), Gaps = 18/558 (3%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60
           MFKK   I  LSNLKNSE + + Q+C++    ++Y F  S VKQT ++   ++G +YTD 
Sbjct: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60

Query: 61  NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE 120
           NNVPIWFK+K+   + PTVY+ W  PN +PI+ THDF+IE ++FNGANLM+ GT+ P DE
Sbjct: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120

Query: 121 RCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKID 180
           R  P K+CGIAS   P  ILAIG+   ++ +  + +G+ G+AV+V+H+++D L   FKI 
Sbjct: 121 RLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKIK 180

Query: 181 I------------XXXXXXXXXXXXXXXXXXXXXXXXSPKRETFHTEISIEDVAQVLDEL 228
           +                                    +P  +TF +  + +D+A+ L++L
Sbjct: 181 LNPPTIMNTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTS--NADDLAETLEQL 238

Query: 229 SVEDVDHFFTRALYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTA 288
            VED+D+F T++LYYT T +T L +PI +S F+S +++ NLP VD +QVN+KK+SWKKTA
Sbjct: 239 RVEDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSSWKKTA 298

Query: 289 KFLKHFEKVGFLQLKGKGDDLVIVGVNKNKDELKNFVPYKTSGQTASKKNSNKDSSPGMM 348
           KFLKHFEK GFL+LKGKGDDL I G NK K +LK FVPY+      +  + +K  +   +
Sbjct: 299 KFLKHFEKEGFLKLKGKGDDLTITGFNKEKPQLKTFVPYRIGKPAGALPSKDKQDNKNFL 358

Query: 349 YSEKLYKPINLGKDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVXXXXXX 408
               LY P            L  K+ +T  E+  ++  YI  K L + K+K  +      
Sbjct: 359 KVVTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKDKAKISMDDVL 418

Query: 409 XXMFYRKKKTQETPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLPRVKIV 468
             +     K     R + R+Q+++P + NNF  ++QLF  ++  L K+P +G  P VK+V
Sbjct: 419 FDLVITNNKANAN-RNIMRSQVVEPVLVNNFLLYHQLFTHDNISLSKHPKKGSPPTVKMV 477

Query: 469 TEMKIGRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGAHGP 528
           TE     KV+TRVS+FE F +D +D++  L+ LCSGST+I E    P  +EVQVQG HG 
Sbjct: 478 TEKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEEL---PNGSEVQVQGPHGD 534

Query: 529 LIIDYLNKQGIPTKWIDF 546
           ++++Y  K GIP KW D+
Sbjct: 535 IVMEYFEKHGIPRKWFDY 552

>AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR117C
          Length = 542

 Score =  420 bits (1080), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 224/549 (40%), Positives = 323/549 (58%), Gaps = 18/549 (3%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60
           MFKKEP++   SN KNSERK+L  S +EQ     Y FS++ +K   +K Q + GTVYTD 
Sbjct: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60

Query: 61  NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE 120
           NN+P+WF+ KH +   PTVYSCW  P+LLP+V TH+ V+E +L  GA+LML GT+PPF  
Sbjct: 61  NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS 120

Query: 121 RCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKID 180
                +V GIAS   P V+ A+G+ +++L   ++V    G+AV+V+H + DGLC+ FK+ 
Sbjct: 121 GTRRGRVVGIASTRAPGVVKAVGICEMDLEGVTTVADTTGVAVRVLHTYGDGLCRVFKVQ 180

Query: 181 IXXXXXXXXXXXXXXXXXXXXXXXXSPKRETFHTEISIEDVAQVLDELSVEDVDHFFTRA 240
                                     P+ E   T    E +A+ L+ L++EDVDH  TRA
Sbjct: 181 --------REAPEASEAKGASPEAREPEAEPPKTAPG-EGLAEELERLTMEDVDHLLTRA 231

Query: 241 LYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTAKFLKHFEKVGFL 300
           +YYT   D  L +P+ AS FI+ H+L NLPP+D SQV +K++SW K AK LKHFE  G L
Sbjct: 232 VYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLLKHFEAQGLL 291

Query: 301 QLKGKGDDLVIVGVNKNKDELKNFVPYKTSGQTAS--KKNSNKDSSPGMMYSEKLYKPIN 358
            LKGK +   +V VN   + LK+F PY+T    AS   KNS+   S  ++Y    Y P  
Sbjct: 292 TLKGKPESFTVVSVNSAHEALKSFEPYRTVSDKASTGSKNSSTTQSLEIVYH---YVPNR 348

Query: 359 LGKDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVXXXXXXXXMFYRKKKT 418
                +    +   +  +  +++D + QY+ A+K VD  +K M+        + + K   
Sbjct: 349 TLLPQLNGLGISGGDALSAKDIRDRLEQYVAARKCVDPYDKSMLRLDDTLAQLLH-KNVN 407

Query: 419 QETPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLPRVKIVTEMKIGRKVV 478
            +TPR + R + +   ++ +F+E++ + +  D PL K P +G  P +K+  E KI +KVV
Sbjct: 408 ADTPRSLPRPEALAALLSRSFSEYFVVMRG-DAPLSK-PQKGRAPPIKVTNERKIYKKVV 465

Query: 479 TRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGAHGPLIIDYLNKQG 538
           T+VS+FE + +DPE+LAA LR  CSGSTTI + V + K  EVQVQG H   I+  LNK G
Sbjct: 466 TKVSNFEVYGVDPEELAAELRVRCSGSTTITD-VPNTKAVEVQVQGPHEATIVSILNKHG 524

Query: 539 IPTKWIDFE 547
           IP+K+I  +
Sbjct: 525 IPSKYITLD 533

>NCAS0I02730 Chr9 (505260..506447) [1188 bp, 395 aa] {ON} Anc_1.203
           YJL147C
          Length = 395

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 28/62 (45%), Gaps = 11/62 (17%)

Query: 482 SHFETF--KLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGAHGPLIIDYLNKQGI 539
           S F T   K + EDL + LR L  GS+TIGET+           G H P  +D   K   
Sbjct: 23  SQFSTVLSKAENEDLRSTLRLLTKGSSTIGETIQG---------GNHLPHRLDATTKTSA 73

Query: 540 PT 541
            T
Sbjct: 74  QT 75

>TBLA0A09210 Chr1 complement(2282468..2283226) [759 bp, 252 aa] {ON}
           Anc_5.685 YOR077W
          Length = 252

 Score = 30.4 bits (67), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 5/69 (7%)

Query: 273 DQSQVNMKKTSWKKTAKFLKHFEKVGFLQL---KGKGDDLVIVGVNKNKDELKNFVPYKT 329
           D+  ++M  T++    KF++H EK G +Q+   K   +D  +VG   N D  ++ + Y  
Sbjct: 98  DKDHIHMNSTTFTSLTKFIQHLEKTGKIQIHVDKASVNDGELVG--NNIDMGQSLISYID 155

Query: 330 SGQTASKKN 338
             Q A + N
Sbjct: 156 RSQNAIEHN 164

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,634,674
Number of extensions: 2626363
Number of successful extensions: 7780
Number of sequences better than 10.0: 37
Number of HSP's gapped: 7917
Number of HSP's successfully gapped: 46
Length of query: 558
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 443
Effective length of database: 40,294,809
Effective search space: 17850600387
Effective search space used: 17850600387
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)